F468161

General Info

Members Datasets Scaffolds Average Seq Length
602 322 1204 364

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10068649|Ga0111539_100686493
Length 392
Sequence VGGDGRAARGGARPGAGGAGSEVTMAGVRLQSLRRRFGDVVALDGIDLDIASGEFVSFLGPSGCGKTTALRLIAGFDRPTSGRVFVGDKDITGVAPNKRDIGMVFQAYSLFPNMTSVRNVEFGLRVRRQGRGDRRTRALELLELVGLGHAADRYPHQLSGGMQQRVALARALAIEPRLLLLDEPLSALDAKVRVQLREEIRRIQTRLGITTIYVTHDQEEALSISDRVAVLSQGQIEQIGTPAEIYGAPATPFVAEFVGTMNRIESTVADPDNGRVHYEGSSLAVDAARGRQRGERVLVLVRPETVQVEAAASSENGLTGEVVSQTFLGSVTRLRVLAGPAEWTADLSAERAAALPIGAQVSLHFPPSSAKLLTLEGGAAEGLEAAAADSVE

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
134 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
135 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
136 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
137 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
182 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
185 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
191 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
207 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
215 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
235 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
236 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
242 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
243 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
244 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
245 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
246 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
257 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
258 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
269 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
270 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
295 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
296 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
297 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
298 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
299 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
300 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
301 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
302 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
303 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
304 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
305 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
306 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
307 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
308 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
309 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
310 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
311 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
312 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
313 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
314 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
315 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
316 2891562705 Microbispora tritici MT50 Isolate Unclassified
317 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
318 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
319 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
320 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
321 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
322 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.01
Metatranscriptomes 0.83
Isolates 2.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.16
Nodule 0
Rhizoplane 6.31
Rhizosphere 88.04
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10068649 3300009094 Bacteria 4185
2 JGI24743J22301_10004581 3300001991 Bacteria 2262
3 JGI24738J21930_10005514 3300002075 Bacteria 3026
4 JGI24744J21845_10003117 3300002077 Bacteria 3399
5 Ga0070658_10021015 3300005327 Bacteria 5229
6 Ga0070658_10037918 3300005327 Bacteria 3886
7 Ga0070658_10099103 3300005327 Bacteria 2408
8 Ga0070658_10124935 3300005327 Bacteria 2141
9 Ga0070683_100028507 3300005329 Bacteria 5046
10 Ga0070683_100037617 3300005329 Bacteria 4430
11 Ga0070683_100107185 3300005329 Bacteria 2634
12 Ga0070683_100173743 3300005329 Bacteria 2045
13 Ga0070683_100183465 3300005329 Bacteria 1986
14 Ga0070683_100368580 3300005329 Bacteria 1368
15 Ga0070670_100040997 3300005331 Bacteria 3979
16 Ga0070670_100126877 3300005331 Bacteria 2202
17 Ga0070666_10074430 3300005335 Bacteria 2315
18 Ga0070680_100008048 3300005336 Bacteria 8051
19 Ga0070680_100011877 3300005336 Bacteria 6756
20 Ga0070680_100023947 3300005336 Bacteria 4873
21 Ga0070680_100162573 3300005336 Bacteria 1876
22 Ga0070682_100008572 3300005337 Bacteria 5771
23 Ga0068868_100022812 3300005338 Bacteria 4730
24 Ga0070660_100005959 3300005339 Bacteria 8425
25 Ga0070660_100010773 3300005339 Bacteria 6472
26 Ga0070660_100014838 3300005339 Bacteria 5623
27 Ga0070660_100024165 3300005339 Bacteria 4507
28 Ga0070660_100065706 3300005339 Bacteria 2823
29 Ga0070691_10006513 3300005341 Bacteria 5340
30 Ga0070687_100041154 3300005343 Bacteria 2334
31 Ga0070661_100003244 3300005344 Bacteria 11212
32 Ga0070661_100004837 3300005344 Bacteria 9273
33 Ga0070661_100055438 3300005344 Bacteria 2902
34 Ga0070692_10002220 3300005345 Bacteria 7443
35 Ga0070668_100050068 3300005347 Bacteria 3215
36 Ga0070674_100271703 3300005356 Bacteria 1340
37 Ga0070674_100299936 3300005356 Bacteria 1280
38 Ga0070673_100005214 3300005364 Bacteria 8299
39 Ga0070659_100020846 3300005366 Bacteria 4985
40 Ga0070659_100032153 3300005366 Bacteria 4068
41 Ga0070659_100184068 3300005366 Bacteria 1715
42 Ga0070703_10023978 3300005406 Bacteria 1800
43 Ga0070714_100059342 3300005435 Bacteria 3280
44 Ga0070714_100439082 3300005435 Bacteria 1238
45 Ga0070701_10018506 3300005438 Bacteria 3275
46 Ga0070700_100082112 3300005441 Bacteria 2084
47 Ga0070663_100012183 3300005455 Bacteria 5428
48 Ga0070663_100066847 3300005455 Bacteria 2605
