F468157

General Info

Members Datasets Scaffolds Average Seq Length
602 269 1204 113

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100079366|Ga0075429_1000793662
Length 136
Sequence MLAGRFLFSLLSLPSLLCYALSLRMSKEDRTNADQLHGTLDMLVLKTLAAGPQHGYGIAQRLQQLSDAVLQVEEGSLYPALYRMEQRGWIASAWGVSENNRRARFYQLTRTGRKQLDAETASWRRLTGAVARVLEA

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
187 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
188 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
203 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
204 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
205 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
208 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
209 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
236 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
240 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
241 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
242 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
243 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
244 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
249 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
250 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
251 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
252 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
255 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
264 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
265 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 4.32
Rhizosphere 91.53
Stem 0
Stem Tuber 0
Unclassified 28.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100079366 3300006880 Unclassified 2861
2 Ga0065704_10197030 3300005289 Bacteria 1163
3 Ga0065712_10488883 3300005290 Bacteria 657
4 Ga0065712_10821360 3300005290 Bacteria 506
5 Ga0065715_10003806 3300005293 Bacteria 5515
6 Ga0065715_10293521 3300005293 Bacteria 1057
7 Ga0065715_10570897 3300005293 Bacteria 727
8 Ga0065707_10101288 3300005295 Bacteria 2874
9 Ga0065707_10252326 3300005295 Unclassified 1121
10 Ga0065707_10444755 3300005295 Unclassified 806
11 Ga0070676_10725773 3300005328 Bacteria 727
12 Ga0070676_11245235 3300005328 Unclassified 567
13 Ga0070676_11310380 3300005328 Unclassified 553
14 Ga0070683_100018231 3300005329 Bacteria 6215
15 Ga0070683_101455447 3300005329 Bacteria 658
16 Ga0070683_102203526 3300005329 Bacteria 529
17 Ga0070690_100006015 3300005330 Bacteria 6858
18 Ga0070670_100025021 3300005331 Bacteria 5136
19 Ga0070670_100195646 3300005331 Bacteria 1756
20 Ga0068869_100099816 3300005334 Bacteria 2194
21 Ga0070666_10257810 3300005335 Unclassified 1236
22 Ga0070666_10409214 3300005335 Bacteria 976
23 Ga0070666_10493711 3300005335 Bacteria 887
24 Ga0070680_100161687 3300005336 Bacteria 1882
25 Ga0070680_100863473 3300005336 Bacteria 780
26 Ga0070682_100134094 3300005337 Unclassified 1680
27 Ga0070682_100364239 3300005337 Bacteria 1082
28 Ga0070682_101015941 3300005337 Unclassified 689
29 Ga0070682_101205190 3300005337 Bacteria 639
30 Ga0070682_101446428 3300005337 Unclassified 589
31 Ga0068868_100065073 3300005338 Unclassified 2895
32 Ga0068868_100506695 3300005338 Bacteria 1058
33 Ga0068868_100877873 3300005338 Bacteria 814
34 Ga0068868_101494645 3300005338 Unclassified 632
35 Ga0070660_100340864 3300005339 Bacteria 1233
36 Ga0070660_101353179 3300005339 Unclassified 605
37 Ga0070689_100011797 3300005340 Bacteria 6270
38 Ga0070689_100057740 3300005340 Bacteria 3013
39 Ga0070689_100121879 3300005340 Bacteria 2083
40 Ga0070689_100398978 3300005340 Bacteria 1162
41 Ga0070689_102041940 3300005340 Unclassified 524
42 Ga0070689_102046955 3300005340 Unclassified 524
43 Ga0070661_100132235 3300005344 Bacteria 1875
44 Ga0070661_100193913 3300005344 Bacteria 1550
45 Ga0070661_100324429 3300005344 Bacteria 1203
46 Ga0070661_100684292 3300005344 Bacteria 835
47 Ga0070668_100940856 3300005347 Bacteria 774
48 Ga0070668_101159164 3300005347 Unclassified 699
49 Ga0070668_101487171 3300005347 Bacteria 619
50 Ga0070669_100021994 3300005353 Bacteria 4561
51 Ga0070669_100259608 3300005353 Bacteria 1386
52 Ga0070669_100942491 3300005353 Unclassified 739
53 Ga0070669_101034235 3300005353 Bacteria 706
54 Ga0070675_100076504 3300005354 Bacteria 2784
55 Ga0070675_100139633 3300005354 Unclassified 2070
56 Ga0070675_100535495 3300005354 Bacteria 1058
57 Ga0070674_100073096 3300005356 Bacteria 2430
58 Ga0070674_100315308 3300005356 Bacteria 1252
59 Ga0070673_101809531 3300005364 Unclassified 579
60 Ga0070688_100047745 3300005365 Bacteria 2657
61 Ga0070688_100137976 3300005365 Bacteria 1653
62 Ga0070688_100226145 3300005365 Bacteria 1321
63 Ga0070688_101457196 3300005365 Bacteria 556
64 Ga0070659_100050967 3300005366 Bacteria 3254
65 Ga0070659_100156891 3300005366 Bacteria 1859
66 Ga0070659_100410527 3300005366 Bacteria 1144
67 Ga0070659_100968165 3300005366 Bacteria 746
68 Ga0070659_101054144 3300005366 Bacteria 715
69 Ga0070659_101950400 3300005366 Unclassified 527
70 Ga0070667_100150808 3300005367 Bacteria 2042
71 Ga0070667_100178784 3300005367 Bacteria 1876
72 Ga0070714_100637339 3300005435 Bacteria 1025
73 Ga0070713_100048988 3300005436 Bacteria 3483
74 Ga0070710_10060933 3300005437 Bacteria 2148
75 Ga0070701_10194712 3300005438 Bacteria 1195
76 Ga0070711_100033666 3300005439 Bacteria 3413
77 Ga0070700_100267132 3300005441 Bacteria 1234
78 Ga0070700_100576081 3300005441 Bacteria 878
79 Ga0070708_100461144 3300005445 Unclassified 1199
80 Ga0070708_100495903 3300005445 Unclassified 1152
81 Ga0070708_101334536 3300005445 Bacteria 670
82 Ga0070663_100011358 3300005455 Bacteria 5587
83 Ga0070663_100375520 3300005455 Bacteria 1157
84 Ga0070663_101899637 3300005455 Unclassified 535
85 Ga0070678_101103228 3300005456 Bacteria 733
86 Ga0070678_101795556 3300005456 Unclassified 578
