F468146

General Info

Members Datasets Scaffolds Average Seq Length
602 290 1204 158

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10033450|Ga0070681_100334508
Length 188
Sequence MGAANGDDRLDILVNRIYSLHQVNAIYIHGSLVMAPQTTDVHVNPSDETIRIGPLVVRFLITGDDASGSVALFELTVPAAQRLAAPAHSHDHYEETVFGMEGVLTWTVDGKPIEVGPGQALCIPRGAVHRFDNSGSQDVKALCAITPAAIGPQFFREAAAVINXXXXGPPDRVKMAEIMRRHGLTPAQ

Samples

Sample ID Description Type Environment
1 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
166 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
167 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
189 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
206 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
219 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
220 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
241 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
242 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
261 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
262 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
265 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
266 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
267 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
268 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
290 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 4.82
Rhizosphere 93.85
Stem 0
Stem Tuber 0
Unclassified 15.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070681_10033450 3300005458 Bacteria 5161
2 MBSR1b_contig_4311323 2162886012 Unclassified 925
3 Ga0065712_10128329 3300005290 Bacteria 1580
4 Ga0065715_10150235 3300005293 Bacteria 1730
5 Ga0065715_10615300 3300005293 Bacteria 699
6 Ga0070658_10013201 3300005327 Bacteria 6626
7 Ga0070658_10177928 3300005327 Bacteria 1789
8 Ga0070658_10330696 3300005327 Bacteria 1302
9 Ga0070658_10496032 3300005327 Bacteria 1054
10 Ga0070658_10587266 3300005327 Unclassified 965
11 Ga0070676_10159816 3300005328 Bacteria 1449
12 Ga0070676_10557994 3300005328 Bacteria 821
13 Ga0070683_100025964 3300005329 Bacteria 5268
14 Ga0070683_100327804 3300005329 Bacteria 1458
15 Ga0070690_100134692 3300005330 Unclassified 1672
16 Ga0070670_100099863 3300005331 Bacteria 2498
17 Ga0070677_10111752 3300005333 Bacteria 1221
18 Ga0070677_10374881 3300005333 Unclassified 743
19 Ga0070666_10166686 3300005335 Unclassified 1541
20 Ga0070666_10190177 3300005335 Bacteria 1442
21 Ga0070680_100003177 3300005336 Bacteria 12213
22 Ga0070680_100124512 3300005336 Bacteria 2153
23 Ga0070680_100199163 3300005336 Bacteria 1688
24 Ga0070680_100228706 3300005336 Bacteria 1570
25 Ga0070680_101212128 3300005336 Bacteria 653
26 Ga0070682_100237275 3300005337 Bacteria 1307
27 Ga0068868_100013018 3300005338 Bacteria 6088
28 Ga0068868_100181287 3300005338 Unclassified 1747
29 Ga0068868_100312838 3300005338 Bacteria 1336
30 Ga0068868_100602952 3300005338 Bacteria 973
31 Ga0070660_100061095 3300005339 Bacteria 2925
32 Ga0070660_100235911 3300005339 Bacteria 1489
33 Ga0070660_100562011 3300005339 Bacteria 952
34 Ga0070689_100212915 3300005340 Unclassified 1582