49 Ga0070678_100010115 3300005456 Bacteria 5744
50 Ga0070662_100019080 3300005457 Bacteria 4650
51 Ga0070681_10006050 3300005458 Bacteria 11732
52 Ga0070681_10026629 3300005458 Bacteria 5812
53 Ga0070681_10032838 3300005458 Bacteria 5211
54 Ga0070681_10040724 3300005458 Bacteria 4654
55 Ga0070681_10046513 3300005458 Bacteria 4339
56 Ga0070681_10077704 3300005458 Bacteria 3277
57 Ga0070681_10137190 3300005458 Bacteria 2376
58 Ga0068867_100131443 3300005459 Bacteria 1946
59 Ga0070707_100005697 3300005468 Bacteria 11625
60 Ga0070707_100013002 3300005468 Bacteria 7777
61 Ga0070698_100049133 3300005471 Bacteria 4308
62 Ga0070698_100085259 3300005471 Bacteria 3146
63 Ga0070679_100004225 3300005530 Bacteria 13255
64 Ga0070679_100012703 3300005530 Bacteria 8055
65 Ga0070679_100127666 3300005530 Bacteria 2525
66 Ga0070679_100169282 3300005530 Bacteria 2157
67 Ga0070679_100202978 3300005530 Bacteria 1947
68 Ga0070679_100290608 3300005530 Bacteria 1586
69 Ga0070684_100003748 3300005535 Bacteria 11470
70 Ga0070684_100018284 3300005535 Bacteria 5772
71 Ga0070684_100058754 3300005535 Bacteria 3361
72 Ga0070684_100084085 3300005535 Bacteria 2820
73 Ga0070684_100167755 3300005535 Bacteria 1993
74 Ga0070697_100074727 3300005536 Bacteria 2785
75 Ga0068853_100000569 3300005539 Bacteria 25263
76 Ga0068853_100402369 3300005539 Bacteria 1281
77 Ga0070672_100192819 3300005543 Bacteria 1702
78 Ga0070696_100158802 3300005546 Bacteria 1665
79 Ga0070693_100195798 3300005547 Bacteria 1310
80 Ga0070665_100144177 3300005548 Bacteria 2385
81 Ga0070704_100093734 3300005549 Bacteria 2245
82 Ga0068855_100006908 3300005563 Bacteria 13767
83 Ga0068855_100013836 3300005563 Bacteria 9729
84 Ga0068855_100024003 3300005563 Bacteria 7300
85 Ga0068855_100138866 3300005563 Bacteria 2772
86 Ga0070664_100153225 3300005564 Bacteria 2036
87 Ga0068857_100022510 3300005577 Bacteria 5546
88 Ga0068857_100344776 3300005577 Bacteria 1378
89 Ga0068854_100002047 3300005578 Bacteria 12361
90 Ga0068854_100210587 3300005578 Bacteria 1533
91 Ga0068856_100333896 3300005614 Bacteria 1534
92 Ga0070702_100009669 3300005615 Bacteria 4730
93 Ga0070702_100025131 3300005615 Bacteria 3187
94 Ga0068852_100007847 3300005616 Bacteria 7814
95 Ga0068852_100017594 3300005616 Bacteria 5613
96 Ga0068852_100147650 3300005616 Bacteria 2183
97 Ga0068859_100229291 3300005617 Bacteria 1945
98 Ga0068864_100089789 3300005618 Bacteria 2708
99 Ga0068866_10014556 3300005718 Bacteria 3477
100 Ga0068870_10003587 3300005840 Bacteria 6583
101 Ga0068870_10167326 3300005840 Bacteria 1309
102 Ga0068863_100167411 3300005841 Bacteria 2107
103 Ga0068858_100097574 3300005842 Bacteria 2739
104 Ga0068860_100213197 3300005843 Bacteria 1873
105 Ga0081455_10017265 3300005937 Bacteria 6926
106 Ga0070715_10029908 3300006163 Bacteria 2197
107 Ga0068871_100119637 3300006358 Bacteria 2223
108 Ga0075433_10028951 3300006852 Bacteria 4714
109 Ga0075434_100015439 3300006871 Bacteria 7322
110 Ga0075434_100031270 3300006871 Bacteria 5247
111 Ga0075434_100036633 3300006871 Bacteria 4853
112 Ga0075434_100293607 3300006871 Bacteria 1645
113 Ga0068865_100075846 3300006881 Bacteria 2399
114 Ga0068865_100154757 3300006881 Bacteria 1743
115 Ga0097620_100229292 3300006931 Bacteria 1945
116 Ga0075435_100037510 3300007076 Bacteria 3860
117 Ga0111539_10002146 3300009094 Bacteria 26383
118 Ga0111539_10052346 3300009094 Bacteria 4860
119 Ga0111539_10089105 3300009094 Bacteria 3625
120 Ga0111539_10190391 3300009094 Bacteria 2394
121 Ga0105245_10007984 3300009098 Bacteria 9255
122 Ga0105245_10088691 3300009098 Bacteria 2841
123 Ga0105245_10254802 3300009098 Bacteria 1706
124 Ga0105245_10288893 3300009098 Bacteria 1606
125 Ga0114129_10020649 3300009147 Bacteria 9364
126 Ga0114129_10105218 3300009147 Bacteria 3900
127 Ga0105243_10000322 3300009148 Bacteria 52684
128 Ga0105243_10006836 3300009148 Bacteria 8792
129 Ga0105243_10021939 3300009148 Bacteria 4850
130 Ga0105243_10095098 3300009148 Bacteria 2462
131 Ga0105243_10152278 3300009148 Bacteria 1985
132 Ga0105248_10305485 3300009177 Bacteria 1792
133 Ga0105237_10014836 3300009545 Bacteria 8131
134 Ga0105237_10028629 3300009545 Bacteria 5672
135 Ga0105238_10221746 3300009551 Bacteria 1867
136 Ga0105238_10310438 3300009551 Bacteria 1562
137 Ga0105238_10447146 3300009551 Bacteria 1289
138 Ga0105239_10003567 3300010375 Bacteria 19027
139 Ga0105239_10028230 3300010375 Bacteria 6172
140 Ga0105246_10022247 3300011119 Bacteria 4090
141 Ga0157373_10092388 3300013100 Bacteria 2131
142 Ga0157371_10005520 3300013102 Bacteria 10645
143 Ga0157369_10019130 3300013105 Bacteria 7666
144 Ga0157369_10070097 3300013105 Bacteria 3766
145 Ga0157369_10086412 3300013105 Bacteria 3349
146 Ga0157369_10132545 3300013105 Bacteria 2640
147 Ga0157374_10223693 3300013296 Bacteria 1847
148 Ga0157372_10009877 3300013307 Bacteria 10153
149 Ga0157372_10025582 3300013307 Bacteria 6420
150 Ga0157375_10004987 3300013308 Bacteria 11545
151 Ga0157375_10035571 3300013308 Bacteria 4755
152 Ga0163163_10204397 3300014325 Bacteria 2023
153 Ga0157377_10005573 3300014745 Bacteria 5929
154 Ga0157377_10060728 3300014745 Bacteria 2159
155 Ga0157377_10126732 3300014745 Bacteria 1554
156 Ga0157379_10035708 3300014968 Bacteria 4432
157 Ga0157379_10260348 3300014968 Bacteria 1576
158 Ga0206356_10667724 3300020070 Bacteria 3231
159 Ga0206354_10371761 3300020081 Bacteria 1965
160 Ga0206354_10579434 3300020081 Bacteria 2771
161 Ga0206353_10336346 3300020082 Bacteria 2468
162 Ga0206353_11323343 3300020082 Bacteria 2249
163 Ga0207656_10034967 3300025321 Bacteria 2101
164 Ga0207653_10011624 3300025885 Bacteria 2746
165 Ga0207692_10144350 3300025898 Bacteria 1357
166 Ga0207642_10025984 3300025899 Bacteria 2377
167 Ga0207710_10059236 3300025900 Bacteria 1733
168 Ga0207688_10007728 3300025901 Bacteria 5858
169 Ga0207688_10014924 3300025901 Bacteria 4215
170 Ga0207688_10015639 3300025901 Bacteria 4115
171 Ga0207688_10034664 3300025901 Bacteria 2796
172 Ga0207643_10002251 3300025908 Bacteria 10513