87 Ga0070662_100724755 3300005457 Bacteria 842
88 Ga0070662_101004948 3300005457 Bacteria 714
89 Ga0070662_101107438 3300005457 Bacteria 679
90 Ga0070681_10051317 3300005458 Bacteria 4113
91 Ga0070681_10330450 3300005458 Bacteria 1434
92 Ga0068867_100034163 3300005459 Unclassified 3685
93 Ga0068867_100063260 3300005459 Unclassified 2750
94 Ga0068867_100347424 3300005459 Bacteria 1237
95 Ga0070685_10079885 3300005466 Bacteria 1958
96 Ga0070685_10121242 3300005466 Bacteria 1624
97 Ga0070685_10329883 3300005466 Bacteria 1037
98 Ga0070685_10593315 3300005466 Unclassified 796
99 Ga0070698_101069826 3300005471 Bacteria 755
100 Ga0070698_101748511 3300005471 Bacteria 574
101 Ga0070679_100166331 3300005530 Bacteria 2179
102 Ga0070679_100220829 3300005530 Bacteria 1856
103 Ga0070679_100263336 3300005530 Bacteria 1679
104 Ga0070679_100307404 3300005530 Unclassified 1536
105 Ga0070684_100032061 3300005535 Bacteria 4476
106 Ga0070684_100146065 3300005535 Unclassified 2141
107 Ga0070684_100169617 3300005535 Bacteria 1982
108 Ga0070684_100383998 3300005535 Bacteria 1294
109 Ga0070697_100437581 3300005536 Bacteria 1138
110 Ga0070672_100387233 3300005543 Bacteria 1197
111 Ga0070672_100658536 3300005543 Unclassified 915
112 Ga0070686_100254780 3300005544 Unclassified 1283
113 Ga0070686_100294274 3300005544 Bacteria 1202
114 Ga0070695_100253907 3300005545 Bacteria 1281
115 Ga0070693_100095402 3300005547 Bacteria 1801
116 Ga0070693_101197864 3300005547 Unclassified 583
117 Ga0070665_100307024 3300005548 Unclassified 1590
118 Ga0070665_100485148 3300005548 Bacteria 1247
119 Ga0068855_100097826 3300005563 Bacteria 3381
120 Ga0070664_100048983 3300005564 Bacteria 3572
121 Ga0070664_100071920 3300005564 Bacteria 2965
122 Ga0070664_101474120 3300005564 Bacteria 644
123 Ga0068857_100204580 3300005577 Bacteria 1800
124 Ga0068857_100826305 3300005577 Unclassified 886
125 Ga0068857_101034500 3300005577 Bacteria 791
126 Ga0068857_102025477 3300005577 Bacteria 565
127 Ga0068854_100664084 3300005578 Bacteria 896
128 Ga0068854_101722206 3300005578 Bacteria 573
129 Ga0068854_102087440 3300005578 Bacteria 523
130 Ga0068856_100810785 3300005614 Bacteria 956
131 Ga0070702_100664388 3300005615 Bacteria 790
132 Ga0070702_100741248 3300005615 Bacteria 753
133 Ga0070702_100748709 3300005615 Unclassified 750
134 Ga0068859_100023633 3300005617 Bacteria 6169
135 Ga0068859_100156493 3300005617 Bacteria 2356
136 Ga0068859_100570242 3300005617 Bacteria 1226
137 Ga0068859_100959843 3300005617 Bacteria 938
138 Ga0068864_100980921 3300005618 Bacteria 837
139 Ga0068864_101116893 3300005618 Unclassified 785
140 Ga0068864_101535802 3300005618 Unclassified 669
141 Ga0068864_102459063 3300005618 Unclassified 527
142 Ga0068866_10083727 3300005718 Bacteria 1719
143 Ga0068866_10989089 3300005718 Bacteria 597
144 Ga0068861_100163544 3300005719 Unclassified 1838
145 Ga0068861_100713835 3300005719 Bacteria 933
146 Ga0068861_101892363 3300005719 Bacteria 593
147 Ga0068851_10828474 3300005834 Unclassified 576
148 Ga0068870_10032339 3300005840 Unclassified 2659
149 Ga0068870_10125008 3300005840 Bacteria 1486
150 Ga0068870_10723183 3300005840 Bacteria 689
151 Ga0068863_100016720 3300005841 Bacteria 7039
152 Ga0068863_100377963 3300005841 Bacteria 1383
153 Ga0068863_100535848 3300005841 Unclassified 1155
154 Ga0068860_100221465 3300005843 Bacteria 1838
155 Ga0068860_100941672 3300005843 Bacteria 881
156 Ga0068860_101172909 3300005843 Unclassified 788
157 Ga0068860_101932223 3300005843 Unclassified 612
158 Ga0068862_100056204 3300005844 Unclassified 3371
159 Ga0068862_100292698 3300005844 Unclassified 1496
160 Ga0068862_100408690 3300005844 Bacteria 1271
161 Ga0068862_101028954 3300005844 Bacteria 816
162 Ga0081540_1122144 3300005983 Bacteria 1079
163 Ga0075368_10101141 3300006042 Bacteria 1184
164 Ga0075363_100049867 3300006048 Bacteria 2230
165 Ga0075364_10001988 3300006051 Bacteria 11390
166 Ga0070716_100744804 3300006173 Bacteria 753
167 Ga0075362_10001240 3300006177 Bacteria 8049
168 Ga0075362_10461302 3300006177 Bacteria 646
169 Ga0075367_10000983 3300006178 Bacteria 11664
170 Ga0075367_10165239 3300006178 Bacteria 1377
171 Ga0075367_10173878 3300006178 Bacteria 1342
172 Ga0075367_10586734 3300006178 Unclassified 708
173 Ga0075369_10154797 3300006186 Bacteria 1049
174 Ga0075366_10034058 3300006195 Bacteria 3001
175 Ga0075366_10107277 3300006195 Bacteria 1679
176 Ga0075366_10280069 3300006195 Bacteria 1019
177 Ga0075366_10925951 3300006195 Bacteria 543
178 Ga0075366_11024038 3300006195 Unclassified 515
179 Ga0097621_100031316 3300006237 Bacteria 4220
180 Ga0097621_100191719 3300006237 Bacteria 1770
181 Ga0097621_100248958 3300006237 Bacteria 1555
182 Ga0097621_100599369 3300006237 Bacteria 1007
183 Ga0075370_10063683 3300006353 Bacteria 2102
184 Ga0068871_100068745 3300006358 Bacteria 2908
185 Ga0068871_100612258 3300006358 Unclassified 991
186 Ga0075428_100003791 3300006844 Bacteria 16573
187 Ga0075428_100019775 3300006844 Bacteria 7453
188 Ga0075428_100066770 3300006844 Bacteria 3938
189 Ga0075428_100199242 3300006844 Bacteria 2165
190 Ga0075428_101772172 3300006844 Bacteria 643
191 Ga0075430_100547518 3300006846 Bacteria 954
192 Ga0075430_100750928 3300006846 Unclassified 804
193 Ga0075430_100777659 3300006846 Bacteria 789
194 Ga0075430_101513051 3300006846 Unclassified 551
195 Ga0075431_100038616 3300006847 Bacteria 4917
196 Ga0075431_100267052 3300006847 Bacteria 1735
197 Ga0075431_100380538 3300006847 Bacteria 1415
198 Ga0075433_10191138 3300006852 Unclassified 1821
199 Ga0075433_10210624 3300006852 Bacteria 1727
200 Ga0075433_10291121 3300006852 Unclassified 1446
201 Ga0075433_10461254 3300006852 Unclassified 1120
202 Ga0075434_100006968 3300006871 Bacteria 10419
203 Ga0075434_100213128 3300006871 Unclassified 1951
204 Ga0075434_100848022 3300006871 Bacteria 929
