F468274

General Info

Members Datasets Scaffolds Average Seq Length
603 239 598 355

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10019843|Ga0105239_100198435
Length 396
Sequence LPYFNFYLAFFDKVPGNFRQYQKELTRTCVILFLIFAIMKHSEFTQLLMQWHMQKNTRQMPWKGEKDPYKIWLSEVILQQTRVEQGWSYYEKFIKAYPTLAKLANAKDEEVFKLWEGLGYYNRCKNLLYTARFIVKELNGVFPDEYEKILSLKGVGPYTASAIASFAFNKPYAVVDGNVFRVLSRWFGIDTAIDSAEGIKIFTSLAGKLIDKKNAGLYNQAIMDFGATVCKPALPLCSACDLQENCVAHEKRLVNHLPVKEKLLQRKNRWFTWFLFTHRNKIFVTKRTGKDIWQNLFEFYLVETDEKTEWQTDTINEVLKNQLSIANADIVHISPVFSQQLTHQNIKAVFIKIELSSVPVSLESYTCIGFNDIGKFAFPGIINQYLQSASMQSTLF

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
3 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
4 2914759650 Rhizosphaericola mali Isolate Rhizosphere
5 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
6 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
7 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
8 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
160 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
163 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
215 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
216 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
217 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
218 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
219 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
220 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
221 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
222 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
231 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
235 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
237 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
238 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
239 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 0
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.32
Nodule 0
Rhizoplane 0.83
Rhizosphere 91.04
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1005534 3300001904 Unclassified 2132
2 JGI24740J21852_10018339 3300001979 Bacteria 2485
3 JGI25406J46586_10001483 3300003203 Bacteria 11059
4 rootH1_10156960 3300003316 Bacteria 1723
5 rootH2_10003341 3300003320 Bacteria 1939
6 rootH2_10065940 3300003320 Bacteria 2496
7 rootL2_10008821 3300003322 Bacteria 8297
8 rootL2_10088783 3300003322 Bacteria 1995
9 rootL2_10098621 3300003322 Unclassified 2139
10 rootL2_10249723 3300003322 Unclassified 2239
11 rootL2_10276898 3300003322 Bacteria 3654
12 rootH1_10034412 3300003316 Bacteria 4969
13 rootH1_10034412 3300003323 Bacteria 3310
14 rootH1_10104740 3300003323 Bacteria 2592
15 JGI25160J50197_1000629 3300003354 Bacteria 19720
16 Ga0055531_10000038 3300003794 Bacteria 143598
17 Ga0065165_1001823 3300005262 Bacteria 20859
18 Ga0065714_10100949 3300005288 Bacteria 1654
19 Ga0065712_10002781 3300005290 Bacteria 4678
20 Ga0065715_10015875 3300005293 Bacteria 1936
21 Ga0065707_10105112 3300005295 Unclassified 2661
22 Ga0070658_10121781 3300005327 Bacteria 2168
23 Ga0070676_10001354 3300005328 Bacteria 12323
24 Ga0070676_10006927 3300005328 Bacteria 6071
25 Ga0070676_10012348 3300005328 Bacteria 4658
26 Ga0070683_100003994 3300005329 Bacteria 12078
27 Ga0070683_100005727 3300005329 Bacteria 10386
28 Ga0070683_100390665 3300005329 Bacteria 1326
29 Ga0070690_100030757 3300005330 Unclassified 3340
30 Ga0070670_100044143 3300005331 Unclassified 3833
31 Ga0070670_100068090 3300005331 Bacteria 3055
32 Ga0070670_100248543 3300005331 Bacteria 1549
33 Ga0070677_10005047 3300005333 Bacteria 4334
34 Ga0068869_100002827 3300005334 Bacteria 10519
35 Ga0068869_100031991 3300005334 Bacteria 3704
36 Ga0068869_100085737 3300005334 Bacteria 2359
37 Ga0068869_100126773 3300005334 Unclassified 1958
38 Ga0068869_100205753 3300005334 Bacteria 1554
39 Ga0068869_100251429 3300005334 Bacteria 1412
40 Ga0068869_100284568 3300005334 Bacteria 1330
41 Ga0070666_10000039 3300005335 Bacteria 115360
42 Ga0070666_10000452 3300005335 Bacteria 24971
43 Ga0070666_10009397 3300005335 Bacteria 6093
44 Ga0070666_10013217 3300005335 Bacteria 5233
45 Ga0070666_10036452 3300005335 Bacteria 3265
46 Ga0070682_100000008 3300005337 Bacteria 322125
47 Ga0068868_100000280 3300005338 Bacteria 34319
48 Ga0068868_100019589 3300005338 Bacteria 5072
49 Ga0068868_100027020 3300005338 Bacteria 4376
50 Ga0068868_100098642 3300005338 Bacteria 2362
51 Ga0070660_100000353 3300005339 Bacteria 30722
52 Ga0070660_100020777 3300005339 Bacteria 4833
53 Ga0070660_100344127 3300005339 Unclassified 1227
54 Ga0070689_100006897 3300005340 Bacteria 7904
55 Ga0070689_100074941 3300005340 Bacteria 2648
56 Ga0070689_100126134 3300005340 Bacteria 2048
57 Ga0070689_100134250 3300005340 Bacteria 1986
58 Ga0070689_100345727 3300005340 Bacteria 1246
59 Ga0070691_10020464 3300005341 Bacteria 3057
60 Ga0070691_10046161 3300005341 Unclassified 2069
61 Ga0070661_100002742 3300005344 Bacteria 12078
62 Ga0070661_100016222 3300005344 Bacteria 5262
63 Ga0070661_100093644 3300005344 Unclassified 2226
64 Ga0070661_100245377 3300005344 Bacteria 1380
65 Ga0070668_100000267 3300005347 Bacteria 34430
66 Ga0070668_100010691 3300005347 Bacteria 6826
67 Ga0070668_100073485 3300005347 Unclassified 2666
68 Ga0070669_100001604 3300005353 Bacteria 16344
69 Ga0070669_100049929 3300005353 Bacteria 3055
70 Ga0070669_100074731 3300005353 Bacteria 2512
71 Ga0070675_100004009 3300005354 Bacteria 11177
72 Ga0070675_100092708 3300005354 Bacteria 2532
73 Ga0070675_100108134 3300005354 Bacteria 2349
74 Ga0070671_100045190 3300005355 Bacteria 3661
75 Ga0070674_100001880 3300005356 Bacteria 11400
76 Ga0070674_100054587 3300005356 Bacteria 2764
77 Ga0070674_100111318 3300005356 Bacteria 2011
78 Ga0070673_100005984 3300005364 Bacteria 7869
79 Ga0070673_100007830 3300005364 Bacteria 7077
80 Ga0070673_100023296 3300005364 Bacteria 4523
81 Ga0070673_100078147 3300005364 Bacteria 2676
82 Ga0070673_100099582 3300005364 Unclassified 2391
83 Ga0070673_100291390 3300005364 Bacteria 1434
84 Ga0070673_100423736 3300005364 Bacteria 1193
85 Ga0070688_100017479 3300005365 Unclassified 4116
86 Ga0070659_100058608 3300005366 Bacteria 3039
87 Ga0070659_100199075 3300005366 Bacteria 1648
88 Ga0070667_100016036 3300005367 Bacteria 6198
89 Ga0070667_100037795 3300005367 Bacteria 4047
90 Ga0070667_100116916 3300005367 Bacteria 2316
91 Ga0070667_100229618 3300005367 Bacteria 1654
92 Ga0070678_100012238 3300005456 Bacteria 5324
93 Ga0070678_100073378 3300005456 Bacteria 2568
94 Ga0070662_100006870 3300005457 Bacteria 7363
95 Ga0070662_100077966 3300005457 Unclassified 2460
96 Ga0070662_100146875 3300005457 Bacteria 1832
97 Ga0068867_100007549 3300005459 Bacteria 7693
98 Ga0068867_100012264 3300005459 Bacteria 6059
99 Ga0068867_100067288 3300005459 Bacteria 2670
100 Ga0068867_100077598 3300005459 Unclassified 2496
101 Ga0068867_100165847 3300005459 Bacteria 1745
102 Ga0068867_100197869 3300005459 Unclassified 1607
103 Ga0070685_10049189 3300005466 Unclassified 2431
104 Ga0070698_100009173 3300005471 Bacteria 10619
105 Ga0070698_100023341 3300005471 Bacteria 6466
106 Ga0070684_100004828 3300005535 Bacteria 10298
107 Ga0070684_100062327 3300005535 Bacteria 3266
108 Ga0068853_100001211 3300005539 Bacteria 18396
109 Ga0068853_100004182 3300005539 Bacteria 11128
110 Ga0068853_100029117 3300005539 Bacteria 4652
111 Ga0068853_100086424 3300005539 Bacteria 2750
112 Ga0068853_100208940 3300005539 Bacteria 1779
113 Ga0068853_100268382 3300005539 Bacteria 1571
114 Ga0070672_100003158 3300005543 Bacteria 10647
115 Ga0070672_100006757 3300005543 Bacteria 7740
116 Ga0070686_100099214 3300005544 Bacteria 1964
117 Ga0070665_100000002 3300005548 Bacteria 849037
118 Ga0070665_100000916 3300005548 Bacteria 37835
119 Ga0068855_100093870 3300005563 Bacteria 3460
120 Ga0068855_100130636 3300005563 Bacteria 2869
121 Ga0068855_100247385 3300005563 Bacteria 1990
122 Ga0068855_100351121 3300005563 Bacteria 1624
123 Ga0068855_100353910 3300005563 Unclassified 1617
124 Ga0070664_100005377 3300005564 Bacteria 10282
125 Ga0070664_100028328 3300005564 Bacteria 4659
126 Ga0070664_100335478 3300005564 Bacteria 1372
127 Ga0068857_100003544 3300005577 Bacteria 13049
128 Ga0068857_100077036 3300005577 Unclassified 2975
129 Ga0068857_100117539 3300005577 Bacteria 2392
130 Ga0068857_100345345 3300005577 Bacteria 1377
131 Ga0068854_100023226 3300005578 Bacteria 4234
132 Ga0068856_100010761 3300005614 Bacteria 8884
133 Ga0068856_100037969 3300005614 Bacteria 4727
134 Ga0068856_100092874 3300005614 Bacteria 3003
135 Ga0068852_100006499 3300005616 Bacteria 8451
136 Ga0068852_100011761 3300005616 Bacteria 6607
137 Ga0068852_100024082 3300005616 Bacteria 4914
138 Ga0068852_100111255 3300005616 Bacteria 2490
139 Ga0068852_100425437 3300005616 Bacteria 1310
140 Ga0068859_100000006 3300005617 Bacteria 421509
141 Ga0068859_100006972 3300005617 Bacteria 11470
142 Ga0068859_100071547 3300005617 Bacteria 3504
143 Ga0068859_100103313 3300005617 Bacteria 2907
144 Ga0068859_100112168 3300005617 Bacteria 2790
145 Ga0068859_100507145 3300005617 Bacteria 1301
146 Ga0068864_100000239 3300005618 Bacteria 49175
147 Ga0068864_100009898 3300005618 Bacteria 7863
148 Ga0068864_100041703 3300005618 Bacteria 3925
149 Ga0068864_100069416 3300005618 Bacteria 3064
150 Ga0068864_100109224 3300005618 Bacteria 2462
151 Ga0068861_100003670 3300005719 Bacteria 10241
152 Ga0068861_100007525 3300005719 Bacteria 7468
153 Ga0068861_100033589 3300005719 Bacteria 3786
154 Ga0068861_100036163 3300005719 Unclassified 3663
155 Ga0068861_100052191 3300005719 Bacteria 3107
156 Ga0068851_10000724 3300005834 Bacteria 14097
157 Ga0068863_100000808 3300005841 Bacteria 31389
158 Ga0068863_100002445 3300005841 Bacteria 18454
159 Ga0068863_100011454 3300005841 Bacteria 8575
160 Ga0068863_100117309 3300005841 Bacteria 2536
161 Ga0068863_100302577 3300005841 Bacteria 1551
162 Ga0068858_100000453 3300005842 Bacteria 42983
163 Ga0068858_100007148 3300005842 Bacteria 10835
164 Ga0068858_100188479 3300005842 Bacteria 1949
165 Ga0068860_100000003 3300005843 Bacteria 575741
166 Ga0068860_100000991 3300005843 Bacteria 31410
167 Ga0068860_100002063 3300005843 Bacteria 21160
168 Ga0068860_100012912 3300005843 Bacteria 8205
169 Ga0068860_100017617 3300005843 Bacteria 6959
170 Ga0068860_100036321 3300005843 Bacteria 4722
171 Ga0068860_100116491 3300005843 Bacteria 2556
172 Ga0068860_100185551 3300005843 Unclassified 2011