173 Ga0207643_10008870 3300025908 Bacteria 5398
174 Ga0207643_10056287 3300025908 Bacteria 2237
175 Ga0207705_10027398 3300025909 Bacteria 4064
176 Ga0207705_10039761 3300025909 Bacteria 3371
177 Ga0207684_10086709 3300025910 Bacteria 2666
178 Ga0207654_10083106 3300025911 Bacteria 1933
179 Ga0207707_10009140 3300025912 Bacteria 8607
180 Ga0207707_10023602 3300025912 Bacteria 5379
181 Ga0207707_10053622 3300025912 Bacteria 3510
182 Ga0207707_10071072 3300025912 Bacteria 3032
183 Ga0207707_10086209 3300025912 Bacteria 2744
184 Ga0207707_10093621 3300025912 Bacteria 2625
185 Ga0207707_10104221 3300025912 Bacteria 2479
186 Ga0207707_10129986 3300025912 Bacteria 2203
187 Ga0207695_10087388 3300025913 Bacteria 3140
188 Ga0207695_10097665 3300025913 Bacteria 2938
189 Ga0207671_10056016 3300025914 Bacteria 2921
190 Ga0207693_10098984 3300025915 Bacteria 2286
191 Ga0207660_10045642 3300025917 Bacteria 3087
192 Ga0207660_10067769 3300025917 Bacteria 2586
193 Ga0207660_10113001 3300025917 Bacteria 2047
194 Ga0207660_10137330 3300025917 Bacteria 1866
195 Ga0207657_10000523 3300025919 Bacteria 40648
196 Ga0207657_10002448 3300025919 Bacteria 20057
197 Ga0207657_10003418 3300025919 Bacteria 16947
198 Ga0207657_10003834 3300025919 Bacteria 15968
199 Ga0207657_10008493 3300025919 Bacteria 10417
200 Ga0207649_10025959 3300025920 Bacteria 3422
201 Ga0207649_10039269 3300025920 Bacteria 2869
202 Ga0207652_10013381 3300025921 Bacteria 6643
203 Ga0207652_10020596 3300025921 Bacteria 5435
204 Ga0207652_10045641 3300025921 Bacteria 3736
205 Ga0207652_10098840 3300025921 Bacteria 2574
206 Ga0207652_10171599 3300025921 Bacteria 1946
207 Ga0207652_10263286 3300025921 Bacteria 1555
208 Ga0207646_10002534 3300025922 Bacteria 21550
209 Ga0207646_10073602 3300025922 Bacteria 3052
210 Ga0207681_10278618 3300025923 Bacteria 1316
211 Ga0207694_10014018 3300025924 Bacteria 6044
212 Ga0207694_10045916 3300025924 Bacteria 3375
213 Ga0207650_10028600 3300025925 Bacteria 3999
214 Ga0207659_10065369 3300025926 Bacteria 2635
215 Ga0207687_10021699 3300025927 Bacteria 4268
216 Ga0207687_10074886 3300025927 Bacteria 2428
217 Ga0207664_10018521 3300025929 Bacteria 5128
218 Ga0207664_10086585 3300025929 Bacteria 2560
219 Ga0207690_10005115 3300025932 Bacteria 7747
220 Ga0207690_10009243 3300025932 Bacteria 5854
221 Ga0207706_10007115 3300025933 Bacteria 10354
222 Ga0207709_10005376 3300025935 Bacteria 7282
223 Ga0207709_10009851 3300025935 Bacteria 5261
224 Ga0207704_10037315 3300025938 Bacteria 2806
225 Ga0207691_10011586 3300025940 Bacteria 8468
226 Ga0207691_10016666 3300025940 Bacteria 6978
227 Ga0207691_10160582 3300025940 Bacteria 1972
228 Ga0207711_10100021 3300025941 Bacteria 2564
229 Ga0207689_10043017 3300025942 Bacteria 3734
230 Ga0207661_10068250 3300025944 Bacteria 2895
231 Ga0207661_10074550 3300025944 Bacteria 2781
232 Ga0207661_10084616 3300025944 Bacteria 2627
233 Ga0207661_10144372 3300025944 Bacteria 2051
234 Ga0207661_10208005 3300025944 Bacteria 1723
235 Ga0207667_10059418 3300025949 Bacteria 4004
236 Ga0207667_10126014 3300025949 Bacteria 2638
237 Ga0207667_10140888 3300025949 Bacteria 2483
238 Ga0207667_10459068 3300025949 Bacteria 1294
239 Ga0207651_10020403 3300025960 Bacteria 3999
240 Ga0207668_10077363 3300025972 Bacteria 2399
241 Ga0207640_10006358 3300025981 Bacteria 6478
242 Ga0207677_10060200 3300026023 Bacteria 2623
243 Ga0207703_10174631 3300026035 Bacteria 1892
244 Ga0207703_10218685 3300026035 Bacteria 1702
245 Ga0207639_10024298 3300026041 Bacteria 4384
246 Ga0207639_10059675 3300026041 Bacteria 2940
247 Ga0207678_10041674 3300026067 Bacteria 3981
248 Ga0207678_10057710 3300026067 Bacteria 3341
249 Ga0207708_10027455 3300026075 Bacteria 4310
250 Ga0207702_10032799 3300026078 Bacteria 4334
251 Ga0207676_10078180 3300026095 Bacteria 2679
252 Ga0207674_10144402 3300026116 Bacteria 2339
253 Ga0207674_10145851 3300026116 Bacteria 2325
254 Ga0207675_100121255 3300026118 Bacteria 2474
255 Ga0207683_10010477 3300026121 Bacteria 7909
256 Ga0207683_10024923 3300026121 Bacteria 5156
257 Ga0207683_10117387 3300026121 Bacteria 2386
258 Ga0207698_10014823 3300026142 Bacteria 5197
259 Ga0207698_10094434 3300026142 Bacteria 2459
260 Ga0207428_10042005 3300027907 Bacteria 3699
261 Ga0207428_10045224 3300027907 Bacteria 3547
262 Ga0207428_10075173 3300027907 Bacteria 2648
263 Ga0207428_10106845 3300027907 Bacteria 2157
264 Ga0268264_10209031 3300028381 Bacteria 1790
265 Ga0265319_1001008 3300028563 Bacteria 17574
266 Ga0265319_1008872 3300028563 Bacteria 4356
267 Ga0265334_10003569 3300028573 Bacteria 7049
268 Ga0265318_10000982 3300028577 Bacteria 18274
269 Ga0265318_10028464 3300028577 Bacteria 2185
270 Ga0265322_10002208 3300028654 Bacteria 6047
271 Ga0307517_10005451 3300028786 Bacteria 19155
272 Ga0265338_10003055 3300028800 Bacteria 24061
273 Ga0265338_10006956 3300028800 Bacteria 14221
274 Ga0265338_10015934 3300028800 Bacteria 8221
275 Ga0265338_10162884 3300028800 Bacteria 1720
276 Ga0307511_10051371 3300030521 Bacteria 3307
277 Ga0307511_10108488 3300030521 Bacteria 1781
278 Ga0265330_10017634 3300031235 Bacteria 3285
279 Ga0265320_10025002 3300031240 Bacteria 3146
280 Ga0265325_10009038 3300031241 Bacteria 5847
281 Ga0265339_10015324 3300031249 Bacteria 4596
282 Ga0265339_10030508 3300031249 Bacteria 3052
283 Ga0265331_10050564 3300031250 Bacteria 1993
284 Ga0265327_10006105 3300031251 Bacteria 9763
285 Ga0265327_10021295 3300031251 Bacteria 3916
286 Ga0265327_10044253 3300031251 Bacteria 2376
287 Ga0265327_10066058 3300031251 Bacteria 1827
288 Ga0265316_10007566 3300031344 Bacteria 10222
289 Ga0265316_10014678 3300031344 Bacteria 6881
290 Ga0265316_10110034 3300031344 Bacteria 2087
291 Ga0265316_10187557 3300031344 Bacteria 1538
292 Ga0307509_10187406 3300031507 Bacteria 1925
293 Ga0265313_10007562 3300031595 Bacteria 7385
294 Ga0307508_10034924 3300031616 Bacteria 4531
295 Ga0307508_10057482 3300031616 Bacteria 3442