35 Ga0070689_101310690 3300005340 Unclassified 652
36 Ga0070691_10388099 3300005341 Bacteria 784
37 Ga0070691_10460529 3300005341 Bacteria 728
38 Ga0070687_100040681 3300005343 Bacteria 2344
39 Ga0070661_100099406 3300005344 Bacteria 2162
40 Ga0070661_100186334 3300005344 Bacteria 1581
41 Ga0070661_100359523 3300005344 Bacteria 1144
42 Ga0070669_100021184 3300005353 Unclassified 4646
43 Ga0070675_100064828 3300005354 Bacteria 3020
44 Ga0070675_100098498 3300005354 Bacteria 2460
45 Ga0070671_100222112 3300005355 Bacteria 1602
46 Ga0070671_100368985 3300005355 Bacteria 1226
47 Ga0070674_100000514 3300005356 Bacteria 19393
48 Ga0070674_100003466 3300005356 Bacteria 8860
49 Ga0070674_100143667 3300005356 Bacteria 1794
50 Ga0070674_100753412 3300005356 Bacteria 837
51 Ga0070673_101304549 3300005364 Unclassified 682
52 Ga0070688_100239531 3300005365 Unclassified 1287
53 Ga0070659_100357755 3300005366 Bacteria 1226
54 Ga0070659_100550612 3300005366 Bacteria 987
55 Ga0070667_100043236 3300005367 Bacteria 3781
56 Ga0070667_100050740 3300005367 Bacteria 3497
57 Ga0070667_100141459 3300005367 Bacteria 2107
58 Ga0070667_100203017 3300005367 Bacteria 1759
59 Ga0070714_100301944 3300005435 Unclassified 1493
60 Ga0070711_100258915 3300005439 Bacteria 1368
61 Ga0070711_101520218 3300005439 Bacteria 584
62 Ga0070708_100461482 3300005445 Bacteria 1198
63 Ga0070663_100138271 3300005455 Bacteria 1857
64 Ga0070678_100080768 3300005456 Bacteria 2463
65 Ga0070678_100943133 3300005456 Bacteria 791
66 Ga0070662_100105522 3300005457 Bacteria 2139
67 Ga0070681_10011291 3300005458 Bacteria 8836
68 Ga0070681_10038302 3300005458 Unclassified 4807
69 Ga0070681_10251323 3300005458 Bacteria 1680
70 Ga0068867_100123717 3300005459 Bacteria 2002
71 Ga0068867_100335717 3300005459 Bacteria 1257
72 Ga0068867_100411952 3300005459 Bacteria 1142
73 Ga0068867_100550768 3300005459 Bacteria 999
74 Ga0070706_100240724 3300005467 Bacteria 1690
75 Ga0070706_100279557 3300005467 Bacteria 1558
76 Ga0070707_100315210 3300005468 Bacteria 1520
77 Ga0070699_100956284 3300005518 Bacteria 785
78 Ga0070679_100010031 3300005530 Bacteria 8971
79 Ga0070679_100084099 3300005530 Bacteria 3170
80 Ga0070679_100130783 3300005530 Bacteria 2491
81 Ga0070684_100354388 3300005535 Bacteria 1350
82 Ga0070684_100727309 3300005535 Bacteria 926
83 Ga0070684_100826068 3300005535 Bacteria 867
84 Ga0070684_100907749 3300005535 Bacteria 825
85 Ga0070697_100475620 3300005536 Bacteria 1091
86 Ga0068853_100454874 3300005539 Bacteria 1204
87 Ga0070672_100043257 3300005543 Bacteria 3472
88 Ga0070672_100104052 3300005543 Bacteria 2306
89 Ga0070672_100261162 3300005543 Bacteria 1460
90 Ga0070672_100693155 3300005543 Bacteria 892
91 Ga0070686_100136782 3300005544 Bacteria 1701
92 Ga0070686_100672034 3300005544 Bacteria 823
93 Ga0070695_101092688 3300005545 Bacteria 652
94 Ga0070696_100406723 3300005546 Bacteria 1066
95 Ga0070665_100022809 3300005548 Bacteria 6302
96 Ga0070665_100149319 3300005548 Bacteria 2340
97 Ga0070665_100436315 3300005548 Bacteria 1319
98 Ga0070665_101092878 3300005548 Bacteria 809