173 Ga0068862_100044327 3300005844 Bacteria 3794
174 Ga0081539_10000223 3300005985 Bacteria 133106
175 Ga0070715_10005236 3300006163 Bacteria 4310
176 Ga0075366_10032691 3300006195 Bacteria 3063
177 Ga0075366_10033812 3300006195 Bacteria 3012
178 Ga0097621_100000199 3300006237 Bacteria 38904
179 Ga0097621_100002337 3300006237 Bacteria 12996
180 Ga0097621_100016643 3300006237 Bacteria 5564
181 Ga0068871_100000319 3300006358 Bacteria 33457
182 Ga0068871_100003257 3300006358 Bacteria 11137
183 Ga0068871_100026260 3300006358 Bacteria 4542
184 Ga0068871_100253117 3300006358 Bacteria 1534
185 Ga0075428_100056938 3300006844 Bacteria 4280
186 Ga0075428_100116230 3300006844 Bacteria 2914
187 Ga0075430_100008070 3300006846 Bacteria 8897
188 Ga0075430_100267394 3300006846 Bacteria 1416
189 Ga0075431_100002276 3300006847 Bacteria 18407
190 Ga0075431_100016813 3300006847 Bacteria 7430
191 Ga0075431_100220363 3300006847 Bacteria 1935
192 Ga0075429_100002069 3300006880 Bacteria 16736
193 Ga0075429_100006815 3300006880 Bacteria 9914
194 Ga0075429_100010688 3300006880 Bacteria 7941
195 Ga0068865_100010178 3300006881 Bacteria 5846
196 Ga0068865_100036334 3300006881 Bacteria 3321
197 Ga0097620_100000006 3300006931 Bacteria 421509
198 Ga0097620_100000451 3300006931 Bacteria 40880
199 Ga0097620_100071550 3300006931 Bacteria 3504
200 Ga0097620_100103305 3300006931 Bacteria 2907
201 Ga0097620_100112164 3300006931 Bacteria 2790
202 Ga0097620_100507145 3300006931 Bacteria 1301
203 Ga0105251_10080151 3300009011 Bacteria 1510
204 Ga0105240_10002527 3300009093 Bacteria 29369
205 Ga0105240_10004802 3300009093 Bacteria 20368
206 Ga0105240_10021604 3300009093 Bacteria 8559
207 Ga0105240_10094371 3300009093 Unclassified 3650
208 Ga0105240_10139996 3300009093 Bacteria 2893
209 Ga0105240_10175692 3300009093 Bacteria 2532
210 Ga0111539_10000962 3300009094 Bacteria 37802
211 Ga0111539_10028416 3300009094 Bacteria 6822
212 Ga0111539_10061571 3300009094 Bacteria 4446
213 Ga0111539_10110171 3300009094 Bacteria 3231
214 Ga0111539_10571965 3300009094 Unclassified 1316
215 Ga0111539_10595732 3300009094 Bacteria 1287
216 Ga0105247_10003742 3300009101 Bacteria 9867
217 Ga0114129_10032094 3300009147 Bacteria 7424
218 Ga0114129_10204303 3300009147 Bacteria 2674
219 Ga0114129_10267659 3300009147 Unclassified 2287
220 Ga0105241_10000864 3300009174 Bacteria 22996
221 Ga0105241_10143700 3300009174 Unclassified 1945
222 Ga0105241_10210537 3300009174 Bacteria 1629
223 Ga0105242_10003357 3300009176 Bacteria 12455
224 Ga0105242_10029744 3300009176 Bacteria 4357
225 Ga0105242_10075350 3300009176 Bacteria 2809
226 Ga0105248_10045256 3300009177 Bacteria 4935
227 Ga0105237_10001982 3300009545 Bacteria 26058
228 Ga0105237_10005989 3300009545 Bacteria 13616
229 Ga0105237_10018657 3300009545 Bacteria 7172
230 Ga0105237_10033319 3300009545 Bacteria 5218
231 Ga0105237_10038552 3300009545 Unclassified 4826
232 Ga0105237_10047861 3300009545 Bacteria 4299
233 Ga0105237_10349931 3300009545 Bacteria 1482
234 Ga0105249_10001537 3300009553 Bacteria 20259
235 Ga0105249_10008791 3300009553 Bacteria 8814
236 Ga0105249_10008988 3300009553 Bacteria 8729
237 Ga0105249_10028901 3300009553 Bacteria 5004
238 Ga0105249_10201155 3300009553 Bacteria 1949
239 Ga0105249_10272104 3300009553 Unclassified 1688
240 Ga0105249_10465193 3300009553 Bacteria 1305
241 Ga0105239_10008984 3300010375 Bacteria 11311
242 Ga0105239_10019843 3300010375 Bacteria 7418
243 Ga0105239_10072111 3300010375 Unclassified 3796
244 Ga0105239_10086090 3300010375 Bacteria 3463
245 Ga0105239_10252133 3300010375 Bacteria 1982
246 Ga0105239_10396478 3300010375 Bacteria 1562
247 Ga0105239_10510823 3300010375 Bacteria 1367
248 Ga0105239_10649589 3300010375 Bacteria 1205
249 Ga0105246_10051676 3300011119 Bacteria 2823
250 Ga0105246_10255307 3300011119 Bacteria 1394
251 Ga0105246_10355813 3300011119 Bacteria 1201
252 Ga0157373_10007865 3300013100 Bacteria 7931
253 Ga0157373_10009480 3300013100 Bacteria 7193
254 Ga0157371_10011054 3300013102 Bacteria 6991
255 Ga0157371_10157253 3300013102 Bacteria 1623
256 Ga0157370_10009283 3300013104 Bacteria 10535
257 Ga0157374_10000168 3300013296 Bacteria 60649
258 Ga0157374_10022913 3300013296 Bacteria 5578
259 Ga0157374_10024773 3300013296 Bacteria 5380
260 Ga0157374_10058036 3300013296 Bacteria 3617
261 Ga0157374_10085729 3300013296 Bacteria 2996
262 Ga0157374_10161294 3300013296 Bacteria 2184
263 Ga0157374_10391679 3300013296 Bacteria 1385
264 Ga0157378_10025276 3300013297 Bacteria 5230
265 Ga0157378_10063950 3300013297 Bacteria 3289
266 Ga0157378_10085511 3300013297 Bacteria 2857
267 Ga0157378_10106429 3300013297 Bacteria 2566
268 Ga0157378_10111114 3300013297 Bacteria 2513
269 Ga0157378_10352911 3300013297 Bacteria 1437
270 Ga0157378_10356778 3300013297 Bacteria 1430
271 Ga0157378_10388052 3300013297 Bacteria 1373
272 Ga0157378_10398073 3300013297 Bacteria 1356
273 Ga0163162_10000171 3300013306 Bacteria 59945
274 Ga0163162_10000504 3300013306 Bacteria 36390
275 Ga0163162_10000635 3300013306 Bacteria 32493
276 Ga0163162_10001007 3300013306 Bacteria 26190
277 Ga0163162_10019395 3300013306 Bacteria 6669
278 Ga0163162_10050619 3300013306 Bacteria 4166
279 Ga0163162_10093604 3300013306 Bacteria 3090
280 Ga0163162_10141727 3300013306 Bacteria 2517
281 Ga0163162_10176577 3300013306 Unclassified 2261
282 Ga0163162_10201185 3300013306 Bacteria 2121
283 Ga0163162_10456314 3300013306 Bacteria 1410
284 Ga0163162_10558633 3300013306 Bacteria 1272
285 Ga0157372_10000215 3300013307 Bacteria 64407
286 Ga0157372_10014148 3300013307 Bacteria 8524
287 Ga0157372_10028285 3300013307 Bacteria 6118
288 Ga0157372_10067857 3300013307 Bacteria 4009
289 Ga0157372_10347035 3300013307 Bacteria 1729
290 Ga0157375_10000098 3300013308 Bacteria 88130
291 Ga0157375_10000500 3300013308 Bacteria 35438
292 Ga0157375_10006257 3300013308 Bacteria 10369
293 Ga0157375_10016610 3300013308 Bacteria 6618
294 Ga0157375_10029421 3300013308 Bacteria 5166
295 Ga0157375_10030623 3300013308 Bacteria 5076
296 Ga0157375_10031284 3300013308 Bacteria 5027
297 Ga0157375_10034938 3300013308 Bacteria 4794
298 Ga0157375_10091820 3300013308 Bacteria 3098
299 Ga0157375_10434798 3300013308 Bacteria 1478
300 Ga0157375_10493721 3300013308 Unclassified 1389
301 Ga0157375_10552308 3300013308 Bacteria 1313
302 Ga0163163_10000271 3300014325 Bacteria 52036
303 Ga0163163_10001158 3300014325 Bacteria 22414
304 Ga0163163_10060459 3300014325 Bacteria 3752
305 Ga0163163_10132727 3300014325 Bacteria 2530
306 Ga0163163_10147871 3300014325 Bacteria 2394
307 Ga0163163_10241144 3300014325 Bacteria 1857
308 Ga0157380_10001179 3300014326 Bacteria 16931
309 Ga0157380_10004406 3300014326 Bacteria 9758
310 Ga0157380_10022376 3300014326 Bacteria 4757
311 Ga0157380_10118363 3300014326 Bacteria 2239
312 Ga0157380_10168024 3300014326 Bacteria 1913
313 Ga0157377_10001079 3300014745 Bacteria 11553
314 Ga0157379_10002303 3300014968 Bacteria 15919
315 Ga0157379_10027927 3300014968 Bacteria 5022
316 Ga0157379_10042242 3300014968 Bacteria 4070
317 Ga0157379_10360786 3300014968 Bacteria 1332
318 Ga0157376_10000444 3300014969 Bacteria 26696
319 Ga0157376_10002197 3300014969 Bacteria 13158
320 Ga0157376_10005420 3300014969 Bacteria 8919
321 Ga0157376_10079805 3300014969 Bacteria 2806
322 Ga0163161_10001929 3300017792 Bacteria 15128
323 Ga0163161_10007014 3300017792 Bacteria 7792
324 Ga0163161_10025666 3300017792 Bacteria 4172
325 Ga0163161_10104782 3300017792 Bacteria 2109
326 Ga0163161_10105597 3300017792 Bacteria 2101
327 Ga0163161_10113265 3300017792 Bacteria 2030
328 Ga0163161_10226223 3300017792 Bacteria 1450
329 Ga0213876_10004211 3300021384 Bacteria 8072
330 Ga0213876_10062056 3300021384 Bacteria 1972
331 Ga0207426_1000059 3300025302 Bacteria 363842
332 Ga0209257_1000007 3300025304 Bacteria 1564415
333 Ga0207656_10003743 3300025321 Bacteria 5268
334 Ga0207682_10005197 3300025893 Bacteria 5328
335 Ga0207682_10005789 3300025893 Bacteria 5012
336 Ga0207682_10021884 3300025893 Bacteria 2516
337 Ga0207710_10046739 3300025900 Bacteria 1933
338 Ga0207680_10000037 3300025903 Bacteria 72773
339 Ga0207680_10016273 3300025903 Bacteria 3901
340 Ga0207647_10007443 3300025904 Bacteria 7909
341 Ga0207647_10049148 3300025904 Bacteria 2617
342 Ga0207645_10001928 3300025907 Bacteria 16746
343 Ga0207645_10076717 3300025907 Unclassified 2141
344 Ga0207643_10006710 3300025908 Bacteria 6173
345 Ga0207705_10112442 3300025909 Bacteria 2013
346 Ga0207654_10004449 3300025911 Bacteria 7072
347 Ga0207695_10000156 3300025913 Bacteria 204576
348 Ga0207695_10027728 3300025913 Bacteria 6302
349 Ga0207695_10122033 3300025913 Bacteria 2572
350 Ga0207695_10143304 3300025913 Unclassified 2336
351 Ga0207671_10004726 3300025914 Bacteria 12855
352 Ga0207671_10005234 3300025914 Bacteria 12049
353 Ga0207671_10008380 3300025914 Bacteria 8774
354 Ga0207671_10011061 3300025914 Bacteria 7386
355 Ga0207671_10014684 3300025914 Bacteria 6177
356 Ga0207671_10022624 3300025914 Unclassified 4749
357 Ga0207657_10005517 3300025919 Bacteria 13209
358 Ga0207657_10007579 3300025919 Bacteria 11123
359 Ga0207657_10047151 3300025919 Bacteria 3770
360 Ga0207657_10301526 3300025919 Unclassified 1269
361 Ga0207649_10004202 3300025920 Bacteria 7843
362 Ga0207649_10195207 3300025920 Bacteria 1426
363 Ga0207681_10004841 3300025923 Bacteria 8271
364 Ga0207694_10112133 3300025924 Bacteria 2170
365 Ga0207650_10007916 3300025925 Bacteria 7243
366 Ga0207650_10023649 3300025925 Unclassified 4361
367 Ga0207650_10205012 3300025925 Unclassified 1581
368 Ga0207650_10219329 3300025925 Unclassified 1530
369 Ga0207650_10229400 3300025925 Bacteria 1497
370 Ga0207659_10011016 3300025926 Bacteria 5698
371 Ga0207659_10134263 3300025926 Bacteria 1914
372 Ga0207644_10030033 3300025931 Bacteria 3774
373 Ga0207644_10097271 3300025931 Bacteria 2205
374 Ga0207690_10041154 3300025932 Bacteria 3027
375 Ga0207690_10171740 3300025932 Bacteria 1625
376 Ga0207706_10005992 3300025933 Bacteria 11304
377 Ga0207706_10007003 3300025933 Bacteria 10421
378 Ga0207706_10271372 3300025933 Bacteria 1480
379 Ga0207706_10279663 3300025933 Bacteria 1455
380 Ga0207706_10318724 3300025933 Bacteria 1353
381 Ga0207686_10088855 3300025934 Bacteria 2035
382 Ga0207670_10179866 3300025936 Bacteria 1592
383 Ga0207670_10233732 3300025936 Unclassified 1413
384 Ga0207669_10006791 3300025937 Bacteria 5259