205 Ga0075429_100004555 3300006880 Bacteria 11912
206 Ga0075429_100693601 3300006880 Unclassified 892
207 Ga0075429_100804980 3300006880 Bacteria 823
208 Ga0075429_101034558 3300006880 Bacteria 718
209 Ga0075429_101447262 3300006880 Bacteria 598
210 Ga0068865_100063863 3300006881 Bacteria 2590
211 Ga0068865_100338236 3300006881 Unclassified 1216
212 Ga0097620_100023634 3300006931 Bacteria 6169
213 Ga0097620_100068251 3300006931 Bacteria 3591
214 Ga0097620_100156501 3300006931 Bacteria 2356
215 Ga0097620_100570315 3300006931 Bacteria 1226
216 Ga0097620_100959762 3300006931 Bacteria 938
217 Ga0075435_100018556 3300007076 Bacteria 5294
218 Ga0075435_101060838 3300007076 Bacteria 708
219 Ga0105240_10151818 3300009093 Bacteria 2758
220 Ga0111539_10000249 3300009094 Bacteria 64681
221 Ga0111539_10008022 3300009094 Bacteria 13469
222 Ga0111539_10014410 3300009094 Bacteria 9868
223 Ga0111539_10040445 3300009094 Bacteria 5613
224 Ga0111539_10049235 3300009094 Bacteria 5026
225 Ga0111539_10207075 3300009094 Unclassified 2286
226 Ga0111539_10300403 3300009094 Bacteria 1868
227 Ga0111539_10749763 3300009094 Bacteria 1136
228 Ga0111539_11279555 3300009094 Bacteria 851
229 Ga0111539_11601479 3300009094 Unclassified 755
230 Ga0105245_10151087 3300009098 Bacteria 2196
231 Ga0105245_13208106 3300009098 Unclassified 507
232 Ga0105247_11668372 3300009101 Unclassified 526
233 Ga0114129_10000118 3300009147 Bacteria 79809
234 Ga0114129_10002204 3300009147 Bacteria 26849
235 Ga0114129_10004307 3300009147 Bacteria 20115
236 Ga0114129_10011897 3300009147 Bacteria 12379
237 Ga0114129_10182724 3300009147 Unclassified 2852
238 Ga0114129_11117302 3300009147 Bacteria 986
239 Ga0114129_12975746 3300009147 Bacteria 558
240 Ga0105243_10102690 3300009148 Bacteria 2376
241 Ga0105243_10299464 3300009148 Bacteria 1457
242 Ga0105243_10642457 3300009148 Bacteria 1027
243 Ga0105241_11381570 3300009174 Bacteria 674
244 Ga0105242_10192966 3300009176 Bacteria 1804
245 Ga0105242_10684870 3300009176 Bacteria 1001
246 Ga0105242_11792035 3300009176 Unclassified 652
247 Ga0105248_10076496 3300009177 Bacteria 3762
248 Ga0105248_10108191 3300009177 Unclassified 3135
249 Ga0105248_10213499 3300009177 Unclassified 2174
250 Ga0105248_10352618 3300009177 Bacteria 1657
251 Ga0105248_10570044 3300009177 Bacteria 1277
252 Ga0105248_10652490 3300009177 Bacteria 1187
253 Ga0105248_10849157 3300009177 Bacteria 1031
254 Ga0105248_11105944 3300009177 Unclassified 896
255 Ga0105248_13102485 3300009177 Unclassified 529
256 Ga0105249_10001474 3300009553 Bacteria 20625
257 Ga0105249_10353559 3300009553 Bacteria 1489
258 Ga0105249_11426548 3300009553 Unclassified 764
259 Ga0105249_12451849 3300009553 Unclassified 594
260 Ga0105249_12488688 3300009553 Bacteria 590
261 Ga0105239_12503152 3300010375 Unclassified 601
262 Ga0105246_10127628 3300011119 Bacteria 1895
263 Ga0105246_10343746 3300011119 Bacteria 1220
264 Ga0105246_10805434 3300011119 Bacteria 834
265 Ga0105246_11420306 3300011119 Bacteria 648
266 Ga0105246_11438043 3300011119 Bacteria 645
267 Ga0157370_10143130 3300013104 Bacteria 2227
268 Ga0157374_10698218 3300013296 Unclassified 1028
269 Ga0157378_10135392 3300013297 Bacteria 2284
270 Ga0157378_12261962 3300013297 Unclassified 595
271 Ga0163162_10059441 3300013306 Unclassified 3854
272 Ga0163162_10775563 3300013306 Bacteria 1077
273 Ga0157372_10097949 3300013307 Bacteria 3345
274 Ga0157372_10327213 3300013307 Bacteria 1784
275 Ga0157375_10439584 3300013308 Bacteria 1470
276 Ga0157375_10799629 3300013308 Bacteria 1092
277 Ga0157375_11366040 3300013308 Bacteria 834
278 Ga0157375_11466973 3300013308 Bacteria 805
279 Ga0157375_12596523 3300013308 Bacteria 605
280 Ga0163163_10016096 3300014325 Bacteria 6937
281 Ga0163163_10198617 3300014325 Bacteria 2054
282 Ga0163163_10390847 3300014325 Bacteria 1449
283 Ga0163163_10549763 3300014325 Bacteria 1217
284 Ga0163163_10841807 3300014325 Bacteria 981
285 Ga0163163_12556196 3300014325 Unclassified 568
286 Ga0157380_10276013 3300014326 Bacteria 1535
287 Ga0157380_10476932 3300014326 Bacteria 1205
288 Ga0157380_11071338 3300014326 Unclassified 843
289 Ga0157380_11284634 3300014326 Bacteria 778
290 Ga0157380_11459060 3300014326 Bacteria 736
291 Ga0157377_10328171 3300014745 Unclassified 1019
292 Ga0157379_10184702 3300014968 Unclassified 1884
293 Ga0157379_11575983 3300014968 Bacteria 641
294 Ga0157379_11705999 3300014968 Bacteria 617
295 Ga0157376_10119776 3300014969 Bacteria 2331
296 Ga0157376_10172806 3300014969 Bacteria 1969
297 Ga0157376_10284116 3300014969 Bacteria 1560
298 Ga0207697_10097591 3300025315 Bacteria 1250
299 Ga0207697_10320199 3300025315 Bacteria 688
300 Ga0207656_10056696 3300025321 Bacteria 1708
301 Ga0207692_10037262 3300025898 Bacteria 2377
302 Ga0207642_10328707 3300025899 Bacteria 895
303 Ga0207642_10595185 3300025899 Unclassified 688
304 Ga0207688_10950577 3300025901 Bacteria 544
305 Ga0207680_10463539 3300025903 Unclassified 900
306 Ga0207680_10664351 3300025903 Unclassified 746
307 Ga0207647_10214800 3300025904 Bacteria 1110
308 Ga0207645_10096126 3300025907 Unclassified 1908
309 Ga0207643_10039087 3300025908 Bacteria 2669
310 Ga0207643_10228547 3300025908 Bacteria 1141
311 Ga0207705_10558953 3300025909 Unclassified 889
312 Ga0207654_11298370 3300025911 Unclassified 531
313 Ga0207707_10127288 3300025912 Bacteria 2227
314 Ga0207707_10763465 3300025912 Bacteria 808
315 Ga0207695_10249041 3300025913 Bacteria 1676
316 Ga0207671_10587345 3300025914 Unclassified 888
317 Ga0207662_10006740 3300025918 Bacteria 6213
318 Ga0207662_10560106 3300025918 Bacteria 792
319 Ga0207662_10896962 3300025918 Bacteria 627
320 Ga0207662_10984769 3300025918 Bacteria 598
321 Ga0207657_10256538 3300025919 Bacteria 1392
322 Ga0207657_10428167 3300025919 Bacteria 1040
323 Ga0207649_10220118 3300025920 Bacteria 1352