99 Ga0068855_100044266 3300005563 Bacteria 5268
100 Ga0068855_100102070 3300005563 Bacteria 3301
101 Ga0068855_100148837 3300005563 Bacteria 2663
102 Ga0068855_100474647 3300005563 Bacteria 1362
103 Ga0068855_100489984 3300005563 Unclassified 1337
104 Ga0068855_100515011 3300005563 Bacteria 1298
105 Ga0068855_100796675 3300005563 Bacteria 1005
106 Ga0068855_100800477 3300005563 Bacteria 1002
107 Ga0068855_101467874 3300005563 Bacteria 701
108 Ga0070664_100034878 3300005564 Bacteria 4222
109 Ga0070664_100261087 3300005564 Bacteria 1558
110 Ga0070664_100602378 3300005564 Bacteria 1019
111 Ga0070664_101025743 3300005564 Unclassified 776
112 Ga0068857_100115729 3300005577 Bacteria 2412
113 Ga0068857_100295305 3300005577 Bacteria 1493
114 Ga0068857_100682838 3300005577 Bacteria 975
115 Ga0068856_100043239 3300005614 Bacteria 4433
116 Ga0068856_100129426 3300005614 Bacteria 2529
117 Ga0068856_100767889 3300005614 Bacteria 984
118 Ga0068856_101430088 3300005614 Unclassified 706
119 Ga0070702_100168199 3300005615 Unclassified 1423
120 Ga0068852_100465675 3300005616 Unclassified 1254
121 Ga0068852_101738862 3300005616 Unclassified 646
122 Ga0068859_100097206 3300005617 Bacteria 2998
123 Ga0068859_100158662 3300005617 Bacteria 2341
124 Ga0068864_100820464 3300005618 Bacteria 915
125 Ga0068866_10040555 3300005718 Bacteria 2305
126 Ga0068851_10326423 3300005834 Unclassified 888
127 Ga0068870_10453490 3300005840 Bacteria 846
128 Ga0068863_101223266 3300005841 Bacteria 757
129 Ga0068863_101420041 3300005841 Bacteria 702
130 Ga0068858_100218396 3300005842 Unclassified 1805
131 Ga0068858_100267349 3300005842 Bacteria 1626
132 Ga0068858_100354272 3300005842 Bacteria 1406
133 Ga0068858_100426985 3300005842 Bacteria 1275
134 Ga0068858_101034721 3300005842 Bacteria 805
135 Ga0068860_100031450 3300005843 Bacteria 5103
136 Ga0068860_100234346 3300005843 Bacteria 1784
137 Ga0068860_100352333 3300005843 Unclassified 1449
138 Ga0068862_100094264 3300005844 Bacteria 2611
139 Ga0075365_10008126 3300006038 Bacteria 5928
140 Ga0075363_100165517 3300006048 Bacteria 1254
141 Ga0075364_10014717 3300006051 Bacteria 4838
142 Ga0070712_100552912 3300006175 Bacteria 970
143 Ga0097621_100049342 3300006237 Bacteria 3419
144 Ga0097621_100072157 3300006237 Bacteria 2855
145 Ga0097621_100555612 3300006237 Bacteria 1045
146 Ga0097621_100681875 3300006237 Bacteria 945
147 Ga0097621_101005574 3300006237 Bacteria 780
148 Ga0097621_101147734 3300006237 Bacteria 731
149 Ga0075370_10032639 3300006353 Bacteria 2912
150 Ga0068871_100157609 3300006358 Unclassified 1940
151 Ga0068871_100532187 3300006358 Unclassified 1062
152 Ga0068871_100903319 3300006358 Bacteria 819
153 Ga0075428_100001438 3300006844 Bacteria 25432
154 Ga0075428_100003801 3300006844 Bacteria 16555
155 Ga0075428_100009870 3300006844 Bacteria 10610
156 Ga0075430_100004373 3300006846 Bacteria 11927
157 Ga0075430_100004916 3300006846 Bacteria 11241
158 Ga0075431_100014728 3300006847 Bacteria 7915
159 Ga0075431_100142609 3300006847 Bacteria 2470
160 Ga0075433_10022412 3300006852 Bacteria 5301