385 Ga0207669_10044633 3300025937 Bacteria 2606
386 Ga0207669_10083868 3300025937 Bacteria 2051
387 Ga0207704_10004308 3300025938 Bacteria 6502
388 Ga0207704_10093726 3300025938 Bacteria 1980
389 Ga0207691_10000234 3300025940 Bacteria 54055
390 Ga0207691_10009264 3300025940 Bacteria 9447
391 Ga0207691_10030595 3300025940 Bacteria 5029
392 Ga0207691_10102286 3300025940 Bacteria 2556
393 Ga0207689_10001418 3300025942 Bacteria 22893
394 Ga0207689_10003300 3300025942 Bacteria 14776
395 Ga0207689_10005600 3300025942 Bacteria 11190
396 Ga0207689_10006499 3300025942 Bacteria 10325
397 Ga0207689_10043479 3300025942 Bacteria 3714
398 Ga0207689_10081544 3300025942 Bacteria 2659
399 Ga0207689_10102382 3300025942 Bacteria 2352
400 Ga0207689_10106305 3300025942 Bacteria 2306
401 Ga0207689_10134415 3300025942 Bacteria 2036
402 Ga0207689_10280845 3300025942 Bacteria 1379
403 Ga0207661_10117127 3300025944 Bacteria 2262
404 Ga0207661_10299974 3300025944 Bacteria 1440
405 Ga0207679_10001806 3300025945 Bacteria 13318
406 Ga0207679_10294847 3300025945 Bacteria 1395
407 Ga0207667_10001082 3300025949 Bacteria 34557
408 Ga0207667_10078432 3300025949 Bacteria 3423
409 Ga0207667_10174609 3300025949 Bacteria 2208
410 Ga0207667_10208782 3300025949 Unclassified 2002
411 Ga0207667_10289745 3300025949 Bacteria 1673
412 Ga0207651_10003601 3300025960 Bacteria 7628
413 Ga0207651_10003856 3300025960 Bacteria 7442
414 Ga0207651_10076405 3300025960 Bacteria 2394
415 Ga0207651_10329883 3300025960 Bacteria 1278
416 Ga0207712_10001573 3300025961 Bacteria 15371
417 Ga0207712_10008963 3300025961 Bacteria 6327
418 Ga0207712_10118222 3300025961 Bacteria 2001
419 Ga0207668_10013925 3300025972 Unclassified 4967
420 Ga0207668_10065897 3300025972 Bacteria 2565
421 Ga0207668_10194947 3300025972 Bacteria 1609
422 Ga0207640_10019464 3300025981 Bacteria 4011
423 Ga0207640_10139144 3300025981 Bacteria 1767
424 Ga0207658_10000950 3300025986 Bacteria 23916
425 Ga0207658_10252614 3300025986 Unclassified 1499
426 Ga0207658_10276546 3300025986 Bacteria 1438
427 Ga0207658_10302143 3300025986 Bacteria 1379
428 Ga0207677_10001355 3300026023 Bacteria 13116
429 Ga0207677_10060008 3300026023 Bacteria 2627
430 Ga0207677_10097364 3300026023 Bacteria 2155
431 Ga0207703_10003242 3300026035 Bacteria 13674
432 Ga0207703_10073714 3300026035 Bacteria 2824
433 Ga0207703_10184871 3300026035 Bacteria 1841
434 Ga0207639_10002981 3300026041 Bacteria 11397
435 Ga0207639_10005297 3300026041 Bacteria 8706
436 Ga0207639_10006018 3300026041 Bacteria 8229
437 Ga0207639_10067383 3300026041 Bacteria 2785
438 Ga0207639_10084625 3300026041 Bacteria 2520
439 Ga0207639_10279805 3300026041 Unclassified 1467
440 Ga0207678_10169205 3300026067 Bacteria 1866
441 Ga0207702_10023587 3300026078 Bacteria 5104
442 Ga0207641_10000186 3300026088 Bacteria 86601
443 Ga0207641_10000345 3300026088 Bacteria 55589
444 Ga0207641_10001042 3300026088 Bacteria 28066
445 Ga0207641_10039793 3300026088 Bacteria 3933
446 Ga0207641_10081111 3300026088 Bacteria 2817
447 Ga0207641_10240811 3300026088 Bacteria 1686
448 Ga0207648_10000755 3300026089 Bacteria 36347
449 Ga0207648_10002569 3300026089 Bacteria 19457
450 Ga0207648_10029202 3300026089 Bacteria 4890
451 Ga0207648_10148847 3300026089 Unclassified 2066
452 Ga0207648_10219957 3300026089 Bacteria 1688
453 Ga0207648_10358348 3300026089 Bacteria 1316
454 Ga0207676_10003530 3300026095 Bacteria 11067
455 Ga0207676_10006774 3300026095 Bacteria 8110
456 Ga0207676_10007715 3300026095 Bacteria 7649
457 Ga0207674_10002788 3300026116 Bacteria 21761
458 Ga0207674_10003327 3300026116 Bacteria 19761
459 Ga0207674_10137975 3300026116 Bacteria 2400
460 Ga0207674_10160997 3300026116 Bacteria 2199
461 Ga0207674_10204925 3300026116 Bacteria 1922
462 Ga0207675_100000260 3300026118 Bacteria 50253
463 Ga0207675_100005048 3300026118 Bacteria 12708
464 Ga0207675_100046526 3300026118 Bacteria 4054
465 Ga0207675_100048897 3300026118 Bacteria 3947
466 Ga0207675_100099732 3300026118 Bacteria 2735
467 Ga0207683_10016230 3300026121 Bacteria 6338
468 Ga0207683_10017895 3300026121 Bacteria 6042
469 Ga0207698_10016388 3300026142 Bacteria 4992
470 Ga0207698_10119563 3300026142 Bacteria 2227
471 Ga0207698_10121929 3300026142 Bacteria 2208
472 Ga0268266_10000073 3300028379 Bacteria 232074
473 Ga0268266_10002778 3300028379 Bacteria 18278
474 Ga0268266_10172749 3300028379 Bacteria 1962
475 Ga0268265_10045534 3300028380 Unclassified 3274
476 Ga0268265_10208784 3300028380 Bacteria 1700
477 Ga0268264_10000063 3300028381 Bacteria 301702
478 Ga0268264_10001589 3300028381 Bacteria 21046
479 Ga0268264_10004017 3300028381 Bacteria 12601
480 Ga0268264_10047843 3300028381 Bacteria 3557
481 Ga0268264_10161627 3300028381 Bacteria 2018
482 Ga0268264_10200961 3300028381 Bacteria 1823
483 Ga0268264_10234172 3300028381 Bacteria 1697
484 Ga0307517_10005143 3300028786 Bacteria 19867
485 Ga0307515_10000001 3300028794 Bacteria 4259510
486 Ga0307515_10000012 3300028794 Bacteria 582232
487 Ga0307515_10000021 3300028794 Bacteria 406008
488 Ga0307515_10099418 3300028794 Bacteria 3532
489 Ga0307511_10000232 3300030521 Bacteria 56875
490 Ga0265329_10051809 3300031242 Unclassified 1306
491 Ga0265327_10000013 3300031251 Bacteria 519549
492 Ga0265327_10000031 3300031251 Bacteria 325718
493 Ga0265327_10045706 3300031251 Bacteria 2325
494 Ga0307514_10110392 3300031649 Bacteria 1950
495 Ga0316576_10004652 3300031727 Bacteria 8266
496 Ga0316576_10131855 3300031727 Bacteria 1880
497 Ga0307516_10000675 3300031730 Bacteria 46218
498 Ga0307413_10034740 3300031824 Unclassified 2885
499 Ga0307416_100394418 3300032002 Bacteria 1419
500 Ga0307414_10000082 3300032004 Bacteria 87561
501 Ga0307507_10116122 3300033179 Bacteria 2163
502 Ga0307510_10000637 3300033180 Bacteria 35581
503 Ga0373955_0005793 3300035172 Bacteria 5580
504 Ga0373924_0041605 3300035410 Bacteria 1883
505 Ga0373935_0142180 3300035692 Bacteria 1622
506 Ga0373937_0000946 3300036401 Bacteria 24696
507 Ga0316584_0128796 3300036712 Bacteria 1890
508 Ga0373925_0251775 3300037068 Bacteria 1417
509 Ga0395899_0000025 3300037312 Bacteria 350927
510 Ga0395900_0036501 3300037418 Bacteria 5067
511 Ga0395900_0256225 3300037418 Bacteria 1749
512 Ga0395900_0277574 3300037418 Bacteria 1669
513 Ga0395905_0000049 3300037471 Bacteria 230719
514 Ga0400483_051963 3300039062 Bacteria 9882
515 Ga0400483_174686 3300039062 Bacteria 4870
516 Ga0436365_1039057 3300039437 Bacteria 4280
517 Ga0436365_1855296 3300039437 Bacteria 37922
518 Ga0436362_0693319 3300039453 Bacteria 1557
519 Ga0451577_0063184 3300042876 Bacteria 3302
520 Ga0466972_0000021 3300044658 Bacteria 196266
521 Ga0466972_0002104 3300044658 Bacteria 9771
522 Ga0453684_0006871 3300044712 Bacteria 21362
523 Ga0453684_0051490 3300044712 Bacteria 5397
524 Ga0453684_0084126 3300044712 Bacteria 3958
525 Ga0453684_0160981 3300044712 Unclassified 2655
526 Ga0466968_0027010 3300044735 Bacteria 2360
527 Ga0466970_0002595 3300044765 Bacteria 8708
528 Ga0466957_0180148 3300044842 Unclassified 1380
529 Ga0495592_0194846 3300046454 Bacteria 1371
530 Ga0495580_0091662 3300046472 Bacteria 2115
531 Ga0495606_0011733 3300046507 Bacteria 7111
532 Ga0495630_0001112 3300046517 Bacteria 18503
533 Ga0495648_0006012 3300046524 Bacteria 9964
534 Ga0495586_0040819 3300046535 Bacteria 2498
535 Ga0495587_0093014 3300046536 Bacteria 1741
536 Ga0495621_0004586 3300046539 Unclassified 3902
537 Ga0495667_0068364 3300046559 Bacteria 2320
538 Ga0495668_0000114 3300046616 Bacteria 127503
539 Ga0495668_0000451 3300046616 Bacteria 52539
540 Ga0495634_0006396 3300046642 Bacteria 8952
541 Ga0495611_0000037 3300046648 Bacteria 101602
542 Ga0495613_0072280 3300046689 Bacteria 2514
543 Ga0495672_0015450 3300047320 Bacteria 5182
544 Ga0495672_0017455 3300047320 Bacteria 4801
545 Ga0495672_0133243 3300047320 Unclassified 1305
546 Ga0495680_0025848 3300047322 Bacteria 4854
547 Ga0495687_000040 3300047443 Bacteria 230786
548 Ga0495675_0101584 3300047444 Bacteria 1799
549 Ga0496102_0181247 3300048905 Bacteria 1985
550 Ga0496104_0079880 3300048907 Bacteria 3118
551 Ga0496105_0180277 3300048908 Bacteria 1730
552 Ga0496109_0046409 3300048912 Unclassified 3946
553 Ga0496115_0369173 3300048918 Bacteria 1168
554 Ga0501034_0000007 3300049571 Bacteria 357805
555 Ga0501034_0091962 3300049571 Bacteria 3031
556 Ga0501034_0252799 3300049571 Unclassified 1706
557 Ga0501037_0020708 3300049573 Bacteria 4856
558 Ga0501072_0361137 3300049588 Bacteria 1153
559 Ga0501217_000113 3300049661 Bacteria 10474
560 Ga0501223_000703 3300049663 Bacteria 7965
561 Ga0501224_001424 3300049664 Bacteria 3172
562 Ga0501235_004741 3300049669 Bacteria 2942
563 Ga0501259_002482 3300049688 Bacteria 2992
564 Ga0501260_002522 3300049689 Bacteria 1588
565 Ga0501261_000485 3300049690 Bacteria 5086
566 Ga0501221_001544 3300049704 Bacteria 3813
567 Ga0501225_0001042 3300049705 Bacteria 8702
568 Ga0501080_0242745 3300049742 Bacteria 1644
569 Ga0501044_0062457 3300049823 Bacteria 3807
570 Ga0501044_0094586 3300049823 Bacteria 3012
571 Ga0501044_0256201 3300049823 Bacteria 1689
572 nmdc:mga0k408_32737_c1 3300050493 Bacteria 2970
573 nmdc:mga05p37_230328_c1 3300050507 Bacteria 2233
574 nmdc:mga05p37_230415_c1 3300050507 Unclassified 2232
575 nmdc:mga09592_107995_c1 3300050508 Bacteria 2387
576 nmdc:mga09592_361542_c1 3300050508 Bacteria 1256
577 nmdc:mga09592_40691_c1 3300050508 Bacteria 3905
578 nmdc:mga0qj67_126834_c1 3300050509 Bacteria 2065
579 nmdc:mga0qj67_7485_c1 3300050509 Bacteria 8063
580 nmdc:mga06r32_8239_c1 3300050510 Bacteria 9385
581 nmdc:mga08y16_105071_c1 3300050511 Bacteria 2940
582 nmdc:mga08y16_220660_c1 3300050511 Bacteria 1963
583 nmdc:mga08y16_288529_c1 3300050511 Unclassified 1692
584 nmdc:mga08y16_34762_c1 3300050511 Bacteria 5295
585 nmdc:mga08y16_588762_c1 3300050511 Unclassified 1122
586 Ga0495619_0136541 3300053085 Bacteria 1687
587 Ga0500644_0028909 3300053088 Bacteria 1738
588 Ga0500562_000012 3300053108 Bacteria 168210
589 Ga0500642_0004991 3300053130 Bacteria 4229
590 Ga0500642_0020611 3300053130 Bacteria 2594
591 Ga0500568_0026467 3300053139 Bacteria 2434
592 Ga0500577_0035943 3300053142 Bacteria 1771
593 Ga0500616_0001032 3300053153 Bacteria 29487
594 Ga0500616_0016523 3300053153 Bacteria 4199
595 Ga0500622_0000993 3300053156 Bacteria 23938
596 Ga0500622_0003615 3300053156 Bacteria 10176
597 Ga0500627_0008543 3300053158 Bacteria 3645
598 Ga0500637_0085291 3300053178 Bacteria 1826