296 Ga0265314_10003537 3300031711 Bacteria 15091
297 Ga0265314_10006697 3300031711 Bacteria 10122
298 Ga0265314_10093956 3300031711 Bacteria 1945
299 Ga0265342_10007711 3300031712 Bacteria 7836
300 Ga0265342_10109772 3300031712 Bacteria 1562
301 Ga0307405_10026687 3300031731 Bacteria 3336
302 Ga0307410_10008058 3300031852 Bacteria 5817
303 Ga0307406_10006759 3300031901 Bacteria 6343
304 Ga0307407_10067374 3300031903 Bacteria 2115
305 Ga0307412_10120455 3300031911 Bacteria 1888
306 Ga0307409_100091811 3300031995 Bacteria 2489
307 Ga0307416_100038295 3300032002 Bacteria 3698
308 Ga0307414_10027364 3300032004 Bacteria 3684
309 Ga0373958_0007538 3300034819 Bacteria 1738
310 Ga0373958_0014293 3300034819 Bacteria 1386
311 Ga0373934_0066044 3300035086 Bacteria 1445
312 Ga0373951_0032109 3300035091 Bacteria 1241
313 Ga0373932_0025679 3300035112 Bacteria 1597
314 Ga0373945_0003950 3300035116 Bacteria 4689
315 Ga0373960_0007219 3300035121 Bacteria 2628
316 Ga0373960_0013284 3300035121 Bacteria 2063
317 Ga0373943_0006609 3300035170 Bacteria 5197
318 Ga0373955_0064744 3300035172 Bacteria 2027
319 Ga0373961_0003444 3300035241 Bacteria 3914
320 Ga0373962_0007941 3300035242 Bacteria 2605
321 Ga0373931_0001199 3300035691 Bacteria 11079
322 Ga0373931_0034182 3300035691 Bacteria 2637
323 Ga0373935_0021213 3300035692 Bacteria 3976
324 Ga0373933_0098665 3300035724 Bacteria 1810
325 Ga0373947_0001437 3300035725 Bacteria 14644
326 Ga0373937_0051373 3300036401 Bacteria 3778
327 Ga0373937_0124669 3300036401 Bacteria 2402
328 Ga0373925_0020974 3300037068 Bacteria 4761
329 Ga0395899_0015517 3300037312 Bacteria 5808
330 Ga0395899_0033358 3300037312 Bacteria 3866
331 Ga0395900_0022312 3300037418 Bacteria 6476
332 Ga0395900_0039271 3300037418 Bacteria 4876
333 Ga0395898_0024615 3300037466 Bacteria 6071
334 Ga0395898_0038250 3300037466 Bacteria 4756
335 Ga0395898_0295516 3300037466 Bacteria 1545
336 Ga0395905_0047186 3300037471 Bacteria 4038
337 Ga0395905_0049615 3300037471 Bacteria 3933
338 Ga0436364_1485142 3300037853 Bacteria 12573
339 Ga0395901_0020937 3300038443 Bacteria 6699
340 Ga0395901_0212419 3300038443 Bacteria 2025
341 Ga0395901_0282710 3300038443 Bacteria 1723
342 Ga0436360_0559017 3300039438 Bacteria 3798
343 Ga0436363_0306795 3300039450 Bacteria 2300
344 Ga0439453_0002435 3300041408 Bacteria 2570
345 Ga0439437_003869 3300042000 Bacteria 1620
346 Ga0439448_0037465 3300042005 Bacteria 1558
347 Ga0439448_0043958 3300042005 Bacteria 1452
348 Ga0466966_0033251 3300044684 Bacteria 3339
349 Ga0466966_0053222 3300044684 Bacteria 2568
350 Ga0466963_0000931 3300044694 Bacteria 14949
351 Ga0466963_0001489 3300044694 Bacteria 12648
352 Ga0466963_0137687 3300044694 Bacteria 1690
353 Ga0466964_0004559 3300044706 Bacteria 5124
354 Ga0466964_0024895 3300044706 Bacteria 2334
355 Ga0466971_0000135 3300044719 Bacteria 27200
356 Ga0466971_0000602 3300044719 Bacteria 14279
357 Ga0466968_0004900 3300044735 Bacteria 5009
358 Ga0466968_0025061 3300044735 Bacteria 2441
359 Ga0466957_0000159 3300044842 Bacteria 29481
360 Ga0466959_0004673 3300045049 Bacteria 9217
361 Ga0466959_0029060 3300045049 Bacteria 4095
362 Ga0466959_0039521 3300045049 Bacteria 3486
363 Ga0466959_0174704 3300045049 Bacteria 1505
364 Ga0466958_0000770 3300045836 Bacteria 14089
365 Ga0466958_0021561 3300045836 Bacteria 3767
366 Ga0466958_0067501 3300045836 Bacteria 2185
367 Ga0466967_0000393 3300045976 Bacteria 20421
368 Ga0466967_0000488 3300045976 Bacteria 19271
369 Ga0466967_0001271 3300045976 Bacteria 14311
370 Ga0466967_0010218 3300045976 Bacteria 7024
371 Ga0466967_0010750 3300045976 Bacteria 6882
372 Ga0466967_0014600 3300045976 Bacteria 6126
373 Ga0466967_0058530 3300045976 Bacteria 3406
374 Ga0466967_0071920 3300045976 Bacteria 3098
375 Ga0466967_0101223 3300045976 Bacteria 2633
376 Ga0466967_0121279 3300045976 Bacteria 2416
377 Ga0466967_0139266 3300045976 Bacteria 2259
378 Ga0466967_0164195 3300045976 Bacteria 2086
379 Ga0495592_0179128 3300046454 Bacteria 1445
380 Ga0495629_0063326 3300046459 Bacteria 2583
381 Ga0495629_0115286 3300046459 Bacteria 1872
382 Ga0495651_0011238 3300046462 Bacteria 6880
383 Ga0495651_0063631 3300046462 Bacteria 2819
384 Ga0495653_0019279 3300046463 Bacteria 5533
385 Ga0495653_0022381 3300046463 Bacteria 5116
386 Ga0495653_0051600 3300046463 Bacteria 3157
387 Ga0495664_0121741 3300046477 Bacteria 1578
388 Ga0495607_0035391 3300046501 Bacteria 3021
389 Ga0495608_0001903 3300046511 Bacteria 14964
390 Ga0495608_0015248 3300046511 Bacteria 5332
391 Ga0495608_0017693 3300046511 Bacteria 4928
392 Ga0495616_0035514 3300046513 Bacteria 2579
393 Ga0495628_0044444 3300046516 Bacteria 3534
394 Ga0495628_0044632 3300046516 Bacteria 3525
395 Ga0495630_0008401 3300046517 Bacteria 7404
396 Ga0495630_0020194 3300046517 Bacteria 4909
397 Ga0495630_0083308 3300046517 Bacteria 2414
398 Ga0495630_0130551 3300046517 Bacteria 1908
399 Ga0495631_0080026 3300046518 Bacteria 1410
400 Ga0495643_0003441 3300046522 Bacteria 11580
401 Ga0495648_0001604 3300046524 Bacteria 22021
402 Ga0495652_0104424 3300046529 Bacteria 2291
403 Ga0495640_0007848 3300046533 Bacteria 8393
404 Ga0495645_0179877 3300046543 Bacteria 1450
405 Ga0495633_0045620 3300046558 Bacteria 2075
406 Ga0495667_0002819 3300046559 Bacteria 11610
407 Ga0495667_0011859 3300046559 Bacteria 5905
408 Ga0495667_0035291 3300046559 Bacteria 3342
409 Ga0495667_0046403 3300046559 Bacteria 2873
410 Ga0495667_0049324 3300046559 Bacteria 2779
411 Ga0495634_0015965 3300046642 Bacteria 5379
412 Ga0495634_0130984 3300046642 Bacteria 1599
413 Ga0495611_0028717 3300046648 Bacteria 2437
414 Ga0495635_0014425 3300046663 Bacteria 5528
415 Ga0495635_0066051 3300046663 Bacteria 2481
416 Ga0495635_0073287 3300046663 Bacteria 2346
417 Ga0495661_0079340 3300046665 Bacteria 1897
418 Ga0495657_0075529 3300046675 Bacteria 2190
419 Ga0495599_0157349 3300046678 Bacteria 1405
420 Ga0495646_0039389 3300046680 Bacteria 2914