161 Ga0075434_100001624 3300006871 Bacteria 19118
162 Ga0075434_100172234 3300006871 Bacteria 2185
163 Ga0075434_100190547 3300006871 Unclassified 2071
164 Ga0075434_101209053 3300006871 Bacteria 768
165 Ga0075429_100006454 3300006880 Bacteria 10156
166 Ga0075429_100162175 3300006880 Bacteria 1958
167 Ga0068865_100056721 3300006881 Bacteria 2730
168 Ga0068865_100187196 3300006881 Bacteria 1598
169 Ga0068865_100273584 3300006881 Bacteria 1342
170 Ga0068865_100418115 3300006881 Unclassified 1102
171 Ga0075436_100005768 3300006914 Bacteria 8512
172 Ga0075436_100304472 3300006914 Bacteria 1143
173 Ga0097620_100097206 3300006931 Bacteria 2998
174 Ga0097620_100158656 3300006931 Bacteria 2341
175 Ga0075435_101161926 3300007076 Bacteria 675
176 Ga0105251_10417784 3300009011 Bacteria 618
177 Ga0105240_10016206 3300009093 Bacteria 10101
178 Ga0105240_10044733 3300009093 Bacteria 5622
179 Ga0105240_10085178 3300009093 Bacteria 3873
180 Ga0105240_10121764 3300009093 Bacteria 3141
181 Ga0105240_10380802 3300009093 Bacteria 1593
182 Ga0105240_10806481 3300009093 Bacteria 1016
183 Ga0111539_10005424 3300009094 Bacteria 16502
184 Ga0111539_10145490 3300009094 Bacteria 2775
185 Ga0111539_10173391 3300009094 Bacteria 2520
186 Ga0111539_10441194 3300009094 Bacteria 1516
187 Ga0105245_10057139 3300009098 Bacteria 3509
188 Ga0105245_10149017 3300009098 Bacteria 2210
189 Ga0105245_10200038 3300009098 Bacteria 1918
190 Ga0105245_10266503 3300009098 Bacteria 1669
191 Ga0105245_10358280 3300009098 Bacteria 1447
192 Ga0105245_10359286 3300009098 Unclassified 1445
193 Ga0105247_10048781 3300009101 Bacteria 2601
194 Ga0105247_10200372 3300009101 Bacteria 1341
195 Ga0114129_10024687 3300009147 Bacteria 8520
196 Ga0114129_11406850 3300009147 Bacteria 860
197 Ga0105243_10250331 3300009148 Unclassified 1581
198 Ga0105241_10337158 3300009174 Bacteria 1305
199 Ga0105241_10680841 3300009174 Unclassified 937
200 Ga0105241_11662756 3300009174 Bacteria 619
201 Ga0105242_10257036 3300009176 Bacteria 1576
202 Ga0105242_10304046 3300009176 Bacteria 1457
203 Ga0105242_10362476 3300009176 Bacteria 1342
204 Ga0105248_10120967 3300009177 Bacteria 2953
205 Ga0105248_10134199 3300009177 Bacteria 2793
206 Ga0105248_10261926 3300009177 Bacteria 1946
207 Ga0105248_10275529 3300009177 Bacteria 1894
208 Ga0105248_10292362 3300009177 Bacteria 1835
209 Ga0105248_10558347 3300009177 Unclassified 1292
210 Ga0105248_10843005 3300009177 Bacteria 1035
211 Ga0105248_11023241 3300009177 Bacteria 933
212 Ga0105237_10537770 3300009545 Bacteria 1175
213 Ga0105238_10052907 3300009551 Bacteria 4081
214 Ga0105238_10112687 3300009551 Bacteria 2700
215 Ga0105238_10135284 3300009551 Unclassified 2442
216 Ga0105238_12013507 3300009551 Unclassified 611
217 Ga0105249_10685446 3300009553 Bacteria 1084
218 Ga0105249_10693688 3300009553 Bacteria 1078
219 Ga0105239_10099908 3300010375 Bacteria 3208
220 Ga0105239_10276594 3300010375 Bacteria 1889
221 Ga0105239_11674568 3300010375 Bacteria 736
222 Ga0105239_11839200 3300010375 Bacteria 702
223 Ga0105246_10087320 3300011119 Bacteria 2238
224 Ga0105246_10386963 3300011119 Bacteria 1157