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049571 Ga0501034_0091962 Ga0501034_0091962_1949_2950 304
2 3300005262 Ga0065165_1001823 Ga0065165_100182317 308
3 3300005335 Ga0070666_10036452 Ga0070666_100364522 308
4 3300005719 Ga0068861_100052191 Ga0068861_1000521913 308
5 3300026118 Ga0207675_100099732 Ga0207675_1000997323 308
6 3300044712 Ga0453684_0160981 Ga0453684_0160981_944_1993 308
7 3300026116 Ga0207674_10003327 Ga0207674_1000332714 309
8 3300005548 Ga0070665_100000002 Ga0070665_100000002482 310
9 3300009176 Ga0105242_10029744 Ga0105242_100297443 310
10 3300044712 Ga0453684_0051490 Ga0453684_0051490_1630_2706 311
11 iso_pu_bacteria 2914759650 2914763599 311
12 3300003322 rootL2_10008821 rootL2_100088214 312
13 3300005356 Ga0070674_100054587 Ga0070674_1000545873 314
14 3300006847 Ga0075431_100016813 Ga0075431_1000168135 314
15 3300006880 Ga0075429_100006815 Ga0075429_1000068155 314
16 3300005841 Ga0068863_100011454 Ga0068863_1000114544 315
17 3300025913 Ga0207695_10000156 Ga0207695_100001563 315
18 3300005843 Ga0068860_100116491 Ga0068860_1001164912 316
19 3300031251 Ga0265327_10045706 Ga0265327_100457062 316
20 3300049823 Ga0501044_0062457 Ga0501044_0062457_2674_3675 316
21 3300053088 Ga0500644_0028909 Ga0500644_0028909_705_1700 316
22 3300053108 Ga0500562_000012 Ga0500562_000012_31537_32532 316
23 3300005337 Ga0070682_100000008 Ga0070682_100000008268 317
24 3300005356 Ga0070674_100001880 Ga0070674_1000018806 317
25 3300009094 Ga0111539_10110171 Ga0111539_101101713 317
26 3300013306 Ga0163162_10001007 Ga0163162_100010076 317
27 3300031242 Ga0265329_10051809 Ga0265329_100518091 317
28 3300039062 Ga0400483_051963 Ga0400483_051963_5346_6398 317
29 3300039062 Ga0400483_174686 Ga0400483_174686_3647_4699 317
30 3300046524 Ga0495648_0006012 Ga0495648_0006012_5601_6686 317
31 3300050511 nmdc:mga08y16_220660_c1 nmdc:mga08y16_220660_c1_83_1132 317
32 3300053130 Ga0500642_0004991 Ga0500642_0004991_763_1848 317
33 3300053156 Ga0500622_0003615 Ga0500622_0003615_1343_2428 317
34 3300049669 Ga0501235_004741 Ga0501235_004741_55_1047 318
35 3300003320 rootH2_10065940 rootH2_100659402 319
36 3300003323 rootH1_10104740 rootH1_101047401 319
37 3300005616 Ga0068852_100011761 Ga0068852_1000117617 319
38 3300013306 Ga0163162_10093604 Ga0163162_100936042 319
39 3300013308 Ga0157375_10031284 Ga0157375_100312844 319
40 3300014326 Ga0157380_10022376 Ga0157380_100223763 319
41 3300025909 Ga0207705_10112442 Ga0207705_101124422 319
42 3300025914 Ga0207671_10005234 Ga0207671_100052346 319
43 3300025925 Ga0207650_10205012 Ga0207650_102050121 319
44 3300028786 Ga0307517_10005143 Ga0307517_1000514311 319
45 3300030521 Ga0307511_10000232 Ga0307511_1000023224 319
46 3300033180 Ga0307510_10000637 Ga0307510_100006376 319
47 3300048918 Ga0496115_0369173 Ga0496115_0369173_115_1131 319
48 3300005331 Ga0070670_100248543 Ga0070670_1002485431 320
49 3300005354 Ga0070675_100092708 Ga0070675_1000927082 320
50 3300005539 Ga0068853_100001211 Ga0068853_10000121113 320
51 3300025986 Ga0207658_10276546 Ga0207658_102765461 320
52 3300026142 Ga0207698_10121929 Ga0207698_101219293 320
53 3300031824 Ga0307413_10034740 Ga0307413_100347403 320
54 3300032002 Ga0307416_100394418 Ga0307416_1003944181 320
55 3300005328 Ga0070676_10012348 Ga0070676_100123485 323
56 3300005334 Ga0068869_100205753 Ga0068869_1002057531 323
57 3300005347 Ga0070668_100073485 Ga0070668_1000734853 323
58 3300005459 Ga0068867_100077598 Ga0068867_1000775983 323
59 3300005563 Ga0068855_100130636 Ga0068855_1001306363 323
60 3300005617 Ga0068859_100103313 Ga0068859_1001033133 323
61 3300006195 Ga0075366_10033812 Ga0075366_100338122 323
62 3300006931 Ga0097620_100103305 Ga0097620_1001033053 323
63 3300025942 Ga0207689_10134415 Ga0207689_101344153 323
64 3300025949 Ga0207667_10174609 Ga0207667_101746091 323
65 3300026089 Ga0207648_10000755 Ga0207648_1000075521 323
66 3300049588 Ga0501072_0361137 Ga0501072_0361137_99_1088 323
67 3300049742 Ga0501080_0242745 Ga0501080_0242745_600_1589 323
68 3300050508 nmdc:mga09592_361542_c1 nmdc:mga09592_361542_c1_216_1208 323
69 3300005330 Ga0070690_100030757 Ga0070690_1000307571 324
70 3300005334 Ga0068869_100085737 Ga0068869_1000857373 324
71 3300005338 Ga0068868_100098642 Ga0068868_1000986423 324
72 3300005340 Ga0070689_100134250 Ga0070689_1001342501 324
73 3300005344 Ga0070661_100245377 Ga0070661_1002453771 324
74 3300005535 Ga0070684_100062327 Ga0070684_1000623275 324
75 3300005564 Ga0070664_100335478 Ga0070664_1003354781 324
76 3300005577 Ga0068857_100345345 Ga0068857_1003453451 324
77 3300005617 Ga0068859_100071547 Ga0068859_1000715471 324
78 3300005618 Ga0068864_100041703 Ga0068864_1000417035 324
79 3300006931 Ga0097620_100071550 Ga0097620_1000715501 324
80 3300011119 Ga0105246_10355813 Ga0105246_103558131 324
81 3300013308 Ga0157375_10029421 Ga0157375_100294215 324
82 3300017792 Ga0163161_10104782 Ga0163161_101047822 324
83 3300017792 Ga0163161_10105597 Ga0163161_101055971 324
84 3300025904 Ga0207647_10049148 Ga0207647_100491482 324
85 3300025920 Ga0207649_10195207 Ga0207649_101952071 324
86 3300025932 Ga0207690_10041154 Ga0207690_100411545 324
87 3300025933 Ga0207706_10279663 Ga0207706_102796631 324
88 3300025933 Ga0207706_10318724 Ga0207706_103187241 324
89 3300025936 Ga0207670_10179866 Ga0207670_101798661 324
90 3300025942 Ga0207689_10106305 Ga0207689_101063051 324
91 3300025944 Ga0207661_10117127 Ga0207661_101171271 324
92 3300025986 Ga0207658_10302143 Ga0207658_103021431 324
93 3300026023 Ga0207677_10097364 Ga0207677_100973643 324
94 3300026067 Ga0207678_10169205 Ga0207678_101692053 324
95 3300026095 Ga0207676_10007715 Ga0207676_100077157 324
96 3300026116 Ga0207674_10160997 Ga0207674_101609973 324
97 3300028379 Ga0268266_10172749 Ga0268266_101727492 324
98 3300028381 Ga0268264_10161627 Ga0268264_101616272 324
99 3300046454 Ga0495592_0194846 Ga0495592_0194846_90_1085 324
100 3300049823 Ga0501044_0094586 Ga0501044_0094586_1734_2795 324
101 3300050511 nmdc:mga08y16_288529_c1 nmdc:mga08y16_288529_c1_642_1637 324
102 3300050511 nmdc:mga08y16_588762_c1 nmdc:mga08y16_588762_c1_104_1099 324
103 3300005365 Ga0070688_100017479 Ga0070688_1000174794 325
104 3300005614 Ga0068856_100010761 Ga0068856_1000107617 327
105 3300026078 Ga0207702_10023587 Ga0207702_100235875 327
106 3300037418 Ga0395900_0277574 Ga0395900_0277574_628_1611 327
107 3300005334 Ga0068869_100031991 Ga0068869_1000319911 329
108 3300005335 Ga0070666_10000039 Ga0070666_1000003953 329
109 3300005340 Ga0070689_100126134 Ga0070689_1001261341 329
110 3300005364 Ga0070673_100023296 Ga0070673_1000232963 329
111 3300005367 Ga0070667_100016036 Ga0070667_1000160364 329
112 3300005616 Ga0068852_100006499 Ga0068852_1000064994 329
113 3300005617 Ga0068859_100000006 Ga0068859_100000006124 329
114 3300005618 Ga0068864_100009898 Ga0068864_1000098985 329
115 3300005841 Ga0068863_100000808 Ga0068863_10000080833 329
116 3300005842 Ga0068858_100007148 Ga0068858_1000071489 329
117 3300005843 Ga0068860_100012912 Ga0068860_1000129126 329
118 3300006931 Ga0097620_100000006 Ga0097620_100000006124 329
119 3300021384 Ga0213876_10062056 Ga0213876_100620561 329
120 3300025900 Ga0207710_10046739 Ga0207710_100467391 329
121 3300025903 Ga0207680_10000037 Ga0207680_1000003755 329
122 3300025914 Ga0207671_10014684 Ga0207671_100146846 329
123 3300025937 Ga0207669_10006791 Ga0207669_100067912 329
124 3300025940 Ga0207691_10102286 Ga0207691_101022863 329
125 3300025942 Ga0207689_10005600 Ga0207689_100056006 329
126 3300026035 Ga0207703_10003242 Ga0207703_100032429 329
127 3300026088 Ga0207641_10000186 Ga0207641_1000018641 329
128 3300026095 Ga0207676_10006774 Ga0207676_100067746 329
129 3300026142 Ga0207698_10119563 Ga0207698_101195634 329
130 3300028381 Ga0268264_10200961 Ga0268264_102009612 329
131 3300039437 Ga0436365_1039057 Ga0436365_1039057_1703_2776 329
132 3300053178 Ga0500637_0085291 Ga0500637_0085291_526_1611 330
133 3300003322 rootL2_10276898 rootL2_102768985 331
134 3300003323 rootH1_10034412 rootH1_100344122 331
135 3300003794 Ga0055531_10000038 Ga0055531_10000038126 331
136 3300005341 Ga0070691_10046161 Ga0070691_100461612 331
137 3300005344 Ga0070661_100093644 Ga0070661_1000936441 331
138 3300005563 Ga0068855_100093870 Ga0068855_1000938704 331
139 3300005577 Ga0068857_100003544 Ga0068857_1000035444 331
140 3300005616 Ga0068852_100024082 Ga0068852_1000240824 331
141 3300005843 Ga0068860_100000991 Ga0068860_10000099111 331
142 3300025304 Ga0209257_1000007 Ga0209257_1000007899 331
143 3300025904 Ga0207647_10007443 Ga0207647_100074434 331
144 3300025913 Ga0207695_10122033 Ga0207695_101220333 331
145 3300025914 Ga0207671_10008380 Ga0207671_100083806 331
146 3300025924 Ga0207694_10112133 Ga0207694_101121331 331
147 3300025936 Ga0207670_10233732 Ga0207670_102337321 331
148 3300025949 Ga0207667_10001082 Ga0207667_1000108214 331
149 3300026023 Ga0207677_10060008 Ga0207677_100600083 331
150 3300026142 Ga0207698_10016388 Ga0207698_100163884 331
151 3300028794 Ga0307515_10000012 Ga0307515_10000012256 331
152 3300028794 Ga0307515_10099418 Ga0307515_100994182 331