324 Ga0207649_10360947 3300025920 Bacteria 1078
325 Ga0207652_10227080 3300025921 Bacteria 1683
326 Ga0207646_11226536 3300025922 Unclassified 657
327 Ga0207681_10042867 3300025923 Unclassified 3025
328 Ga0207681_10612069 3300025923 Unclassified 901
329 Ga0207681_10969489 3300025923 Bacteria 713
330 Ga0207694_10209442 3300025924 Unclassified 1588
331 Ga0207694_11101342 3300025924 Bacteria 672
332 Ga0207650_10122110 3300025925 Bacteria 2029
333 Ga0207650_11012756 3300025925 Bacteria 706
334 Ga0207659_10030851 3300025926 Unclassified 3665
335 Ga0207659_10249052 3300025926 Bacteria 1441
336 Ga0207659_10270494 3300025926 Bacteria 1386
337 Ga0207659_11336990 3300025926 Bacteria 615
338 Ga0207687_10151477 3300025927 Unclassified 1770
339 Ga0207700_10307854 3300025928 Bacteria 1370
340 Ga0207664_10973175 3300025929 Unclassified 761
341 Ga0207644_10326543 3300025931 Bacteria 1242
342 Ga0207690_10074433 3300025932 Bacteria 2352
343 Ga0207690_10164949 3300025932 Bacteria 1655
344 Ga0207690_10870720 3300025932 Bacteria 746
345 Ga0207706_10111725 3300025933 Bacteria 2404
346 Ga0207706_11379270 3300025933 Unclassified 579
347 Ga0207706_11471172 3300025933 Bacteria 557
348 Ga0207686_10048051 3300025934 Bacteria 2641
349 Ga0207686_10455232 3300025934 Unclassified 985
350 Ga0207709_10361343 3300025935 Bacteria 1099
351 Ga0207670_10090063 3300025936 Bacteria 2166
352 Ga0207670_10179842 3300025936 Bacteria 1592
353 Ga0207670_10851501 3300025936 Bacteria 762
354 Ga0207669_10409167 3300025937 Bacteria 1065
355 Ga0207704_10176098 3300025938 Bacteria 1540
356 Ga0207704_10948776 3300025938 Bacteria 725
357 Ga0207665_10791478 3300025939 Bacteria 749
358 Ga0207691_10021451 3300025940 Bacteria 6098
359 Ga0207711_10496125 3300025941 Bacteria 1138
360 Ga0207711_10519548 3300025941 Bacteria 1110
361 Ga0207711_11828874 3300025941 Bacteria 550
362 Ga0207689_10020933 3300025942 Bacteria 5498
363 Ga0207689_10079138 3300025942 Bacteria 2702
364 Ga0207689_10145295 3300025942 Unclassified 1954
365 Ga0207661_10010110 3300025944 Bacteria 6781
366 Ga0207661_10749808 3300025944 Bacteria 899
367 Ga0207679_10058146 3300025945 Bacteria 2863
368 Ga0207679_10155262 3300025945 Bacteria 1868
369 Ga0207679_10970878 3300025945 Bacteria 778
370 Ga0207667_11313284 3300025949 Bacteria 699
371 Ga0207667_11726643 3300025949 Unclassified 592
372 Ga0207712_10015269 3300025961 Bacteria 4951
373 Ga0207712_11087113 3300025961 Bacteria 712
374 Ga0207668_10026583 3300025972 Unclassified 3759
375 Ga0207668_10779753 3300025972 Bacteria 845
376 Ga0207668_10783341 3300025972 Bacteria 843
377 Ga0207668_11939447 3300025972 Bacteria 531
378 Ga0207640_10571971 3300025981 Unclassified 953
379 Ga0207640_10650665 3300025981 Bacteria 898
380 Ga0207640_11313140 3300025981 Bacteria 646
381 Ga0207658_10204661 3300025986 Unclassified 1650
382 Ga0207658_10276328 3300025986 Bacteria 1438
383 Ga0207677_10311587 3300026023 Bacteria 1304
384 Ga0207677_10463753 3300026023 Bacteria 1088
385 Ga0207677_10568393 3300026023 Bacteria 991
386 Ga0207677_11497934 3300026023 Unclassified 623
387 Ga0207639_11683187 3300026041 Unclassified 595
388 Ga0207678_10065634 3300026067 Bacteria 3116
389 Ga0207678_11029028 3300026067 Bacteria 729
390 Ga0207678_11503716 3300026067 Unclassified 594
391 Ga0207708_10138160 3300026075 Bacteria 1910
392 Ga0207641_10016999 3300026088 Bacteria 5955
393 Ga0207641_10324357 3300026088 Bacteria 1461
394 Ga0207648_10075154 3300026089 Unclassified 2946
395 Ga0207648_10314234 3300026089 Bacteria 1407
396 Ga0207648_11006649 3300026089 Bacteria 780
397 Ga0207676_11479023 3300026095 Bacteria 676
398 Ga0207674_10155958 3300026116 Bacteria 2238
399 Ga0207674_10157539 3300026116 Bacteria 2226
400 Ga0207674_10185941 3300026116 Bacteria 2028
401 Ga0207674_10540049 3300026116 Bacteria 1126
402 Ga0207675_100076389 3300026118 Unclassified 3137
403 Ga0207698_11364163 3300026142 Bacteria 724
404 Ga0207698_12069528 3300026142 Unclassified 583
405 Ga0207428_10003205 3300027907 Bacteria 15996
406 Ga0207428_10026092 3300027907 Bacteria 4881
407 Ga0207428_10255598 3300027907 Bacteria 1306
408 Ga0207428_10318699 3300027907 Bacteria 1148
409 Ga0207428_10574359 3300027907 Bacteria 814
410 Ga0207428_10622741 3300027907 Bacteria 776
411 Ga0268266_10283213 3300028379 Unclassified 1542
412 Ga0268266_10351517 3300028379 Bacteria 1385
413 Ga0268265_10094067 3300028380 Bacteria 2403
414 Ga0268265_10273579 3300028380 Bacteria 1508
415 Ga0268265_10435173 3300028380 Bacteria 1221
416 Ga0268265_12513382 3300028380 Unclassified 521
417 Ga0268264_11109390 3300028381 Unclassified 800
418 Ga0268264_12303459 3300028381 Unclassified 545
419 Ga0307408_100086510 3300031548 Bacteria 2356
420 Ga0307408_100138388 3300031548 Unclassified 1908
421 Ga0307408_100172207 3300031548 Bacteria 1729
422 Ga0307405_10626738 3300031731 Bacteria 881
423 Ga0307405_11667763 3300031731 Unclassified 564
424 Ga0307410_10096296 3300031852 Bacteria 2112
425 Ga0307410_12100368 3300031852 Unclassified 505
426 Ga0307406_10069759 3300031901 Bacteria 2299
427 Ga0307406_11538499 3300031901 Bacteria 586
428 Ga0307407_10090983 3300031903 Bacteria 1870
429 Ga0307412_10012431 3300031911 Bacteria 4965
430 Ga0307409_100126266 3300031995 Bacteria 2177
431 Ga0307416_100020848 3300032002 Bacteria 4688
432 Ga0307414_10893170 3300032004 Bacteria 814
433 Ga0307411_10036571 3300032005 Bacteria 3078
434 Ga0307411_10152487 3300032005 Bacteria 1719
435 Ga0307415_100071568 3300032126 Bacteria 2439
436 Ga0373936_0213087 3300035113 Bacteria 855
437 Ga0373945_0487995 3300035116 Unclassified 548
438 Ga0373943_0034854 3300035170 Bacteria 2403
439 Ga0373943_0303069 3300035170 Unclassified 908
440 Ga0373955_0203839 3300035172 Bacteria 1178
441 Ga0373935_0938662 3300035692 Unclassified 642
442 Ga0373927_0032133 3300035695 Bacteria 3418
443 Ga0373927_0771776 3300035695 Unclassified 635