225 Ga0105246_10474056 3300011119 Bacteria 1057
226 Ga0157373_10468000 3300013100 Bacteria 908
227 Ga0157371_10447537 3300013102 Unclassified 949
228 Ga0157370_10002290 3300013104 Bacteria 23204
229 Ga0157370_10012502 3300013104 Bacteria 8799
230 Ga0157370_10053425 3300013104 Bacteria 3852
231 Ga0157370_11034172 3300013104 Bacteria 743
232 Ga0157370_11251226 3300013104 Bacteria 669
233 Ga0157369_10022081 3300013105 Bacteria 7111
234 Ga0157369_10063957 3300013105 Bacteria 3963
235 Ga0157369_10298935 3300013105 Bacteria 1675
236 Ga0157374_10016443 3300013296 Bacteria 6504
237 Ga0157374_10406179 3300013296 Bacteria 1359
238 Ga0157374_10477947 3300013296 Bacteria 1249
239 Ga0157378_10337357 3300013297 Bacteria 1469
240 Ga0157378_10407083 3300013297 Bacteria 1342
241 Ga0157378_10605381 3300013297 Bacteria 1107
242 Ga0157378_11019830 3300013297 Unclassified 862
243 Ga0157378_11410580 3300013297 Unclassified 740
244 Ga0163162_10023037 3300013306 Bacteria 6142
245 Ga0163162_10056528 3300013306 Bacteria 3952
246 Ga0163162_10333311 3300013306 Bacteria 1650
247 Ga0163162_11788820 3300013306 Bacteria 702
248 Ga0157372_10008164 3300013307 Bacteria 11127
249 Ga0157372_10093145 3300013307 Bacteria 3428
250 Ga0157372_10138581 3300013307 Bacteria 2802
251 Ga0157372_10289350 3300013307 Bacteria 1905
252 Ga0157372_10346873 3300013307 Bacteria 1730
253 Ga0157372_10388266 3300013307 Bacteria 1627
254 Ga0157372_12540615 3300013307 Bacteria 588
255 Ga0157375_10038762 3300013308 Bacteria 4578
256 Ga0157375_10267179 3300013308 Unclassified 1872
257 Ga0157375_10516294 3300013308 Bacteria 1358
258 Ga0157375_10670336 3300013308 Bacteria 1192
259 Ga0157375_11374223 3300013308 Bacteria 831
260 Ga0163163_10467152 3300014325 Bacteria 1322
261 Ga0163163_10578781 3300014325 Bacteria 1186
262 Ga0163163_10796941 3300014325 Bacteria 1008
263 Ga0157380_10027742 3300014326 Bacteria 4309
264 Ga0157380_10171365 3300014326 Bacteria 1897
265 Ga0157380_10227106 3300014326 Bacteria 1674
266 Ga0157380_10738772 3300014326 Bacteria 994
267 Ga0157380_11015145 3300014326 Bacteria 864
268 Ga0182008_10048654 3300014497 Bacteria 2106
269 Ga0157377_10152885 3300014745 Bacteria 1428
270 Ga0157377_10675829 3300014745 Bacteria 746
271 Ga0157379_10107315 3300014968 Bacteria 2507
272 Ga0157379_10113140 3300014968 Bacteria 2439
273 Ga0157379_10238276 3300014968 Bacteria 1650
274 Ga0157379_10642809 3300014968 Unclassified 993
275 Ga0157379_11500999 3300014968 Bacteria 656
276 Ga0157376_10059684 3300014969 Bacteria 3199
277 Ga0157376_10150833 3300014969 Bacteria 2096
278 Ga0157376_10252598 3300014969 Bacteria 1648
279 Ga0157376_10301699 3300014969 Unclassified 1516
280 Ga0157376_10643442 3300014969 Bacteria 1060
281 Ga0157376_10675454 3300014969 Bacteria 1036
282 Ga0157376_10933944 3300014969 Bacteria 887
283 Ga0163161_10048691 3300017792 Bacteria 3061
284 Ga0207697_10089698 3300025315 Bacteria 1302
285 Ga0207682_10172435 3300025893 Bacteria 985
286 Ga0207682_10190128 3300025893 Unclassified 941
287 Ga0207682_10191189 3300025893 Bacteria 938
288 Ga0207642_10418801 3300025899 Bacteria 805