153 3300031649 Ga0307514_10110392 Ga0307514_101103922 331
154 3300037312 Ga0395899_0000025 Ga0395899_0000025_206820_207866 331
155 3300037418 Ga0395900_0036501 Ga0395900_0036501_613_1659 331
156 3300009093 Ga0105240_10139996 Ga0105240_101399961 332
157 3300009093 Ga0105240_10175692 Ga0105240_101756923 332
158 3300009174 Ga0105241_10143700 Ga0105241_101437002 332
159 3300009545 Ga0105237_10047861 Ga0105237_100478614 332
160 3300010375 Ga0105239_10008984 Ga0105239_100089844 332
161 3300011119 Ga0105246_10255307 Ga0105246_102553072 332
162 3300013104 Ga0157370_10009283 Ga0157370_100092838 332
163 3300013307 Ga0157372_10014148 Ga0157372_100141484 332
164 3300025913 Ga0207695_10027728 Ga0207695_100277283 332
165 3300044842 Ga0466957_0180148 Ga0466957_0180148_39_1124 332
166 3300005843 Ga0068860_100000003 Ga0068860_10000000397 333
167 3300013297 Ga0157378_10111114 Ga0157378_101111142 333
168 3300028379 Ga0268266_10000073 Ga0268266_1000007347 333
169 3300028381 Ga0268264_10000063 Ga0268264_1000006315 333
170 iso_pu_bacteria 2884634485 2884635906 333
171 3300005354 Ga0070675_100108134 Ga0070675_1001081343 334
172 3300005617 Ga0068859_100112168 Ga0068859_1001121682 334
173 3300006931 Ga0097620_100112164 Ga0097620_1001121642 334
174 3300009094 Ga0111539_10028416 Ga0111539_100284166 334
175 3300009094 Ga0111539_10061571 Ga0111539_100615712 334
176 3300009147 Ga0114129_10032094 Ga0114129_100320947 334
177 3300014326 Ga0157380_10004406 Ga0157380_100044065 334
178 3300014326 Ga0157380_10168024 Ga0157380_101680242 334
179 3300025893 Ga0207682_10021884 Ga0207682_100218841 334
180 3300025926 Ga0207659_10134263 Ga0207659_101342632 334
181 3300025937 Ga0207669_10044633 Ga0207669_100446333 334
182 3300031727 Ga0316576_10004652 Ga0316576_100046528 334
183 3300036712 Ga0316584_0128796 Ga0316584_0128796_20_1087 334
184 3300037471 Ga0395905_0000049 Ga0395905_0000049_158840_159895 334
185 3300050508 nmdc:mga09592_40691_c1 nmdc:mga09592_40691_c1_874_1920 334
186 3300050511 nmdc:mga08y16_105071_c1 nmdc:mga08y16_105071_c1_1636_2682 334
187 iso_pu_bacteria 2818991444 2819586189 334
188 iso_pu_bacteria 2919692658 2919693558 334
189 iso_pu_bacteria 2929154850 2929158896 334
190 3300005340 Ga0070689_100074941 Ga0070689_1000749413 335
191 3300025986 Ga0207658_10252614 Ga0207658_102526142 335
192 3300031727 Ga0316576_10131855 Ga0316576_101318553 335
193 3300003203 JGI25406J46586_10001483 JGI25406J46586_100014833 336
194 3300003322 rootL2_10088783 rootL2_100887831 336
195 3300003322 rootL2_10249723 rootL2_102497232 336
196 3300005327 Ga0070658_10121781 Ga0070658_101217813 336
197 3300005329 Ga0070683_100005727 Ga0070683_10000572710 336
198 3300005335 Ga0070666_10013217 Ga0070666_100132174 336
199 3300005338 Ga0068868_100027020 Ga0068868_1000270203 336
200 3300005344 Ga0070661_100016222 Ga0070661_1000162226 336
201 3300005364 Ga0070673_100005984 Ga0070673_1000059842 336
202 3300005366 Ga0070659_100058608 Ga0070659_1000586083 336
203 3300005367 Ga0070667_100116916 Ga0070667_1001169162 336
204 3300005457 Ga0070662_100006870 Ga0070662_1000068702 336
205 3300005539 Ga0068853_100029117 Ga0068853_1000291171 336
206 3300005563 Ga0068855_100247385 Ga0068855_1002473853 336
207 3300005563 Ga0068855_100351121 Ga0068855_1003511212 336
208 3300005564 Ga0070664_100028328 Ga0070664_1000283285 336
209 3300005614 Ga0068856_100092874 Ga0068856_1000928742 336
210 3300005985 Ga0081539_10000223 Ga0081539_1000022357 336
211 3300013100 Ga0157373_10009480 Ga0157373_100094802 336
212 3300013102 Ga0157371_10011054 Ga0157371_100110547 336
213 3300013296 Ga0157374_10022913 Ga0157374_100229131 336
214 3300013307 Ga0157372_10000215 Ga0157372_1000021534 336
215 3300021384 Ga0213876_10004211 Ga0213876_100042114 336
216 3300025903 Ga0207680_10016273 Ga0207680_100162734 336
217 3300025949 Ga0207667_10289745 Ga0207667_102897452 336
218 3300026041 Ga0207639_10084625 Ga0207639_100846252 336
219 3300039437 Ga0436365_1855296 Ga0436365_1855296_18341_19393 336
220 3300039453 Ga0436362_0693319 Ga0436362_0693319_370_1422 336
221 3300049571 Ga0501034_0252799 Ga0501034_0252799_358_1419 336
222 iso_pu_bacteria 2911138879 2911139919 336
223 3300003316 rootH1_10156960 rootH1_101569601 337
224 3300005334 Ga0068869_100251429 Ga0068869_1002514291 337
225 3300005539 Ga0068853_100268382 Ga0068853_1002683822 337
226 3300006358 Ga0068871_100026260 Ga0068871_1000262603 337
227 3300009545 Ga0105237_10018657 Ga0105237_100186573 337
228 3300010375 Ga0105239_10252133 Ga0105239_102521332 337
229 3300010375 Ga0105239_10510823 Ga0105239_105108232 337
230 3300013306 Ga0163162_10558633 Ga0163162_105586331 337
231 3300013308 Ga0157375_10030623 Ga0157375_100306233 337
232 3300025942 Ga0207689_10280845 Ga0207689_102808452 337
233 3300026088 Ga0207641_10081111 Ga0207641_100811113 337
234 3300028794 Ga0307515_10000001 Ga0307515_100000012121 337
235 3300031251 Ga0265327_10000031 Ga0265327_1000003137 337
236 3300046472 Ga0495580_0091662 Ga0495580_0091662_860_1915 337
237 3300046616 Ga0495668_0000451 Ga0495668_0000451_47182_48243 337
238 3300053130 Ga0500642_0020611 Ga0500642_0020611_591_1652 337
239 3300053142 Ga0500577_0035943 Ga0500577_0035943_375_1436 337
240 3300053153 Ga0500616_0001032 Ga0500616_0001032_15734_16795 337
241 3300053158 Ga0500627_0008543 Ga0500627_0008543_754_1815 337
242 3300005328 Ga0070676_10001354 Ga0070676_100013544 338
243 3300005334 Ga0068869_100002827 Ga0068869_1000028274 338
244 3300005335 Ga0070666_10000452 Ga0070666_1000045216 338
245 3300005338 Ga0068868_100000280 Ga0068868_1000002804 338
246 3300005339 Ga0070660_100344127 Ga0070660_1003441271 338
247 3300005347 Ga0070668_100000267 Ga0070668_10000026727 338
248 3300005364 Ga0070673_100007830 Ga0070673_1000078306 338
249 3300005457 Ga0070662_100077966 Ga0070662_1000779663 338
250 3300005459 Ga0068867_100007549 Ga0068867_1000075497 338
251 3300005539 Ga0068853_100004182 Ga0068853_1000041828 338
252 3300005543 Ga0070672_100003158 Ga0070672_1000031588 338
253 3300005548 Ga0070665_100000916 Ga0070665_10000091618 338
254 3300005563 Ga0068855_100353910 Ga0068855_1003539102 338
255 3300005618 Ga0068864_100000239 Ga0068864_10000023925 338
256 3300005719 Ga0068861_100036163 Ga0068861_1000361631 338
257 3300005834 Ga0068851_10000724 Ga0068851_1000072411 338
258 3300005841 Ga0068863_100002445 Ga0068863_1000024454 338
259 3300005842 Ga0068858_100000453 Ga0068858_10000045314 338
260 3300005843 Ga0068860_100002063 Ga0068860_10000206310 338
261 3300006237 Ga0097621_100002337 Ga0097621_1000023379 338
262 3300006237 Ga0097621_100016643 Ga0097621_1000166432 338
263 3300006358 Ga0068871_100003257 Ga0068871_1000032579 338
264 3300006358 Ga0068871_100253117 Ga0068871_1002531172 338
265 3300006881 Ga0068865_100010178 Ga0068865_1000101787 338
266 3300009093 Ga0105240_10004802 Ga0105240_1000480218 338
267 3300009093 Ga0105240_10094371 Ga0105240_100943713 338
268 3300009101 Ga0105247_10003742 Ga0105247_100037427 338
269 3300009174 Ga0105241_10210537 Ga0105241_102105371 338
270 3300009545 Ga0105237_10001982 Ga0105237_1000198211 338
271 3300009545 Ga0105237_10349931 Ga0105237_103499312 338
272 3300009553 Ga0105249_10001537 Ga0105249_100015376 338
273 3300009553 Ga0105249_10008988 Ga0105249_100089883 338
274 3300010375 Ga0105239_10072111 Ga0105239_100721113 338
275 3300010375 Ga0105239_10396478 Ga0105239_103964782 338
276 3300011119 Ga0105246_10051676 Ga0105246_100516763 338
277 3300013296 Ga0157374_10000168 Ga0157374_1000016827 338
278 3300013297 Ga0157378_10025276 Ga0157378_100252764 338
279 3300013297 Ga0157378_10352911 Ga0157378_103529111 338
280 3300013306 Ga0163162_10000171 Ga0163162_1000017150 338
281 3300013306 Ga0163162_10000504 Ga0163162_100005047 338
282 3300013308 Ga0157375_10000098 Ga0157375_1000009810 338
283 3300013308 Ga0157375_10034938 Ga0157375_100349384 338
284 3300014325 Ga0163163_10000271 Ga0163163_1000027131 338
285 3300014325 Ga0163163_10132727 Ga0163163_101327274 338
286 3300014968 Ga0157379_10002303 Ga0157379_1000230310 338
287 3300014968 Ga0157379_10027927 Ga0157379_100279273 338
288 3300014969 Ga0157376_10002197 Ga0157376_1000219712 338
289 3300014969 Ga0157376_10005420 Ga0157376_100054204 338
290 3300017792 Ga0163161_10007014 Ga0163161_100070144 338
291 3300025321 Ga0207656_10003743 Ga0207656_100037433 338
292 3300025907 Ga0207645_10001928 Ga0207645_100019287 338
293 3300025913 Ga0207695_10143304 Ga0207695_101433042 338
294 3300025919 Ga0207657_10301526 Ga0207657_103015261 338
295 3300025933 Ga0207706_10007003 Ga0207706_100070039 338
296 3300025938 Ga0207704_10004308 Ga0207704_100043086 338
297 3300025940 Ga0207691_10000234 Ga0207691_100002348 338
298 3300025942 Ga0207689_10006499 Ga0207689_100064998 338
299 3300025949 Ga0207667_10208782 Ga0207667_102087822 338
300 3300025960 Ga0207651_10003601 Ga0207651_100036012 338
301 3300025972 Ga0207668_10013925 Ga0207668_100139255 338
302 3300025986 Ga0207658_10000950 Ga0207658_100009504 338
303 3300026023 Ga0207677_10001355 Ga0207677_100013557 338
304 3300026041 Ga0207639_10002981 Ga0207639_1000298110 338