421 Ga0495646_0056984 3300046680 Bacteria 2341
422 Ga0495658_0027107 3300046683 Bacteria 3079
423 Ga0495669_0060527 3300046684 Bacteria 1712
424 Ga0495613_0041353 3300046689 Bacteria 3414
425 Ga0495613_0116872 3300046689 Bacteria 1918
426 Ga0495670_0001217 3300046691 Bacteria 12519
427 Ga0495670_0046325 3300046691 Bacteria 2172
428 Ga0495671_0013567 3300046692 Bacteria 4406
429 Ga0495589_0078211 3300046794 Bacteria 1611
430 Ga0495600_0009558 3300046809 Bacteria 5995
431 Ga0495604_0002667 3300047317 Bacteria 14322
432 Ga0495604_0076312 3300047317 Bacteria 2521
433 Ga0495604_0212039 3300047317 Bacteria 1338
434 Ga0495674_0007397 3300047319 Bacteria 10498
435 Ga0495674_0049646 3300047319 Bacteria 3706
436 Ga0495672_0001082 3300047320 Bacteria 27689
437 Ga0495680_0004005 3300047322 Bacteria 14230
438 Ga0495680_0016396 3300047322 Bacteria 6367
439 Ga0495680_0024026 3300047322 Bacteria 5061
440 Ga0495680_0180034 3300047322 Bacteria 1526
441 Ga0495683_0021570 3300047323 Bacteria 3319
442 Ga0495675_0032337 3300047444 Bacteria 3338
443 Ga0495685_002755 3300047447 Bacteria 5541
444 Ga0495673_0001630 3300047469 Bacteria 17372
445 Ga0495681_0001798 3300047470 Bacteria 15786
446 Ga0495684_0010279 3300047471 Bacteria 7237
447 Ga0495684_0020269 3300047471 Bacteria 5123
448 Ga0495686_0090007 3300047472 Bacteria 1864
449 Ga0495593_0106269 3300047673 Bacteria 1436
450 Ga0495593_0142331 3300047673 Bacteria 1215
451 Ga0495602_0211767 3300048088 Bacteria 1470
452 Ga0496100_0016487 3300048903 Bacteria 4340
453 Ga0496100_0072612 3300048903 Bacteria 2301
454 Ga0496100_0078057 3300048903 Bacteria 2228
455 Ga0496101_0169581 3300048904 Bacteria 1677
456 Ga0496102_0045241 3300048905 Bacteria 3996
457 Ga0496102_0299556 3300048905 Bacteria 1515
458 Ga0496103_0017673 3300048906 Bacteria 4270
459 Ga0496104_0148442 3300048907 Bacteria 2251
460 Ga0496105_0090400 3300048908 Bacteria 2529
461 Ga0496106_0019309 3300048909 Bacteria 5054
462 Ga0496106_0035890 3300048909 Bacteria 3708
463 Ga0496106_0188462 3300048909 Bacteria 1639
464 Ga0496107_0008369 3300048910 Bacteria 7156
465 Ga0496107_0008507 3300048910 Bacteria 7103
466 Ga0496107_0015603 3300048910 Bacteria 5326
467 Ga0496107_0067400 3300048910 Bacteria 2597
468 Ga0496108_0002372 3300048911 Bacteria 15085
469 Ga0496108_0309204 3300048911 Bacteria 1377
470 Ga0496109_0007413 3300048912 Bacteria 9284
471 Ga0496109_0057720 3300048912 Bacteria 3544
472 Ga0496109_0058746 3300048912 Bacteria 3513
473 Ga0496110_0000112 3300048913 Bacteria 44496
474 Ga0496110_0015618 3300048913 Bacteria 6324
475 Ga0496110_0021215 3300048913 Bacteria 5495
476 Ga0496110_0366903 3300048913 Bacteria 1312
477 Ga0496111_0000091 3300048914 Bacteria 38326
478 Ga0496111_0012747 3300048914 Bacteria 5700
479 Ga0496112_0012177 3300048915 Bacteria 7895
480 Ga0496112_0029106 3300048915 Bacteria 5339
481 Ga0496112_0090032 3300048915 Bacteria 3037
482 Ga0496112_0297252 3300048915 Bacteria 1560
483 Ga0496112_0310984 3300048915 Bacteria 1520
484 Ga0496113_0133017 3300048916 Bacteria 1953
485 Ga0496113_0241003 3300048916 Bacteria 1443
486 Ga0496114_0002364 3300048917 Bacteria 14362
487 Ga0496114_0067805 3300048917 Bacteria 2994
488 Ga0496114_0166941 3300048917 Bacteria 1917
489 Ga0496114_0179633 3300048917 Bacteria 1848
490 Ga0496119_0042516 3300048922 Bacteria 2880
491 Ga0496119_0067514 3300048922 Bacteria 2109
492 Ga0496122_0070914 3300048925 Bacteria 2485
493 Ga0496123_0011874 3300048926 Bacteria 7488
494 Ga0496126_0014053 3300048929 Bacteria 8110
495 Ga0501031_0006555 3300049568 Bacteria 7592
496 Ga0501031_0088984 3300049568 Bacteria 2013
497 Ga0501032_0025950 3300049569 Bacteria 4036
498 Ga0501036_0011939 3300049572 Bacteria 7202
499 Ga0501036_0075189 3300049572 Bacteria 2857
500 Ga0501038_0057757 3300049574 Bacteria 3330
501 Ga0501038_0109782 3300049574 Bacteria 2286
502 Ga0501040_0026345 3300049576 Bacteria 3910
503 Ga0501040_0067038 3300049576 Bacteria 2473
504 Ga0501041_0165993 3300049577 Bacteria 1381
505 Ga0501042_0015196 3300049578 Bacteria 5267
506 Ga0501042_0016044 3300049578 Bacteria 5138
507 Ga0501042_0030173 3300049578 Bacteria 3828
508 Ga0501048_0014863 3300049582 Bacteria 5757
509 Ga0501067_0000584 3300049583 Bacteria 19724
510 Ga0501067_0017608 3300049583 Bacteria 3955
511 Ga0501067_0032118 3300049583 Bacteria 2914
512 Ga0501067_0034310 3300049583 Bacteria 2816
513 Ga0501067_0034697 3300049583 Bacteria 2800
514 Ga0501067_0035542 3300049583 Bacteria 2767
515 Ga0501067_0074293 3300049583 Bacteria 1884
516 Ga0501067_0074359 3300049583 Bacteria 1883
517 Ga0501068_0007980 3300049584 Bacteria 5869
518 Ga0501068_0038447 3300049584 Bacteria 2867
519 Ga0501068_0048402 3300049584 Bacteria 2566
520 Ga0501069_0000256 3300049585 Bacteria 24083
521 Ga0501069_0035452 3300049585 Bacteria 2749
522 Ga0501069_0064921 3300049585 Bacteria 2040
523 Ga0501069_0092692 3300049585 Bacteria 1709
524 Ga0501069_0107419 3300049585 Bacteria 1587
525 Ga0501070_0072930 3300049586 Bacteria 2841
526 Ga0501070_0164828 3300049586 Bacteria 1826
527 Ga0501071_0001507 3300049587 Bacteria 13537
528 Ga0501072_0013793 3300049588 Bacteria 6188
529 Ga0501072_0073688 3300049588 Bacteria 2699
530 Ga0501072_0084333 3300049588 Bacteria 2519
531 Ga0501073_0024497 3300049589 Bacteria 4333
532 Ga0501073_0040126 3300049589 Bacteria 3315
533 Ga0501074_0013090 3300049590 Bacteria 6030
534 Ga0501075_0048759 3300049591 Bacteria 3182
535 Ga0501076_0008812 3300049592 Bacteria 7413
536 Ga0501076_0064311 3300049592 Bacteria 2923
537 Ga0501077_0156901 3300049593 Bacteria 1444
538 Ga0501079_0018595 3300049741 Bacteria 5308
539 Ga0501079_0163935 3300049741 Bacteria 1733
540 Ga0501080_0008547 3300049742 Bacteria 9284
541 Ga0501080_0050028 3300049742 Bacteria 3890
542 Ga0501081_0011938 3300049743 Bacteria 5691
543 Ga0501081_0053572 3300049743 Bacteria 2785
544 Ga0501081_0133411 3300049743 Bacteria 1776
545 Ga0501083_0082901 3300049744 Bacteria 2124
546 Ga0501045_0041574 3300049824 Bacteria 3344