444 Ga0373937_1362982 3300036401 Bacteria 657
445 Ga0373937_1617886 3300036401 Bacteria 595
446 Ga0373925_0350088 3300037068 Bacteria 1199
447 Ga0373925_0463933 3300037068 Bacteria 1038
448 Ga0395900_0779560 3300037418 Bacteria 885
449 Ga0436362_1099706 3300039453 Bacteria 825
450 Ga0451802_1198630 3300041460 Unclassified 555
451 Ga0439435_0003509 3300042436 Bacteria 3272
452 Ga0439464_0197935 3300042439 Unclassified 640
453 Ga0466961_0522888 3300044693 Bacteria 716
454 Ga0453684_0000019 3300044712 Bacteria 908702
455 Ga0495592_0263458 3300046454 Unclassified 1134
456 Ga0495629_0672693 3300046459 Bacteria 689
457 Ga0495580_0139012 3300046472 Bacteria 1684
458 Ga0495580_0484655 3300046472 Bacteria 827
459 Ga0495582_0124090 3300046473 Unclassified 1456
460 Ga0495582_0263765 3300046473 Bacteria 988
461 Ga0495639_0077573 3300046475 Bacteria 1542
462 Ga0495662_0200096 3300046476 Unclassified 985
463 Ga0495664_0211602 3300046477 Unclassified 1174
464 Ga0495594_0065161 3300046499 Bacteria 2021
465 Ga0495594_0282983 3300046499 Bacteria 945
466 Ga0495594_0474716 3300046499 Unclassified 711
467 Ga0495618_0360836 3300046514 Unclassified 894
468 Ga0495628_0091132 3300046516 Unclassified 2360
469 Ga0495628_0107932 3300046516 Bacteria 2143
470 Ga0495642_0154684 3300046528 Unclassified 993
471 Ga0495665_0592824 3300046531 Bacteria 554
472 Ga0495640_0054871 3300046533 Bacteria 2728
473 Ga0495586_0061466 3300046535 Bacteria 2044
474 Ga0495645_0048987 3300046543 Unclassified 3077
475 Ga0495646_0153311 3300046680 Unclassified 1280
476 Ga0495647_0014344 3300046681 Bacteria 2760
477 Ga0495658_0493380 3300046683 Bacteria 783
478 Ga0495613_0287243 3300046689 Bacteria 1141
479 Ga0495581_0061620 3300047315 Bacteria 2168
480 Ga0495581_0177942 3300047315 Bacteria 1244
481 Ga0495674_0027211 3300047319 Bacteria 5227
482 Ga0495674_0844820 3300047319 Bacteria 710
483 Ga0495675_0142254 3300047444 Unclassified 1486
484 Ga0495684_0034338 3300047471 Bacteria 3891
485 Ga0495602_0951595 3300048088 Unclassified 569
486 Ga0496101_0121782 3300048904 Bacteria 1973
487 Ga0496101_0290702 3300048904 Bacteria 1279
488 Ga0496102_0572707 3300048905 Bacteria 1052
489 Ga0496102_1265087 3300048905 Unclassified 657
490 Ga0496102_1864707 3300048905 Bacteria 518
491 Ga0496104_0010897 3300048907 Bacteria 8133
492 Ga0496104_0292279 3300048907 Bacteria 1542
493 Ga0496105_0032818 3300048908 Unclassified 4262
494 Ga0496105_0052953 3300048908 Bacteria 3352
495 Ga0496108_0123383 3300048911 Bacteria 2223
496 Ga0496108_0566185 3300048911 Unclassified 991
497 Ga0496108_0700876 3300048911 Bacteria 878
498 Ga0496108_0893603 3300048911 Bacteria 763
499 Ga0496109_1328125 3300048912 Bacteria 655
500 Ga0496110_0396760 3300048913 Bacteria 1258
501 Ga0496110_0558726 3300048913 Bacteria 1040
502 Ga0496110_0772681 3300048913 Unclassified 864
503 Ga0496110_1850035 3300048913 Bacteria 514
504 Ga0496112_0129666 3300048915 Unclassified 2493
505 Ga0496112_0887570 3300048915 Bacteria 814
506 Ga0496113_0852217 3300048916 Bacteria 722
507 Ga0496114_0047580 3300048917 Bacteria 3567
508 Ga0496114_0432653 3300048917 Unclassified 1165
509 Ga0496114_1710412 3300048917 Bacteria 517
510 Ga0496115_0028239 3300048918 Bacteria 4397
511 Ga0501034_0103006 3300049571 Bacteria 2848
512 Ga0501038_0613223 3300049574 Viruses 822
513 Ga0501039_0112702 3300049575 Unclassified 2127
514 Ga0501040_0474786 3300049576 Viruses 901
515 Ga0501041_0537417 3300049577 Unclassified 745
516 Ga0501041_1084620 3300049577 Bacteria 516
517 Ga0501042_0612045 3300049578 Bacteria 792
518 Ga0501046_0230876 3300049580 Unclassified 1367
519 Ga0501047_0336650 3300049581 Bacteria 1347
520 Ga0501068_0301721 3300049584 Unclassified 1025
521 Ga0501072_0053055 3300049588 Unclassified 3193
522 Ga0501072_0588800 3300049588 Viruses 877
523 Ga0501072_1250031 3300049588 Unclassified 576
524 Ga0501074_0290065 3300049590 Unclassified 1163
525 Ga0501074_0758094 3300049590 Unclassified 684
526 Ga0501075_0080477 3300049591 Bacteria 2466
527 Ga0501075_0140196 3300049591 Unclassified 1842
528 Ga0501075_0661832 3300049591 Bacteria 796
529 Ga0501076_0033387 3300049592 Unclassified 4018
530 Ga0501216_095502 3300049660 Unclassified 648
531 Ga0501236_115324 3300049670 Bacteria 541
532 Ga0501221_196813 3300049704 Bacteria 558
533 Ga0501079_0209252 3300049741 Unclassified 1523
534 Ga0501080_0266970 3300049742 Bacteria 1558
535 Ga0501080_0367352 3300049742 Bacteria 1298
536 Ga0501080_0931228 3300049742 Unclassified 756
537 Ga0501081_0091556 3300049743 Unclassified 2139
538 Ga0501081_0099607 3300049743 Unclassified 2053
539 Ga0501081_0373529 3300049743 Bacteria 1053
540 Ga0501081_1215144 3300049743 Unclassified 571
541 Ga0501081_1358382 3300049743 Unclassified 539
542 Ga0501083_0237810 3300049744 Bacteria 1186
543 Ga0501035_0231670 3300049822 Unclassified 1574
544 Ga0501045_0263333 3300049824 Unclassified 1283
545 Ga0501045_0299881 3300049824 Bacteria 1196
546 Ga0501045_0941348 3300049824 Unclassified 634
547 Ga0501204_050266 3300049850 Bacteria 637
548 nmdc:mga00v17_389984_c1 3300050491 Bacteria 905
549 nmdc:mga0yw44_217872_c1 3300050492 Bacteria 1264
550 nmdc:mga0k408_292205_c1 3300050493 Bacteria 973
551 nmdc:mga0k408_353708_c1 3300050493 Bacteria 875
552 nmdc:mga0k408_57768_c1 3300050493 Bacteria 2253
553 nmdc:mga0k408_690009_c1 3300050493 Unclassified 599
554 nmdc:mga0k408_886147_c1 3300050493 Bacteria 518
555 nmdc:mga0k408_935132_c1 3300050493 Unclassified 502
556 nmdc:mga06z11_26977_c1 3300050494 Bacteria 2741
557 nmdc:mga05p37_10506_c1 3300050507 Bacteria 10981
558 nmdc:mga05p37_36141_c1 3300050507 Bacteria 6061
559 nmdc:mga05p37_378277_c1 3300050507 Unclassified 1660
560 nmdc:mga05p37_42729_c1 3300050507 Bacteria 5571
561 nmdc:mga09592_14594_c1 3300050508 Bacteria 6411
562 nmdc:mga09592_56932_c1 3300050508 Unclassified 3303