305 3300026041 Ga0207639_10006018 Ga0207639_100060182 338
306 3300026088 Ga0207641_10001042 Ga0207641_1000104222 338
307 3300026089 Ga0207648_10002569 Ga0207648_100025692 338
308 3300026095 Ga0207676_10003530 Ga0207676_100035306 338
309 3300028379 Ga0268266_10002778 Ga0268266_1000277816 338
310 3300028381 Ga0268264_10004017 Ga0268264_1000401711 338
311 3300028794 Ga0307515_10000021 Ga0307515_1000002136 338
312 3300031251 Ga0265327_10000013 Ga0265327_1000001354 338
313 3300033179 Ga0307507_10116122 Ga0307507_101161223 338
314 3300048912 Ga0496109_0046409 Ga0496109_0046409_155_1213 338
315 3300053156 Ga0500622_0000993 Ga0500622_0000993_18202_19269 338
316 3300005333 Ga0070677_10005047 Ga0070677_100050473 339
317 3300005341 Ga0070691_10020464 Ga0070691_100204644 339
318 3300005456 Ga0070678_100012238 Ga0070678_1000122383 339
319 3300005543 Ga0070672_100006757 Ga0070672_1000067574 339
320 3300013297 Ga0157378_10063950 Ga0157378_100639502 339
321 3300025893 Ga0207682_10005197 Ga0207682_100051974 339
322 3300025940 Ga0207691_10009264 Ga0207691_100092644 339
323 3300025972 Ga0207668_10065897 Ga0207668_100658973 339
324 3300026121 Ga0207683_10017895 Ga0207683_100178953 339
325 3300044658 Ga0466972_0000021 Ga0466972_0000021_157670_158776 339
326 3300044765 Ga0466970_0002595 Ga0466970_0002595_2109_3215 339
327 3300005843 Ga0068860_100017617 Ga0068860_1000176174 340
328 3300013296 Ga0157374_10058036 Ga0157374_100580363 340
329 3300013306 Ga0163162_10000635 Ga0163162_1000063519 340
330 3300013308 Ga0157375_10493721 Ga0157375_104937211 340
331 3300025949 Ga0207667_10078432 Ga0207667_100784322 340
332 3300028381 Ga0268264_10001589 Ga0268264_100015894 340
333 3300047320 Ga0495672_0017455 Ga0495672_0017455_2381_3463 340
334 3300047320 Ga0495672_0133243 Ga0495672_0133243_198_1283 340
335 3300053139 Ga0500568_0026467 Ga0500568_0026467_488_1567 340
336 3300053153 Ga0500616_0016523 Ga0500616_0016523_456_1529 340
337 3300005339 Ga0070660_100000353 Ga0070660_1000003532 341
338 3300005355 Ga0070671_100045190 Ga0070671_1000451904 341
339 3300006237 Ga0097621_100000199 Ga0097621_10000019922 341
340 3300006358 Ga0068871_100000319 Ga0068871_10000031930 341
341 3300009177 Ga0105248_10045256 Ga0105248_100452563 341
342 3300009553 Ga0105249_10201155 Ga0105249_102011551 341
343 3300013297 Ga0157378_10085511 Ga0157378_100855112 341
344 3300013308 Ga0157375_10000500 Ga0157375_100005003 341
345 3300014968 Ga0157379_10042242 Ga0157379_100422423 341
346 3300014969 Ga0157376_10000444 Ga0157376_1000044425 341
347 3300017792 Ga0163161_10001929 Ga0163161_100019299 341
348 3300025914 Ga0207671_10022624 Ga0207671_100226245 341
349 3300025919 Ga0207657_10005517 Ga0207657_1000551712 341
350 3300025931 Ga0207644_10030033 Ga0207644_100300333 341
351 3300025938 Ga0207704_10093726 Ga0207704_100937262 341
352 3300044712 Ga0453684_0006871 Ga0453684_0006871_9948_11039 341
353 3300048905 Ga0496102_0181247 Ga0496102_0181247_730_1836 341
354 3300048908 Ga0496105_0180277 Ga0496105_0180277_446_1552 341
355 3300049573 Ga0501037_0020708 Ga0501037_0020708_1752_2825 341
356 3300003320 rootH2_10003341 rootH2_100033412 342
357 3300003322 rootL2_10098621 rootL2_100986212 342
358 3300005539 Ga0068853_100208940 Ga0068853_1002089402 342
359 3300005614 Ga0068856_100037969 Ga0068856_1000379694 342
360 3300009093 Ga0105240_10002527 Ga0105240_100025277 342
361 3300009093 Ga0105240_10021604 Ga0105240_100216048 342
362 3300009174 Ga0105241_10000864 Ga0105241_1000086416 342
363 3300009545 Ga0105237_10005989 Ga0105237_100059899 342
364 3300009545 Ga0105237_10033319 Ga0105237_100333195 342
365 3300009545 Ga0105237_10038552 Ga0105237_100385521 342
366 3300013296 Ga0157374_10161294 Ga0157374_101612942 342
367 3300013307 Ga0157372_10067857 Ga0157372_100678573 342
368 3300013307 Ga0157372_10347035 Ga0157372_103470352 342
369 3300014325 Ga0163163_10147871 Ga0163163_101478714 342
370 3300025911 Ga0207654_10004449 Ga0207654_100044493 342
371 3300025914 Ga0207671_10004726 Ga0207671_1000472610 342
372 3300025919 Ga0207657_10007579 Ga0207657_1000757910 342
373 3300025933 Ga0207706_10005992 Ga0207706_100059923 342
374 3300026041 Ga0207639_10005297 Ga0207639_100052974 342
375 3300026041 Ga0207639_10279805 Ga0207639_102798051 342
376 3300031730 Ga0307516_10000675 Ga0307516_1000067540 342
377 3300044658 Ga0466972_0002104 Ga0466972_0002104_8281_9366 342
378 3300044735 Ga0466968_0027010 Ga0466968_0027010_1157_2242 342
379 3300046507 Ga0495606_0011733 Ga0495606_0011733_3867_4952 342
380 3300046648 Ga0495611_0000037 Ga0495611_0000037_10202_11287 342
381 3300047443 Ga0495687_000040 Ga0495687_000040_19259_20344 342
382 3300049571 Ga0501034_0000007 Ga0501034_0000007_48788_49882 342
383 3300006931 Ga0097620_100000451 Ga0097620_1000004518 343
384 3300025925 Ga0207650_10229400 Ga0207650_102294002 343
385 3300037068 Ga0373925_0251775 Ga0373925_0251775_92_1144 343
386 3300042876 Ga0451577_0063184 Ga0451577_0063184_302_1438 343
387 3300001979 JGI24740J21852_10018339 JGI24740J21852_100183393 345
388 3300006195 Ga0075366_10032691 Ga0075366_100326913 345
389 3300025914 Ga0207671_10011061 Ga0207671_100110613 345
390 3300032004 Ga0307414_10000082 Ga0307414_100000824 346
391 3300005288 Ga0065714_10100949 Ga0065714_101009492 347
392 3300026088 Ga0207641_10039793 Ga0207641_100397935 347
393 3300046616 Ga0495668_0000114 Ga0495668_0000114_22515_23585 347
394 3300005618 Ga0068864_100069416 Ga0068864_1000694163 348
395 3300013307 Ga0157372_10028285 Ga0157372_100282854 348
396 3300014325 Ga0163163_10001158 Ga0163163_100011585 348
397 3300049823 Ga0501044_0256201 Ga0501044_0256201_206_1330 348
398 3300003354 JGI25160J50197_1000629 JGI25160J50197_100062914 349
399 3300005353 Ga0070669_100049929 Ga0070669_1000499292 349
400 3300005471 Ga0070698_100009173 Ga0070698_1000091731 349
401 3300005471 Ga0070698_100023341 Ga0070698_1000233415 349
402 3300006844 Ga0075428_100056938 Ga0075428_1000569385 349
403 3300006844 Ga0075428_100116230 Ga0075428_1001162302 349
404 3300006846 Ga0075430_100267394 Ga0075430_1002673941 349
405 3300006847 Ga0075431_100220363 Ga0075431_1002203632 349
406 3300006880 Ga0075429_100002069 Ga0075429_1000020693 349
407 3300009147 Ga0114129_10204303 Ga0114129_102043033 349
408 3300025302 Ga0207426_1000059 Ga0207426_1000059129 349
409 3300026118 Ga0207675_100048897 Ga0207675_1000488973 349
410 3300050507 nmdc:mga05p37_230328_c1 nmdc:mga05p37_230328_c1_1129_2199 349
411 3300050508 nmdc:mga09592_107995_c1 nmdc:mga09592_107995_c1_415_1485 349
412 3300050509 nmdc:mga0qj67_126834_c1 nmdc:mga0qj67_126834_c1_66_1136 349
413 3300005353 Ga0070669_100074731 Ga0070669_1000747311 350
414 3300005364 Ga0070673_100423736 Ga0070673_1004237361 350
415 3300005719 Ga0068861_100033589 Ga0068861_1000335893 350
416 3300005841 Ga0068863_100302577 Ga0068863_1003025772 350
417 3300009094 Ga0111539_10571965 Ga0111539_105719651 350
418 3300009094 Ga0111539_10595732 Ga0111539_105957321 350
419 3300009553 Ga0105249_10272104 Ga0105249_102721041 350
420 3300009553 Ga0105249_10465193 Ga0105249_104651931 350
421 3300013306 Ga0163162_10456314 Ga0163162_104563142 350
422 3300013308 Ga0157375_10434798 Ga0157375_104347982 350
423 3300017792 Ga0163161_10226223 Ga0163161_102262231 350
424 3300025893 Ga0207682_10005789 Ga0207682_100057895 350
425 3300025908 Ga0207643_10006710 Ga0207643_100067104 350
426 3300025942 Ga0207689_10102382 Ga0207689_101023823 350
427 3300025960 Ga0207651_10329883 Ga0207651_103298832 350
428 3300025961 Ga0207712_10001573 Ga0207712_100015735 350
429 3300025961 Ga0207712_10118222 Ga0207712_101182222 350
430 3300025972 Ga0207668_10194947 Ga0207668_101949472 350
431 3300026035 Ga0207703_10184871 Ga0207703_101848711 350
432 3300026088 Ga0207641_10000345 Ga0207641_1000034524 350
433 3300026118 Ga0207675_100046526 Ga0207675_1000465265 350
434 3300028381 Ga0268264_10234172 Ga0268264_102341721 350
435 3300046539 Ga0495621_0004586 Ga0495621_0004586_944_2017 350
436 3300047320 Ga0495672_0015450 Ga0495672_0015450_2524_3609 350
437 3300005364 Ga0070673_100291390 Ga0070673_1002913901 351
438 3300005459 Ga0068867_100067288 Ga0068867_1000672882 351
439 3300005617 Ga0068859_100006972 Ga0068859_10000697210 351
440 3300005842 Ga0068858_100188479 Ga0068858_1001884791 351
441 3300005843 Ga0068860_100036321 Ga0068860_1000363213 351
442 3300009176 Ga0105242_10003357 Ga0105242_100033573 351
443 3300009176 Ga0105242_10075350 Ga0105242_100753503 351
444 3300013297 Ga0157378_10106429 Ga0157378_101064292 351
445 3300025925 Ga0207650_10007916 Ga0207650_100079163 351
446 3300025925 Ga0207650_10219329 Ga0207650_102193292 351
447 3300025934 Ga0207686_10088855 Ga0207686_100888551 351
448 3300025942 Ga0207689_10003300 Ga0207689_100033003 351
449 3300026089 Ga0207648_10029202 Ga0207648_100292022 351
450 3300026116 Ga0207674_10204925 Ga0207674_102049251 351
451 3300028381 Ga0268264_10047843 Ga0268264_100478432 351
452 3300050493 nmdc:mga0k408_32737_c1 nmdc:mga0k408_32737_c1_345_1433 351
453 3300005347 Ga0070668_100010691 Ga0070668_1000106913 352
454 3300005356 Ga0070674_100111318 Ga0070674_1001113182 352