547 Ga0501045_0110039 3300049824 Bacteria 2042
548 nmdc:mga06z11_19007_c1 3300050494 Bacteria 3150
549 nmdc:mga05p37_23356_c1 3300050507 Bacteria 7503
550 nmdc:mga08y16_33209_c1 3300050511 Bacteria 5420
551 nmdc:mga08y16_48052_c1 3300050511 Bacteria 4466
552 nmdc:mga08y16_52008_c1 3300050511 Bacteria 4286
553 nmdc:mga08y16_52412_c1 3300050511 Bacteria 4269
554 nmdc:mga0n895_139038_c1 3300050512 Bacteria 2456
555 nmdc:mga0n895_15249_c1 3300050512 Bacteria 7002
556 nmdc:mga0n895_182735_c1 3300050512 Bacteria 2129
557 nmdc:mga0rr50_265074_c1 3300050513 Bacteria 1430
558 nmdc:mga0rr50_31306_c1 3300050513 Bacteria 3776
559 nmdc:mga0a205_135779_c1 3300050515 Bacteria 2360
560 nmdc:mga0a205_7328_c1 3300050515 Bacteria 9985
561 Ga0495601_0013003 3300053077 Bacteria 5000
562 Ga0495612_0009607 3300053078 Bacteria 3918
563 Ga0495612_0018131 3300053078 Bacteria 2818
564 Ga0495595_0017929 3300053084 Bacteria 3051
565 Ga0495619_0005999 3300053085 Bacteria 7693
566 Ga0495619_0007846 3300053085 Bacteria 6753
567 Ga0495619_0008870 3300053085 Bacteria 6357
568 Ga0495619_0081719 3300053085 Bacteria 2176
569 Ga0500578_0037865 3300053086 Bacteria 3097
570 Ga0500660_032144 3300053100 Bacteria 2732
571 Ga0500553_108723 3300053101 Bacteria 1172
572 Ga0500560_004524 3300053107 Bacteria 2970
573 Ga0500614_004002 3300053123 Bacteria 3138
574 Ga0500628_001710 3300053129 Bacteria 3703
575 Ga0500658_0003667 3300053134 Bacteria 5791
576 Ga0500561_0000627 3300053137 Bacteria 5632
577 Ga0500573_0016475 3300053140 Bacteria 4196
578 Ga0500600_0045981 3300053149 Bacteria 2495
579 Ga0500616_0015224 3300053153 Bacteria 4402
580 Ga0500634_0011793 3300053161 Bacteria 4525
581 Ga0501084_0034316 3300054114 Bacteria 4243
582 Ga0501084_0043073 3300054114 Bacteria 3776
583 Ga0501084_0139545 3300054114 Bacteria 2041
584 Ga0501082_0229518 3300060353 Bacteria 1615
585 Ga0466962_0000782 3300061719 Bacteria 14304
586 Ga0466962_0068527 3300061719 Bacteria 1694
587 Ga0530510_0053096 3300061734 Bacteria 2928
588 Ga0530510_0136614 3300061734 Bacteria 1805
589 Ga0530510_0149010 3300061734 Bacteria 1727
590 2676496527 2675903060 Bacteria 10051191
591 2739235601 2738543011 Bacteria 5731169
592 2862291579 2862290372 Bacteria 7471434
593 2889305215 2889300758 Bacteria 5690814
594 2891396488 2891395885 Bacteria 9251614
595 2891557831 2891554331 Bacteria 8812224
596 2891567843 2891562705 Bacteria 8039471
597 2895433267 2895427314 Bacteria 13147766
598 2902795280 2902792274 Bacteria 7270173
599 2939746927 2939743619 Bacteria 5762299
600 2966925924 2966924647 Bacteria 3268643
601 8055073298 8055066027 Bacteria 9479577
602 8055174121 8055172936 Bacteria 9305943
603 Ga0111539_10068649
604 JGI24743J22301_10004581
605 JGI24738J21930_10005514
606 JGI24744J21845_10003117
607 Ga0070658_10021015
608 Ga0070658_10037918
609 Ga0070658_10099103
610 Ga0070658_10124935
611 Ga0070683_100028507
612 Ga0070683_100037617
613 Ga0070683_100107185
614 Ga0070683_100173743
615 Ga0070683_100183465
616 Ga0070683_100368580
617 Ga0070670_100040997
618 Ga0070670_100126877
619 Ga0070666_10074430
620 Ga0070680_100008048
621 Ga0070680_100011877
622 Ga0070680_100023947
623 Ga0070680_100162573
624 Ga0070682_100008572
625 Ga0068868_100022812
626 Ga0070660_100005959
627 Ga0070660_100010773
628 Ga0070660_100014838
629 Ga0070660_100024165
630 Ga0070660_100065706
631 Ga0070691_10006513
632 Ga0070687_100041154
633 Ga0070661_100003244
634 Ga0070661_100004837
635 Ga0070661_100055438
636 Ga0070692_10002220
637 Ga0070668_100050068
638 Ga0070674_100271703
639 Ga0070674_100299936
640 Ga0070673_100005214
641 Ga0070659_100020846
642 Ga0070659_100032153
643 Ga0070659_100184068
644 Ga0070703_10023978
645 Ga0070714_100059342
646 Ga0070714_100439082
647 Ga0070701_10018506
648 Ga0070700_100082112
649 Ga0070663_100012183
650 Ga0070663_100066847
651 Ga0070678_100010115
652 Ga0070662_100019080
653 Ga0070681_10006050
654 Ga0070681_10026629
655 Ga0070681_10032838
656 Ga0070681_10040724
657 Ga0070681_10046513
658 Ga0070681_10077704
659 Ga0070681_10137190
660 Ga0068867_100131443
661 Ga0070707_100005697
662 Ga0070707_100013002
663 Ga0070698_100049133
664 Ga0070698_100085259
665 Ga0070679_100004225
666 Ga0070679_100012703
667 Ga0070679_100127666
668 Ga0070679_100169282
669 Ga0070679_100202978
670 Ga0070679_100290608
671 Ga0070684_100003748
672 Ga0070684_100018284
673 Ga0070684_100058754
674 Ga0070684_100084085
675 Ga0070684_100167755
676 Ga0070697_100074727
677 Ga0068853_100000569
678 Ga0068853_100402369
679 Ga0070672_100192819
680 Ga0070696_100158802
681 Ga0070693_100195798
682 Ga0070665_100144177
683 Ga0070704_100093734
684 Ga0068855_100006908
685 Ga0068855_100013836
686 Ga0068855_100024003
687 Ga0068855_100138866
688 Ga0070664_100153225
689 Ga0068857_100022510
690 Ga0068857_100344776
691 Ga0068854_100002047
692 Ga0068854_100210587
693 Ga0068856_100333896
694 Ga0070702_100009669
695 Ga0070702_100025131
696 Ga0068852_100007847
697 Ga0068852_100017594
698 Ga0068852_100147650
699 Ga0068859_100229291
700 Ga0068864_100089789
701 Ga0068866_10014556
702 Ga0068870_10003587
703 Ga0068870_10167326
704 Ga0068863_100167411
705 Ga0068858_100097574
706 Ga0068860_100213197
707 Ga0081455_10017265
708 Ga0070715_10029908
709 Ga0068871_100119637
710 Ga0075433_10028951
711 Ga0075434_100015439
712 Ga0075434_100031270
713 Ga0075434_100036633
714 Ga0075434_100293607
715 Ga0068865_100075846
716 Ga0068865_100154757
717 Ga0097620_100229292
718 Ga0075435_100037510
719 Ga0111539_10002146
720 Ga0111539_10052346
721 Ga0111539_10089105
722 Ga0111539_10190391
723 Ga0105245_10007984
724 Ga0105245_10088691
725 Ga0105245_10254802
726 Ga0105245_10288893
727 Ga0114129_10020649
728 Ga0114129_10105218
729 Ga0105243_10000322
730 Ga0105243_10006836
731 Ga0105243_10021939
732 Ga0105243_10095098
733 Ga0105243_10152278
734 Ga0105248_10305485
735 Ga0105237_10014836
736 Ga0105237_10028629
737 Ga0105238_10221746
738 Ga0105238_10310438
739 Ga0105238_10447146
740 Ga0105239_10003567