563 nmdc:mga09592_691872_c1 3300050508 Unclassified 868
564 nmdc:mga0qj67_1147236_c1 3300050509 Unclassified 606
565 nmdc:mga0qj67_2382_c1 3300050509 Bacteria 13392
566 nmdc:mga0qj67_537628_c1 3300050509 Unclassified 938
567 nmdc:mga0qj67_643301_c1 3300050509 Unclassified 846
568 nmdc:mga06r32_313292_c1 3300050510 Bacteria 1555
569 nmdc:mga06r32_44730_c1 3300050510 Bacteria 4217
570 nmdc:mga06r32_59170_c1 3300050510 Bacteria 3684
571 nmdc:mga08y16_1082037_c1 3300050511 Unclassified 778
572 nmdc:mga08y16_11425_c1 3300050511 Bacteria 9331
573 nmdc:mga08y16_270020_c1 3300050511 Bacteria 1756
574 nmdc:mga08y16_281611_c1 3300050511 Bacteria 1715
575 nmdc:mga08y16_518666_c1 3300050511 Unclassified 1209
576 nmdc:mga08y16_540419_c1 3300050511 Bacteria 1180
577 nmdc:mga08y16_545801_c1 3300050511 Unclassified 1173
578 nmdc:mga08y16_5720_c1 3300050511 Bacteria 13027
579 nmdc:mga08y16_908752_c1 3300050511 Bacteria 866
580 nmdc:mga0n895_180489_c1 3300050512 Bacteria 2142
581 nmdc:mga0rr50_287740_c1 3300050513 Bacteria 1372
582 nmdc:mga0rr50_6454_c1 3300050513 Bacteria 7142
583 nmdc:mga0a205_29629_c1 3300050515 Bacteria 5238
584 nmdc:mga0a205_590496_c1 3300050515 Bacteria 964
585 Ga0495601_0014222 3300053077 Unclassified 4794
586 Ga0495612_0383859 3300053078 Unclassified 637
587 Ga0501084_0171719 3300054114 Unclassified 1830
588 Ga0501084_0215685 3300054114 Bacteria 1619
589 Ga0501084_0308882 3300054114 Unclassified 1336
590 Ga0501084_0438676 3300054114 Bacteria 1104
591 Ga0501084_1249808 3300054114 Bacteria 623
592 Ga0590071_002907 3300059421 Bacteria 4268
593 Ga0590074_002931 3300059423 Bacteria 2810
594 Ga0590075_000344 3300059424 Bacteria 12978
595 Ga0590077_000491 3300059426 Bacteria 11085
596 Ga0501082_0054832 3300060353 Bacteria 3436
597 Ga0501082_0086925 3300060353 Unclassified 2697
598 Ga0501082_0228457 3300060353 Bacteria 1620
599 Ga0501082_0570714 3300060353 Bacteria 990
600 Ga0530510_0107470 3300061734 Unclassified 2042
601 Ga0530510_0492863 3300061734 Bacteria 929
602 Ga0530510_1445058 3300061734 Unclassified 528
603 Ga0075429_100079366
604 Ga0065704_10197030
605 Ga0065712_10488883
606 Ga0065712_10821360
607 Ga0065715_10003806
608 Ga0065715_10293521
609 Ga0065715_10570897
610 Ga0065707_10101288
611 Ga0065707_10252326
612 Ga0065707_10444755
613 Ga0070676_10725773
614 Ga0070676_11245235
615 Ga0070676_11310380
616 Ga0070683_100018231
617 Ga0070683_101455447
618 Ga0070683_102203526
619 Ga0070690_100006015
620 Ga0070670_100025021
621 Ga0070670_100195646
622 Ga0068869_100099816
623 Ga0070666_10257810
624 Ga0070666_10409214
625 Ga0070666_10493711
626 Ga0070680_100161687
627 Ga0070680_100863473
628 Ga0070682_100134094
629 Ga0070682_100364239
630 Ga0070682_101015941
631 Ga0070682_101205190
632 Ga0070682_101446428
633 Ga0068868_100065073
634 Ga0068868_100506695
635 Ga0068868_100877873
636 Ga0068868_101494645
637 Ga0070660_100340864
638 Ga0070660_101353179
639 Ga0070689_100011797
640 Ga0070689_100057740
641 Ga0070689_100121879
642 Ga0070689_100398978
643 Ga0070689_102041940
644 Ga0070689_102046955
645 Ga0070661_100132235
646 Ga0070661_100193913
647 Ga0070661_100324429
648 Ga0070661_100684292
649 Ga0070668_100940856
650 Ga0070668_101159164
651 Ga0070668_101487171
652 Ga0070669_100021994
653 Ga0070669_100259608
654 Ga0070669_100942491
655 Ga0070669_101034235
656 Ga0070675_100076504
657 Ga0070675_100139633
658 Ga0070675_100535495
659 Ga0070674_100073096
660 Ga0070674_100315308
661 Ga0070673_101809531
662 Ga0070688_100047745
663 Ga0070688_100137976
664 Ga0070688_100226145
665 Ga0070688_101457196
666 Ga0070659_100050967
667 Ga0070659_100156891
668 Ga0070659_100410527
669 Ga0070659_100968165
670 Ga0070659_101054144
671 Ga0070659_101950400
672 Ga0070667_100150808
673 Ga0070667_100178784
674 Ga0070714_100637339
675 Ga0070713_100048988
676 Ga0070710_10060933
677 Ga0070701_10194712
678 Ga0070711_100033666
679 Ga0070700_100267132
680 Ga0070700_100576081
681 Ga0070708_100461144
682 Ga0070708_100495903
683 Ga0070708_101334536
684 Ga0070663_100011358
685 Ga0070663_100375520
686 Ga0070663_101899637
687 Ga0070678_101103228
688 Ga0070678_101795556
689 Ga0070662_100724755
690 Ga0070662_101004948
691 Ga0070662_101107438
692 Ga0070681_10051317
693 Ga0070681_10330450
694 Ga0068867_100034163
695 Ga0068867_100063260
696 Ga0068867_100347424
697 Ga0070685_10079885
698 Ga0070685_10121242
699 Ga0070685_10329883
700 Ga0070685_10593315
701 Ga0070698_101069826
702 Ga0070698_101748511
703 Ga0070679_100166331
704 Ga0070679_100220829
705 Ga0070679_100263336
706 Ga0070679_100307404
707 Ga0070684_100032061
708 Ga0070684_100146065
709 Ga0070684_100169617
710 Ga0070684_100383998
711 Ga0070697_100437581
712 Ga0070672_100387233
713 Ga0070672_100658536
714 Ga0070686_100254780
715 Ga0070686_100294274
716 Ga0070695_100253907
717 Ga0070693_100095402
718 Ga0070693_101197864
719 Ga0070665_100307024
720 Ga0070665_100485148
721 Ga0068855_100097826
722 Ga0070664_100048983
723 Ga0070664_100071920
724 Ga0070664_101474120
725 Ga0068857_100204580
726 Ga0068857_100826305
727 Ga0068857_101034500
728 Ga0068857_102025477
729 Ga0068854_100664084
730 Ga0068854_101722206
731 Ga0068854_102087440
732 Ga0068856_100810785
733 Ga0070702_100664388
734 Ga0070702_100741248
735 Ga0070702_100748709
736 Ga0068859_100023633
737 Ga0068859_100156493
738 Ga0068859_100570242
739 Ga0068859_100959843
740 Ga0068864_100980921
741 Ga0068864_101116893
742 Ga0068864_101535802
743 Ga0068864_102459063
744 Ga0068866_10083727
745 Ga0068866_10989089
746 Ga0068861_100163544
747 Ga0068861_100713835
748 Ga0068861_101892363
749 Ga0068851_10828474
750 Ga0068870_10032339
751 Ga0068870_10125008
752 Ga0068870_10723183
753 Ga0068863_100016720
754 Ga0068863_100377963
755 Ga0068863_100535848
756 Ga0068860_100221465
757 Ga0068860_100941672
758 Ga0068860_101172909
759 Ga0068860_101932223
760 Ga0068862_100056204