455 3300005459 Ga0068867_100197869 Ga0068867_1001978691 352
456 3300005719 Ga0068861_100007525 Ga0068861_1000075253 352
457 3300006881 Ga0068865_100036334 Ga0068865_1000363343 352
458 3300025937 Ga0207669_10083868 Ga0207669_100838682 352
459 3300025942 Ga0207689_10001418 Ga0207689_100014188 352
460 3300026089 Ga0207648_10358348 Ga0207648_103583481 352
461 3300026118 Ga0207675_100005048 Ga0207675_1000050483 352
462 3300028380 Ga0268265_10208784 Ga0268265_102087841 352
463 3300049661 Ga0501217_000113 Ga0501217_000113_2082_3179 352
464 3300049663 Ga0501223_000703 Ga0501223_000703_1987_3084 352
465 3300049664 Ga0501224_001424 Ga0501224_001424_2014_3111 352
466 3300049688 Ga0501259_002482 Ga0501259_002482_1316_2413 352
467 3300049689 Ga0501260_002522 Ga0501260_002522_450_1547 352
468 3300049690 Ga0501261_000485 Ga0501261_000485_1510_2607 352
469 3300049704 Ga0501221_001544 Ga0501221_001544_982_2079 352
470 3300049705 Ga0501225_0001042 Ga0501225_0001042_3198_4295 352
471 3300005329 Ga0070683_100390665 Ga0070683_1003906651 353
472 3300005340 Ga0070689_100345727 Ga0070689_1003457271 353
473 3300005367 Ga0070667_100037795 Ga0070667_1000377955 353
474 3300005457 Ga0070662_100146875 Ga0070662_1001468751 353
475 3300005616 Ga0068852_100111255 Ga0068852_1001112551 353
476 3300005618 Ga0068864_100109224 Ga0068864_1001092243 353
477 3300005841 Ga0068863_100117309 Ga0068863_1001173092 353
478 3300006846 Ga0075430_100008070 Ga0075430_1000080705 353
479 3300006847 Ga0075431_100002276 Ga0075431_1000022766 353
480 3300006880 Ga0075429_100010688 Ga0075429_1000106885 353
481 3300009011 Ga0105251_10080151 Ga0105251_100801512 353
482 3300009147 Ga0114129_10267659 Ga0114129_102676593 353
483 3300009553 Ga0105249_10028901 Ga0105249_100289015 353
484 3300010375 Ga0105239_10649589 Ga0105239_106495891 353
485 3300013296 Ga0157374_10391679 Ga0157374_103916791 353
486 3300013297 Ga0157378_10356778 Ga0157378_103567781 353
487 3300013306 Ga0163162_10019395 Ga0163162_100193956 353
488 3300013308 Ga0157375_10016610 Ga0157375_100166103 353
489 3300013308 Ga0157375_10552308 Ga0157375_105523081 353
490 3300014326 Ga0157380_10118363 Ga0157380_101183631 353
491 3300025944 Ga0207661_10299974 Ga0207661_102999741 353
492 3300025961 Ga0207712_10008963 Ga0207712_100089635 353
493 3300026035 Ga0207703_10073714 Ga0207703_100737143 353
494 3300050507 nmdc:mga05p37_230415_c1 nmdc:mga05p37_230415_c1_362_1477 353
495 3300050509 nmdc:mga0qj67_7485_c1 nmdc:mga0qj67_7485_c1_842_1957 353
496 3300050510 nmdc:mga06r32_8239_c1 nmdc:mga06r32_8239_c1_495_1610 353
497 3300005329 Ga0070683_100003994 Ga0070683_1000039941 354
498 3300005334 Ga0068869_100284568 Ga0068869_1002845681 354
499 3300005339 Ga0070660_100020777 Ga0070660_1000207775 354
500 3300005344 Ga0070661_100002742 Ga0070661_1000027429 354
501 3300005366 Ga0070659_100199075 Ga0070659_1001990752 354
502 3300005535 Ga0070684_100004828 Ga0070684_1000048281 354
503 3300005539 Ga0068853_100086424 Ga0068853_1000864243 354
504 3300005564 Ga0070664_100005377 Ga0070664_1000053778 354
505 3300005577 Ga0068857_100117539 Ga0068857_1001175391 354
506 3300005616 Ga0068852_100425437 Ga0068852_1004254371 354
507 3300005617 Ga0068859_100507145 Ga0068859_1005071451 354
508 3300006931 Ga0097620_100507145 Ga0097620_1005071451 354
509 3300013100 Ga0157373_10007865 Ga0157373_100078656 354
510 3300013102 Ga0157371_10157253 Ga0157371_101572532 354
511 3300013296 Ga0157374_10085729 Ga0157374_100857294 354
512 3300013297 Ga0157378_10388052 Ga0157378_103880521 354
513 3300013306 Ga0163162_10050619 Ga0163162_100506191 354
514 3300014325 Ga0163163_10060459 Ga0163163_100604595 354
515 3300014968 Ga0157379_10360786 Ga0157379_103607861 354
516 3300017792 Ga0163161_10113265 Ga0163161_101132652 354
517 3300025919 Ga0207657_10047151 Ga0207657_100471513 354
518 3300025920 Ga0207649_10004202 Ga0207649_100042026 354
519 3300025931 Ga0207644_10097271 Ga0207644_100972713 354
520 3300025932 Ga0207690_10171740 Ga0207690_101717401 354
521 3300025940 Ga0207691_10030595 Ga0207691_100305955 354
522 3300025942 Ga0207689_10043479 Ga0207689_100434791 354
523 3300025945 Ga0207679_10001806 Ga0207679_100018061 354
524 3300025981 Ga0207640_10139144 Ga0207640_101391442 354
525 3300026041 Ga0207639_10067383 Ga0207639_100673832 354
526 3300026088 Ga0207641_10240811 Ga0207641_102408112 354
527 3300026089 Ga0207648_10219957 Ga0207648_102199572 354
528 3300026116 Ga0207674_10137975 Ga0207674_101379751 354
529 3300035172 Ga0373955_0005793 Ga0373955_0005793_1444_2529 354
530 3300035410 Ga0373924_0041605 Ga0373924_0041605_136_1221 354
531 3300035692 Ga0373935_0142180 Ga0373935_0142180_232_1317 354
532 3300036401 Ga0373937_0000946 Ga0373937_0000946_13842_14927 354
533 3300046517 Ga0495630_0001112 Ga0495630_0001112_6952_8037 354
534 3300046535 Ga0495586_0040819 Ga0495586_0040819_1099_2184 354
535 3300046536 Ga0495587_0093014 Ga0495587_0093014_55_1140 354
536 3300046559 Ga0495667_0068364 Ga0495667_0068364_649_1734 354
537 3300046642 Ga0495634_0006396 Ga0495634_0006396_1127_2212 354
538 3300046689 Ga0495613_0072280 Ga0495613_0072280_375_1460 354
539 3300047322 Ga0495680_0025848 Ga0495680_0025848_2317_3402 354
540 3300047444 Ga0495675_0101584 Ga0495675_0101584_223_1308 354
541 3300048907 Ga0496104_0079880 Ga0496104_0079880_933_2009 354
542 3300053085 Ga0495619_0136541 Ga0495619_0136541_129_1214 354
543 3300005331 Ga0070670_100068090 Ga0070670_1000680904 355
544 3300005335 Ga0070666_10009397 Ga0070666_100093975 355
545 3300005338 Ga0068868_100019589 Ga0068868_1000195891 355
546 3300005364 Ga0070673_100078147 Ga0070673_1000781471 355
547 3300005367 Ga0070667_100229618 Ga0070667_1002296182 355
548 3300005456 Ga0070678_100073378 Ga0070678_1000733783 355
549 3300005459 Ga0068867_100165847 Ga0068867_1001658472 355
550 3300005544 Ga0070686_100099214 Ga0070686_1000992143 355
551 3300005578 Ga0068854_100023226 Ga0068854_1000232262 355
552 3300006163 Ga0070715_10005236 Ga0070715_100052363 355
553 3300010375 Ga0105239_10019843 Ga0105239_100198435 355
554 3300010375 Ga0105239_10086090 Ga0105239_100860904 355
555 3300013296 Ga0157374_10024773 Ga0157374_100247732 355
556 3300013297 Ga0157378_10398073 Ga0157378_103980732 355
557 3300013306 Ga0163162_10141727 Ga0163162_101417273 355
558 3300013308 Ga0157375_10091820 Ga0157375_100918202 355
559 3300014325 Ga0163163_10241144 Ga0163163_102411442 355
560 3300014969 Ga0157376_10079805 Ga0157376_100798051 355
561 3300017792 Ga0163161_10025666 Ga0163161_100256663 355
562 3300025933 Ga0207706_10271372 Ga0207706_102713722 355
563 3300025942 Ga0207689_10081544 Ga0207689_100815443 355
564 3300025945 Ga0207679_10294847 Ga0207679_102948471 355
565 3300025960 Ga0207651_10076405 Ga0207651_100764053 355
566 3300026121 Ga0207683_10016230 Ga0207683_100162303 355
567 3300037418 Ga0395900_0256225 Ga0395900_0256225_173_1243 355
568 3300044712 Ga0453684_0084126 Ga0453684_0084126_2679_3821 355
569 3300005290 Ga0065712_10002781 Ga0065712_100027815 357
570 3300005295 Ga0065707_10105112 Ga0065707_101051121 357
571 3300005328 Ga0070676_10006927 Ga0070676_100069273 357
572 3300005331 Ga0070670_100044143 Ga0070670_1000441433 357
573 3300005334 Ga0068869_100126773 Ga0068869_1001267732 357
574 3300005340 Ga0070689_100006897 Ga0070689_1000068976 357
575 3300005353 Ga0070669_100001604 Ga0070669_10000160410 357
576 3300005354 Ga0070675_100004009 Ga0070675_1000040098 357
577 3300005364 Ga0070673_100099582 Ga0070673_1000995823 357
578 3300005459 Ga0068867_100012264 Ga0068867_1000122646 357
579 3300005466 Ga0070685_10049189 Ga0070685_100491894 357
580 3300005577 Ga0068857_100077036 Ga0068857_1000770363 357
581 3300005719 Ga0068861_100003670 Ga0068861_1000036705 357
582 3300005843 Ga0068860_100185551 Ga0068860_1001855512 357
583 3300005844 Ga0068862_100044327 Ga0068862_1000443275 357
584 3300009094 Ga0111539_10000962 Ga0111539_1000096231 357
585 3300009553 Ga0105249_10008791 Ga0105249_100087914 357
586 3300013306 Ga0163162_10176577 Ga0163162_101765772 357
587 3300013308 Ga0157375_10006257 Ga0157375_100062577 357
588 3300014326 Ga0157380_10001179 Ga0157380_1000117913 357
589 3300014745 Ga0157377_10001079 Ga0157377_100010794 357
590 3300025907 Ga0207645_10076717 Ga0207645_100767172 357
591 3300025923 Ga0207681_10004841 Ga0207681_100048413 357
592 3300025925 Ga0207650_10023649 Ga0207650_100236494 357
593 3300025926 Ga0207659_10011016 Ga0207659_100110161 357
594 3300025960 Ga0207651_10003856 Ga0207651_100038565 357
595 3300025981 Ga0207640_10019464 Ga0207640_100194641 357
596 3300026089 Ga0207648_10148847 Ga0207648_101488472 357
597 3300026116 Ga0207674_10002788 Ga0207674_100027889 357
598 3300026118 Ga0207675_100000260 Ga0207675_10000026041 357
599 3300028380 Ga0268265_10045534 Ga0268265_100455342 357
600 3300050511 nmdc:mga08y16_34762_c1 nmdc:mga08y16_34762_c1_2027_3157 357
601 3300013306 Ga0163162_10201185 Ga0163162_102011852 358
602 3300005293 Ga0065715_10015875 Ga0065715_100158752 366
603 3300001904 JGI24736J21556_1005534 JGI24736J21556_10055343 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00633