741 Ga0105239_10028230
742 Ga0105246_10022247
743 Ga0157373_10092388
744 Ga0157371_10005520
745 Ga0157369_10019130
746 Ga0157369_10070097
747 Ga0157369_10086412
748 Ga0157369_10132545
749 Ga0157374_10223693
750 Ga0157372_10009877
751 Ga0157372_10025582
752 Ga0157375_10004987
753 Ga0157375_10035571
754 Ga0163163_10204397
755 Ga0157377_10005573
756 Ga0157377_10060728
757 Ga0157377_10126732
758 Ga0157379_10035708
759 Ga0157379_10260348
760 Ga0206356_10667724
761 Ga0206354_10371761
762 Ga0206354_10579434
763 Ga0206353_10336346
764 Ga0206353_11323343
765 Ga0207656_10034967
766 Ga0207653_10011624
767 Ga0207692_10144350
768 Ga0207642_10025984
769 Ga0207710_10059236
770 Ga0207688_10007728
771 Ga0207688_10014924
772 Ga0207688_10015639
773 Ga0207688_10034664
774 Ga0207643_10002251
775 Ga0207643_10008870
776 Ga0207643_10056287
777 Ga0207705_10027398
778 Ga0207705_10039761
779 Ga0207684_10086709
780 Ga0207654_10083106
781 Ga0207707_10009140
782 Ga0207707_10023602
783 Ga0207707_10053622
784 Ga0207707_10071072
785 Ga0207707_10086209
786 Ga0207707_10093621
787 Ga0207707_10104221
788 Ga0207707_10129986
789 Ga0207695_10087388
790 Ga0207695_10097665
791 Ga0207671_10056016
792 Ga0207693_10098984
793 Ga0207660_10045642
794 Ga0207660_10067769
795 Ga0207660_10113001
796 Ga0207660_10137330
797 Ga0207657_10000523
798 Ga0207657_10002448
799 Ga0207657_10003418
800 Ga0207657_10003834
801 Ga0207657_10008493
802 Ga0207649_10025959
803 Ga0207649_10039269
804 Ga0207652_10013381
805 Ga0207652_10020596
806 Ga0207652_10045641
807 Ga0207652_10098840
808 Ga0207652_10171599
809 Ga0207652_10263286
810 Ga0207646_10002534
811 Ga0207646_10073602
812 Ga0207681_10278618
813 Ga0207694_10014018
814 Ga0207694_10045916
815 Ga0207650_10028600
816 Ga0207659_10065369
817 Ga0207687_10021699
818 Ga0207687_10074886
819 Ga0207664_10018521
820 Ga0207664_10086585
821 Ga0207690_10005115
822 Ga0207690_10009243
823 Ga0207706_10007115
824 Ga0207709_10005376
825 Ga0207709_10009851
826 Ga0207704_10037315
827 Ga0207691_10011586
828 Ga0207691_10016666
829 Ga0207691_10160582
830 Ga0207711_10100021
831 Ga0207689_10043017
832 Ga0207661_10068250
833 Ga0207661_10074550
834 Ga0207661_10084616
835 Ga0207661_10144372
836 Ga0207661_10208005
837 Ga0207667_10059418
838 Ga0207667_10126014
839 Ga0207667_10140888
840 Ga0207667_10459068
841 Ga0207651_10020403
842 Ga0207668_10077363
843 Ga0207640_10006358
844 Ga0207677_10060200
845 Ga0207703_10174631
846 Ga0207703_10218685
847 Ga0207639_10024298
848 Ga0207639_10059675
849 Ga0207678_10041674
850 Ga0207678_10057710
851 Ga0207708_10027455
852 Ga0207702_10032799
853 Ga0207676_10078180
854 Ga0207674_10144402
855 Ga0207674_10145851
856 Ga0207675_100121255
857 Ga0207683_10010477
858 Ga0207683_10024923
859 Ga0207683_10117387
860 Ga0207698_10014823
861 Ga0207698_10094434
862 Ga0207428_10042005
863 Ga0207428_10045224
864 Ga0207428_10075173
865 Ga0207428_10106845
866 Ga0268264_10209031
867 Ga0265319_1001008
868 Ga0265319_1008872
869 Ga0265334_10003569
870 Ga0265318_10000982
871 Ga0265318_10028464
872 Ga0265322_10002208
873 Ga0307517_10005451
874 Ga0265338_10003055
875 Ga0265338_10006956
876 Ga0265338_10015934
877 Ga0265338_10162884
878 Ga0307511_10051371
879 Ga0307511_10108488
880 Ga0265330_10017634
881 Ga0265320_10025002
882 Ga0265325_10009038
883 Ga0265339_10015324
884 Ga0265339_10030508
885 Ga0265331_10050564
886 Ga0265327_10006105
887 Ga0265327_10021295
888 Ga0265327_10044253
889 Ga0265327_10066058
890 Ga0265316_10007566
891 Ga0265316_10014678
892 Ga0265316_10110034
893 Ga0265316_10187557
894 Ga0307509_10187406
895 Ga0265313_10007562
896 Ga0307508_10034924
897 Ga0307508_10057482
898 Ga0265314_10003537
899 Ga0265314_10006697
900 Ga0265314_10093956
901 Ga0265342_10007711
902 Ga0265342_10109772
903 Ga0307405_10026687
904 Ga0307410_10008058
905 Ga0307406_10006759
906 Ga0307407_10067374
907 Ga0307412_10120455
908 Ga0307409_100091811
909 Ga0307416_100038295
910 Ga0307414_10027364
911 Ga0373958_0007538
912 Ga0373958_0014293
913 Ga0373934_0066044
914 Ga0373951_0032109
915 Ga0373932_0025679
916 Ga0373945_0003950
917 Ga0373960_0007219
918 Ga0373960_0013284
919 Ga0373943_0006609
920 Ga0373955_0064744
921 Ga0373961_0003444
922 Ga0373962_0007941
923 Ga0373931_0001199
924 Ga0373931_0034182
925 Ga0373935_0021213
926 Ga0373933_0098665
927 Ga0373947_0001437
928 Ga0373937_0051373
929 Ga0373937_0124669
930 Ga0373925_0020974
931 Ga0395899_0015517
932 Ga0395899_0033358
933 Ga0395900_0022312
934 Ga0395900_0039271
935 Ga0395898_0024615
936 Ga0395898_0038250
937 Ga0395898_0295516
938 Ga0395905_0047186
939 Ga0395905_0049615
940 Ga0436364_1485142
941 Ga0395901_0020937
942 Ga0395901_0212419
943 Ga0395901_0282710
944 Ga0436360_0559017
945 Ga0436363_0306795
946 Ga0439453_0002435
947 Ga0439437_003869
948 Ga0439448_0037465
949 Ga0439448_0043958
950 Ga0466966_0033251
951 Ga0466966_0053222
952 Ga0466963_0000931
953 Ga0466963_0001489
954 Ga0466963_0137687
955 Ga0466964_0004559
956 Ga0466964_0024895
957 Ga0466971_0000135
958 Ga0466971_0000602
959 Ga0466968_0004900
960 Ga0466968_0025061
961 Ga0466957_0000159
962 Ga0466959_0004673
963 Ga0466959_0029060
964 Ga0466959_0039521
965 Ga0466959_0174704
966 Ga0466958_0000770
967 Ga0466958_0021561
968 Ga0466958_0067501
969 Ga0466967_0000393
970 Ga0466967_0000488
971 Ga0466967_0001271
972 Ga0466967_0010218
973 Ga0466967_0010750
974 Ga0466967_0014600
975 Ga0466967_0058530
976 Ga0466967_0071920
977 Ga0466967_0101223
978 Ga0466967_0121279
979 Ga0466967_0139266
980 Ga0466967_0164195
981 Ga0495592_0179128
982 Ga0495629_0063326
983 Ga0495629_0115286
984 Ga0495651_0011238
985 Ga0495651_0063631
986 Ga0495653_0019279
987 Ga0495653_0022381
988 Ga0495653_0051600
989 Ga0495664_0121741
990 Ga0495607_0035391
991 Ga0495608_0001903
992 Ga0495608_0015248
993 Ga0495608_0017693
994 Ga0495616_0035514
995 Ga0495628_0044444
996 Ga0495628_0044632
997 Ga0495630_0008401
998 Ga0495630_0020194
999 Ga0495630_0083308
1000 Ga0495630_0130551
1001 Ga0495631_0080026