761 Ga0068862_100292698
762 Ga0068862_100408690
763 Ga0068862_101028954
764 Ga0081540_1122144
765 Ga0075368_10101141
766 Ga0075363_100049867
767 Ga0075364_10001988
768 Ga0070716_100744804
769 Ga0075362_10001240
770 Ga0075362_10461302
771 Ga0075367_10000983
772 Ga0075367_10165239
773 Ga0075367_10173878
774 Ga0075367_10586734
775 Ga0075369_10154797
776 Ga0075366_10034058
777 Ga0075366_10107277
778 Ga0075366_10280069
779 Ga0075366_10925951
780 Ga0075366_11024038
781 Ga0097621_100031316
782 Ga0097621_100191719
783 Ga0097621_100248958
784 Ga0097621_100599369
785 Ga0075370_10063683
786 Ga0068871_100068745
787 Ga0068871_100612258
788 Ga0075428_100003791
789 Ga0075428_100019775
790 Ga0075428_100066770
791 Ga0075428_100199242
792 Ga0075428_101772172
793 Ga0075430_100547518
794 Ga0075430_100750928
795 Ga0075430_100777659
796 Ga0075430_101513051
797 Ga0075431_100038616
798 Ga0075431_100267052
799 Ga0075431_100380538
800 Ga0075433_10191138
801 Ga0075433_10210624
802 Ga0075433_10291121
803 Ga0075433_10461254
804 Ga0075434_100006968
805 Ga0075434_100213128
806 Ga0075434_100848022
807 Ga0075429_100004555
808 Ga0075429_100693601
809 Ga0075429_100804980
810 Ga0075429_101034558
811 Ga0075429_101447262
812 Ga0068865_100063863
813 Ga0068865_100338236
814 Ga0097620_100023634
815 Ga0097620_100068251
816 Ga0097620_100156501
817 Ga0097620_100570315
818 Ga0097620_100959762
819 Ga0075435_100018556
820 Ga0075435_101060838
821 Ga0105240_10151818
822 Ga0111539_10000249
823 Ga0111539_10008022
824 Ga0111539_10014410
825 Ga0111539_10040445
826 Ga0111539_10049235
827 Ga0111539_10207075
828 Ga0111539_10300403
829 Ga0111539_10749763
830 Ga0111539_11279555
831 Ga0111539_11601479
832 Ga0105245_10151087
833 Ga0105245_13208106
834 Ga0105247_11668372
835 Ga0114129_10000118
836 Ga0114129_10002204
837 Ga0114129_10004307
838 Ga0114129_10011897
839 Ga0114129_10182724
840 Ga0114129_11117302
841 Ga0114129_12975746
842 Ga0105243_10102690
843 Ga0105243_10299464
844 Ga0105243_10642457
845 Ga0105241_11381570
846 Ga0105242_10192966
847 Ga0105242_10684870
848 Ga0105242_11792035
849 Ga0105248_10076496
850 Ga0105248_10108191
851 Ga0105248_10213499
852 Ga0105248_10352618
853 Ga0105248_10570044
854 Ga0105248_10652490
855 Ga0105248_10849157
856 Ga0105248_11105944
857 Ga0105248_13102485
858 Ga0105249_10001474
859 Ga0105249_10353559
860 Ga0105249_11426548
861 Ga0105249_12451849
862 Ga0105249_12488688
863 Ga0105239_12503152
864 Ga0105246_10127628
865 Ga0105246_10343746
866 Ga0105246_10805434
867 Ga0105246_11420306
868 Ga0105246_11438043
869 Ga0157370_10143130
870 Ga0157374_10698218
871 Ga0157378_10135392
872 Ga0157378_12261962
873 Ga0163162_10059441
874 Ga0163162_10775563
875 Ga0157372_10097949
876 Ga0157372_10327213
877 Ga0157375_10439584
878 Ga0157375_10799629
879 Ga0157375_11366040
880 Ga0157375_11466973
881 Ga0157375_12596523
882 Ga0163163_10016096
883 Ga0163163_10198617
884 Ga0163163_10390847
885 Ga0163163_10549763
886 Ga0163163_10841807
887 Ga0163163_12556196
888 Ga0157380_10276013
889 Ga0157380_10476932
890 Ga0157380_11071338
891 Ga0157380_11284634
892 Ga0157380_11459060
893 Ga0157377_10328171
894 Ga0157379_10184702
895 Ga0157379_11575983
896 Ga0157379_11705999
897 Ga0157376_10119776
898 Ga0157376_10172806
899 Ga0157376_10284116
900 Ga0207697_10097591
901 Ga0207697_10320199
902 Ga0207656_10056696
903 Ga0207692_10037262
904 Ga0207642_10328707
905 Ga0207642_10595185
906 Ga0207688_10950577
907 Ga0207680_10463539
908 Ga0207680_10664351
909 Ga0207647_10214800
910 Ga0207645_10096126
911 Ga0207643_10039087
912 Ga0207643_10228547
913 Ga0207705_10558953
914 Ga0207654_11298370
915 Ga0207707_10127288
916 Ga0207707_10763465
917 Ga0207695_10249041
918 Ga0207671_10587345
919 Ga0207662_10006740
920 Ga0207662_10560106
921 Ga0207662_10896962
922 Ga0207662_10984769
923 Ga0207657_10256538
924 Ga0207657_10428167
925 Ga0207649_10220118
926 Ga0207649_10360947
927 Ga0207652_10227080
928 Ga0207646_11226536
929 Ga0207681_10042867
930 Ga0207681_10612069
931 Ga0207681_10969489
932 Ga0207694_10209442
933 Ga0207694_11101342
934 Ga0207650_10122110
935 Ga0207650_11012756
936 Ga0207659_10030851
937 Ga0207659_10249052
938 Ga0207659_10270494
939 Ga0207659_11336990
940 Ga0207687_10151477
941 Ga0207700_10307854
942 Ga0207664_10973175
943 Ga0207644_10326543
944 Ga0207690_10074433
945 Ga0207690_10164949
946 Ga0207690_10870720
947 Ga0207706_10111725
948 Ga0207706_11379270
949 Ga0207706_11471172
950 Ga0207686_10048051
951 Ga0207686_10455232
952 Ga0207709_10361343
953 Ga0207670_10090063
954 Ga0207670_10179842
955 Ga0207670_10851501
956 Ga0207669_10409167
957 Ga0207704_10176098
958 Ga0207704_10948776
959 Ga0207665_10791478
960 Ga0207691_10021451
961 Ga0207711_10496125
962 Ga0207711_10519548
963 Ga0207711_11828874
964 Ga0207689_10020933
965 Ga0207689_10079138
966 Ga0207689_10145295
967 Ga0207661_10010110
968 Ga0207661_10749808
969 Ga0207679_10058146
970 Ga0207679_10155262
971 Ga0207679_10970878
972 Ga0207667_11313284
973 Ga0207667_11726643
974 Ga0207712_10015269
975 Ga0207712_11087113
976 Ga0207668_10026583
977 Ga0207668_10779753
978 Ga0207668_10783341
979 Ga0207668_11939447
980 Ga0207640_10571971
981 Ga0207640_10650665
982 Ga0207640_11313140
983 Ga0207658_10204661
984 Ga0207658_10276328
985 Ga0207677_10311587
986 Ga0207677_10463753
987 Ga0207677_10568393
988 Ga0207677_11497934
989 Ga0207639_11683187
990 Ga0207678_10065634
991 Ga0207678_11029028
992 Ga0207678_11503716
993 Ga0207708_10138160
994 Ga0207641_10016999
995 Ga0207641_10324357
996 Ga0207648_10075154
997 Ga0207648_10314234
998 Ga0207648_11006649
999 Ga0207676_11479023
1000 Ga0207674_10155958
1001 Ga0207674_10157539
1002 Ga0207674_10185941
1003 Ga0207674_10540049
1004 Ga0207675_100076389
1005 Ga0207698_11364163
1006 Ga0207698_12069528
1007 Ga0207428_10003205
1008 Ga0207428_10026092
1009 Ga0207428_10255598
1010 Ga0207428_10318699