HHH

Helix-hairpin-helix motif

137

166

0.95

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

73

205

0.95

PF14815

NUDIX_4

NUDIX domain

272

388

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1kg3-assembly1.cif.gz_A crystal structure of the core fragment of muty from e.coli at 1.55a resolution 0.9573 22 242
1kg7-assembly1.cif.gz_A crystal structure of the e161a mutant of e.coli muty (core fragment) 0.9568 21 242
1kg6-assembly1.cif.gz_A crystal structure of the k142r mutant of e.coli muty (core fragment) 0.9563 22 242
1kg4-assembly1.cif.gz_A crystal structure of the k142a mutant of e. coli muty (core fragment) 0.9563 22 242
1wef-assembly1.cif.gz_A catalytic domain of muty from escherichia coli k20a mutant 0.9556 22 243
ID Description Score Start End Superfamily
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9575 40 150 1.10.340.30
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9547 40 151 1.10.340.30
1rrqA02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9466 40 151 1.10.340.30
1kg2A02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9411 40 150 1.10.340.30
af_A0A1D6IX31_1_95_1.10.1670.10 Mainly Alpha;Orthogonal Bundle;Endonuclease Iii, domain 2;Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 0.9404 59 150 1.10.1670.10
ID Description Score Start End GO Terms
AF-A0A353Y599-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9811 59 170 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A7Y2Y7Z9-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9757 25 192 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-A0A7C2RCT4-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9747 24 229 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539
AF-A0A836X7G4-F1-model_v4 Adenine DNA glycosylase (EC 3.2.2.31) 0.9702 59 196 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051536
AF-T1BBA5-F1-model_v4 Adenine DNA glycosylase 0.968 70 232 GO:0000701
GO:0006284
GO:0006298
GO:0032357
GO:0034039
GO:0035485
GO:0046872
GO:0051539

Feature Viewer

pLDDT pTM Quality
92.52 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map