1002 Ga0495643_0003441
1003 Ga0495648_0001604
1004 Ga0495652_0104424
1005 Ga0495640_0007848
1006 Ga0495645_0179877
1007 Ga0495633_0045620
1008 Ga0495667_0002819
1009 Ga0495667_0011859
1010 Ga0495667_0035291
1011 Ga0495667_0046403
1012 Ga0495667_0049324
1013 Ga0495634_0015965
1014 Ga0495634_0130984
1015 Ga0495611_0028717
1016 Ga0495635_0014425
1017 Ga0495635_0066051
1018 Ga0495635_0073287
1019 Ga0495661_0079340
1020 Ga0495657_0075529
1021 Ga0495599_0157349
1022 Ga0495646_0039389
1023 Ga0495646_0056984
1024 Ga0495658_0027107
1025 Ga0495669_0060527
1026 Ga0495613_0041353
1027 Ga0495613_0116872
1028 Ga0495670_0001217
1029 Ga0495670_0046325
1030 Ga0495671_0013567
1031 Ga0495589_0078211
1032 Ga0495600_0009558
1033 Ga0495604_0002667
1034 Ga0495604_0076312
1035 Ga0495604_0212039
1036 Ga0495674_0007397
1037 Ga0495674_0049646
1038 Ga0495672_0001082
1039 Ga0495680_0004005
1040 Ga0495680_0016396
1041 Ga0495680_0024026
1042 Ga0495680_0180034
1043 Ga0495683_0021570
1044 Ga0495675_0032337
1045 Ga0495685_002755
1046 Ga0495673_0001630
1047 Ga0495681_0001798
1048 Ga0495684_0010279
1049 Ga0495684_0020269
1050 Ga0495686_0090007
1051 Ga0495593_0106269
1052 Ga0495593_0142331
1053 Ga0495602_0211767
1054 Ga0496100_0016487
1055 Ga0496100_0072612
1056 Ga0496100_0078057
1057 Ga0496101_0169581
1058 Ga0496102_0045241
1059 Ga0496102_0299556
1060 Ga0496103_0017673
1061 Ga0496104_0148442
1062 Ga0496105_0090400
1063 Ga0496106_0019309
1064 Ga0496106_0035890
1065 Ga0496106_0188462
1066 Ga0496107_0008369
1067 Ga0496107_0008507
1068 Ga0496107_0015603
1069 Ga0496107_0067400
1070 Ga0496108_0002372
1071 Ga0496108_0309204
1072 Ga0496109_0007413
1073 Ga0496109_0057720
1074 Ga0496109_0058746
1075 Ga0496110_0000112
1076 Ga0496110_0015618
1077 Ga0496110_0021215
1078 Ga0496110_0366903
1079 Ga0496111_0000091
1080 Ga0496111_0012747
1081 Ga0496112_0012177
1082 Ga0496112_0029106
1083 Ga0496112_0090032
1084 Ga0496112_0297252
1085 Ga0496112_0310984
1086 Ga0496113_0133017
1087 Ga0496113_0241003
1088 Ga0496114_0002364
1089 Ga0496114_0067805
1090 Ga0496114_0166941
1091 Ga0496114_0179633
1092 Ga0496119_0042516
1093 Ga0496119_0067514
1094 Ga0496122_0070914
1095 Ga0496123_0011874
1096 Ga0496126_0014053
1097 Ga0501031_0006555
1098 Ga0501031_0088984
1099 Ga0501032_0025950
1100 Ga0501036_0011939
1101 Ga0501036_0075189
1102 Ga0501038_0057757
1103 Ga0501038_0109782
1104 Ga0501040_0026345
1105 Ga0501040_0067038
1106 Ga0501041_0165993
1107 Ga0501042_0015196
1108 Ga0501042_0016044
1109 Ga0501042_0030173
1110 Ga0501048_0014863
1111 Ga0501067_0000584
1112 Ga0501067_0017608
1113 Ga0501067_0032118
1114 Ga0501067_0034310
1115 Ga0501067_0034697
1116 Ga0501067_0035542
1117 Ga0501067_0074293
1118 Ga0501067_0074359
1119 Ga0501068_0007980
1120 Ga0501068_0038447
1121 Ga0501068_0048402
1122 Ga0501069_0000256
1123 Ga0501069_0035452
1124 Ga0501069_0064921
1125 Ga0501069_0092692
1126 Ga0501069_0107419
1127 Ga0501070_0072930
1128 Ga0501070_0164828
1129 Ga0501071_0001507
1130 Ga0501072_0013793
1131 Ga0501072_0073688
1132 Ga0501072_0084333
1133 Ga0501073_0024497
1134 Ga0501073_0040126
1135 Ga0501074_0013090
1136 Ga0501075_0048759
1137 Ga0501076_0008812
1138 Ga0501076_0064311
1139 Ga0501077_0156901
1140 Ga0501079_0018595
1141 Ga0501079_0163935
1142 Ga0501080_0008547
1143 Ga0501080_0050028
1144 Ga0501081_0011938
1145 Ga0501081_0053572
1146 Ga0501081_0133411
1147 Ga0501083_0082901
1148 Ga0501045_0041574
1149 Ga0501045_0110039
1150 nmdc:mga06z11_19007_c1
1151 nmdc:mga05p37_23356_c1
1152 nmdc:mga08y16_33209_c1
1153 nmdc:mga08y16_48052_c1
1154 nmdc:mga08y16_52008_c1
1155 nmdc:mga08y16_52412_c1
1156 nmdc:mga0n895_139038_c1
1157 nmdc:mga0n895_15249_c1
1158 nmdc:mga0n895_182735_c1
1159 nmdc:mga0rr50_265074_c1
1160 nmdc:mga0rr50_31306_c1
1161 nmdc:mga0a205_135779_c1
1162 nmdc:mga0a205_7328_c1
1163 Ga0495601_0013003
1164 Ga0495612_0009607
1165 Ga0495612_0018131
1166 Ga0495595_0017929
1167 Ga0495619_0005999
1168 Ga0495619_0007846
1169 Ga0495619_0008870
1170 Ga0495619_0081719
1171 Ga0500578_0037865
1172 Ga0500660_032144
1173 Ga0500553_108723
1174 Ga0500560_004524
1175 Ga0500614_004002
1176 Ga0500628_001710
1177 Ga0500658_0003667
1178 Ga0500561_0000627
1179 Ga0500573_0016475
1180 Ga0500600_0045981
1181 Ga0500616_0015224
1182 Ga0500634_0011793
1183 Ga0501084_0034316
1184 Ga0501084_0043073
1185 Ga0501084_0139545
1186 Ga0501082_0229518
1187 Ga0466962_0000782
1188 Ga0466962_0068527
1189 Ga0530510_0053096
1190 Ga0530510_0136614
1191 Ga0530510_0149010
1192 2676496527
1193 2739235601
1194 2862291579
1195 2889305215
1196 2891396488
1197 2891557831
1198 2891567843
1199 2895433267
1200 2902795280
1201 2939746927
1202 2966925924
1203 8055073298
1204 8055174121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

43

186

0.95

PF08402

TOBE_2

TOBE domain

299

373

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9534 3 233
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9507 4 221
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9494 1 217
7z17-assembly1.cif.gz_J e. coli c-p lyase bound to a phnk abc dimer in an open conformation 0.9479 1 234
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9447 4 234
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.979 2 217 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9748 4 233 3.40.50.300
af_O69724_1_242_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9694 4 236 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9671 4 216 3.40.50.300
af_Q2G089_1_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.966 4 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A434SIS4-F1-model_v4 deleted 0.986 1 74
AF-A0A3D3SH22-F1-model_v4 deleted 0.9835 2 217
AF-A0A0P9DFL4-F1-model_v4 ABC transporter domain-containing protein 0.9826 2 157 GO:0005524
GO:0016887
AF-A0A2V9R859-F1-model_v4 ABC transporter domain-containing protein 0.9799 4 152 GO:0005524
GO:0016887
AF-A0A7J3BDG1-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9783 1 225 GO:0005524
GO:0016887

Map