1011 Ga0207428_10574359
1012 Ga0207428_10622741
1013 Ga0268266_10283213
1014 Ga0268266_10351517
1015 Ga0268265_10094067
1016 Ga0268265_10273579
1017 Ga0268265_10435173
1018 Ga0268265_12513382
1019 Ga0268264_11109390
1020 Ga0268264_12303459
1021 Ga0307408_100086510
1022 Ga0307408_100138388
1023 Ga0307408_100172207
1024 Ga0307405_10626738
1025 Ga0307405_11667763
1026 Ga0307410_10096296
1027 Ga0307410_12100368
1028 Ga0307406_10069759
1029 Ga0307406_11538499
1030 Ga0307407_10090983
1031 Ga0307412_10012431
1032 Ga0307409_100126266
1033 Ga0307416_100020848
1034 Ga0307414_10893170
1035 Ga0307411_10036571
1036 Ga0307411_10152487
1037 Ga0307415_100071568
1038 Ga0373936_0213087
1039 Ga0373945_0487995
1040 Ga0373943_0034854
1041 Ga0373943_0303069
1042 Ga0373955_0203839
1043 Ga0373935_0938662
1044 Ga0373927_0032133
1045 Ga0373927_0771776
1046 Ga0373937_1362982
1047 Ga0373937_1617886
1048 Ga0373925_0350088
1049 Ga0373925_0463933
1050 Ga0395900_0779560
1051 Ga0436362_1099706
1052 Ga0451802_1198630
1053 Ga0439435_0003509
1054 Ga0439464_0197935
1055 Ga0466961_0522888
1056 Ga0453684_0000019
1057 Ga0495592_0263458
1058 Ga0495629_0672693
1059 Ga0495580_0139012
1060 Ga0495580_0484655
1061 Ga0495582_0124090
1062 Ga0495582_0263765
1063 Ga0495639_0077573
1064 Ga0495662_0200096
1065 Ga0495664_0211602
1066 Ga0495594_0065161
1067 Ga0495594_0282983
1068 Ga0495594_0474716
1069 Ga0495618_0360836
1070 Ga0495628_0091132
1071 Ga0495628_0107932
1072 Ga0495642_0154684
1073 Ga0495665_0592824
1074 Ga0495640_0054871
1075 Ga0495586_0061466
1076 Ga0495645_0048987
1077 Ga0495646_0153311
1078 Ga0495647_0014344
1079 Ga0495658_0493380
1080 Ga0495613_0287243
1081 Ga0495581_0061620
1082 Ga0495581_0177942
1083 Ga0495674_0027211
1084 Ga0495674_0844820
1085 Ga0495675_0142254
1086 Ga0495684_0034338
1087 Ga0495602_0951595
1088 Ga0496101_0121782
1089 Ga0496101_0290702
1090 Ga0496102_0572707
1091 Ga0496102_1265087
1092 Ga0496102_1864707
1093 Ga0496104_0010897
1094 Ga0496104_0292279
1095 Ga0496105_0032818
1096 Ga0496105_0052953
1097 Ga0496108_0123383
1098 Ga0496108_0566185
1099 Ga0496108_0700876
1100 Ga0496108_0893603
1101 Ga0496109_1328125
1102 Ga0496110_0396760
1103 Ga0496110_0558726
1104 Ga0496110_0772681
1105 Ga0496110_1850035
1106 Ga0496112_0129666
1107 Ga0496112_0887570
1108 Ga0496113_0852217
1109 Ga0496114_0047580
1110 Ga0496114_0432653
1111 Ga0496114_1710412
1112 Ga0496115_0028239
1113 Ga0501034_0103006
1114 Ga0501038_0613223
1115 Ga0501039_0112702
1116 Ga0501040_0474786
1117 Ga0501041_0537417
1118 Ga0501041_1084620
1119 Ga0501042_0612045
1120 Ga0501046_0230876
1121 Ga0501047_0336650
1122 Ga0501068_0301721
1123 Ga0501072_0053055
1124 Ga0501072_0588800
1125 Ga0501072_1250031
1126 Ga0501074_0290065
1127 Ga0501074_0758094
1128 Ga0501075_0080477
1129 Ga0501075_0140196
1130 Ga0501075_0661832
1131 Ga0501076_0033387
1132 Ga0501216_095502
1133 Ga0501236_115324
1134 Ga0501221_196813
1135 Ga0501079_0209252
1136 Ga0501080_0266970
1137 Ga0501080_0367352
1138 Ga0501080_0931228
1139 Ga0501081_0091556
1140 Ga0501081_0099607
1141 Ga0501081_0373529
1142 Ga0501081_1215144
1143 Ga0501081_1358382
1144 Ga0501083_0237810
1145 Ga0501035_0231670
1146 Ga0501045_0263333
1147 Ga0501045_0299881
1148 Ga0501045_0941348
1149 Ga0501204_050266
1150 nmdc:mga00v17_389984_c1
1151 nmdc:mga0yw44_217872_c1
1152 nmdc:mga0k408_292205_c1
1153 nmdc:mga0k408_353708_c1
1154 nmdc:mga0k408_57768_c1
1155 nmdc:mga0k408_690009_c1
1156 nmdc:mga0k408_886147_c1
1157 nmdc:mga0k408_935132_c1
1158 nmdc:mga06z11_26977_c1
1159 nmdc:mga05p37_10506_c1
1160 nmdc:mga05p37_36141_c1
1161 nmdc:mga05p37_378277_c1
1162 nmdc:mga05p37_42729_c1
1163 nmdc:mga09592_14594_c1
1164 nmdc:mga09592_56932_c1
1165 nmdc:mga09592_691872_c1
1166 nmdc:mga0qj67_1147236_c1
1167 nmdc:mga0qj67_2382_c1
1168 nmdc:mga0qj67_537628_c1
1169 nmdc:mga0qj67_643301_c1
1170 nmdc:mga06r32_313292_c1
1171 nmdc:mga06r32_44730_c1
1172 nmdc:mga06r32_59170_c1
1173 nmdc:mga08y16_1082037_c1
1174 nmdc:mga08y16_11425_c1
1175 nmdc:mga08y16_270020_c1
1176 nmdc:mga08y16_281611_c1
1177 nmdc:mga08y16_518666_c1
1178 nmdc:mga08y16_540419_c1
1179 nmdc:mga08y16_545801_c1
1180 nmdc:mga08y16_5720_c1
1181 nmdc:mga08y16_908752_c1
1182 nmdc:mga0n895_180489_c1
1183 nmdc:mga0rr50_287740_c1
1184 nmdc:mga0rr50_6454_c1
1185 nmdc:mga0a205_29629_c1
1186 nmdc:mga0a205_590496_c1
1187 Ga0495601_0014222
1188 Ga0495612_0383859
1189 Ga0501084_0171719
1190 Ga0501084_0215685
1191 Ga0501084_0308882
1192 Ga0501084_0438676
1193 Ga0501084_1249808
1194 Ga0590071_002907
1195 Ga0590074_002931
1196 Ga0590075_000344
1197 Ga0590077_000491
1198 Ga0501082_0054832
1199 Ga0501082_0086925
1200 Ga0501082_0228457
1201 Ga0501082_0570714
1202 Ga0530510_0107470
1203 Ga0530510_0492863
1204 Ga0530510_1445058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

44

118

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9304 15 110
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9138 14 113
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.8967 14 114
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8955 14 112
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8919 13 118
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9128 14 115 1.10.10.10
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9042 13 112 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8991 14 113 1.10.10.10
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8948 21 86 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8918 17 98 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9901 14 92
AF-A0A4R1LC83-F1-model_v4 PadR family transcriptional regulator 0.9871 11 114
AF-A0A7W0YC84-F1-model_v4 PadR family transcriptional regulator 0.9845 10 116
AF-A0A7W0YJI2-F1-model_v4 PadR family transcriptional regulator 0.982 20 114
AF-E8V6A6-F1-model_v4 Transcriptional regulator, PadR-like family 0.9819 13 114

Map