289 Ga0207680_10155814 3300025903 Bacteria 1527
290 Ga0207647_10050299 3300025904 Bacteria 2581
291 Ga0207647_10051231 3300025904 Bacteria 2552
292 Ga0207645_10098230 3300025907 Bacteria 1888
293 Ga0207645_10483748 3300025907 Bacteria 837
294 Ga0207705_10297277 3300025909 Bacteria 1238
295 Ga0207705_10970112 3300025909 Bacteria 657
296 Ga0207684_10298989 3300025910 Bacteria 1388
297 Ga0207654_11134597 3300025911 Bacteria 570
298 Ga0207707_10105914 3300025912 Bacteria 2458
299 Ga0207707_10108504 3300025912 Unclassified 2426
300 Ga0207707_10164042 3300025912 Unclassified 1942
301 Ga0207707_10210802 3300025912 Unclassified 1692
302 Ga0207707_10244274 3300025912 Bacteria 1560
303 Ga0207707_10308455 3300025912 Bacteria 1368
304 Ga0207707_10660472 3300025912 Unclassified 880
305 Ga0207695_10018908 3300025913 Bacteria 7948
306 Ga0207695_10220098 3300025913 Bacteria 1806
307 Ga0207695_10384436 3300025913 Bacteria 1289
308 Ga0207671_10177378 3300025914 Bacteria 1657
309 Ga0207660_10050583 3300025917 Bacteria 2951
310 Ga0207660_10168480 3300025917 Unclassified 1694
311 Ga0207660_10868570 3300025917 Bacteria 736
312 Ga0207662_10069720 3300025918 Bacteria 2125
313 Ga0207657_10016418 3300025919 Bacteria 7142
314 Ga0207657_10032446 3300025919 Bacteria 4718
315 Ga0207657_10105159 3300025919 Bacteria 2337
316 Ga0207657_10143035 3300025919 Bacteria 1953
317 Ga0207657_10187059 3300025919 Bacteria 1672
318 Ga0207657_10224965 3300025919 Bacteria 1502
319 Ga0207649_10054563 3300025920 Bacteria 2488
320 Ga0207649_10080320 3300025920 Bacteria 2109
321 Ga0207649_10385441 3300025920 Bacteria 1045
322 Ga0207649_11244094 3300025920 Bacteria 589
323 Ga0207649_11603313 3300025920 Bacteria 515
324 Ga0207652_10025013 3300025921 Bacteria 4959
325 Ga0207652_10234319 3300025921 Bacteria 1654
326 Ga0207652_10244865 3300025921 Bacteria 1616
327 Ga0207646_10728002 3300025922 Bacteria 886
328 Ga0207681_10010028 3300025923 Bacteria 5799
329 Ga0207694_10067860 3300025924 Bacteria 2784
330 Ga0207694_10180210 3300025924 Bacteria 1713
331 Ga0207694_10228398 3300025924 Bacteria 1519
332 Ga0207650_10100491 3300025925 Bacteria 2226
333 Ga0207650_10477100 3300025925 Bacteria 1040
334 Ga0207687_10084273 3300025927 Bacteria 2303
335 Ga0207687_10145611 3300025927 Bacteria 1802
336 Ga0207687_10248010 3300025927 Bacteria 1414
337 Ga0207687_10257658 3300025927 Bacteria 1389
338 Ga0207687_10429604 3300025927 Unclassified 1092
339 Ga0207687_10433563 3300025927 Bacteria 1087
340 Ga0207664_10043173 3300025929 Bacteria 3525
341 Ga0207664_10574815 3300025929 Bacteria 1012
342 Ga0207644_10210323 3300025931 Bacteria 1538
343 Ga0207644_10416175 3300025931 Unclassified 1100
344 Ga0207644_10662945 3300025931 Bacteria 869
345 Ga0207644_10954813 3300025931 Bacteria 719
346 Ga0207690_10130351 3300025932 Bacteria 1839
347 Ga0207690_10480779 3300025932 Bacteria 1002
348 Ga0207706_10091216 3300025933 Bacteria 2679
349 Ga0207706_11209977 3300025933 Bacteria 627
350 Ga0207686_10142162 3300025934 Bacteria 1660
351 Ga0207686_10149775 3300025934 Bacteria 1623
352 Ga0207670_10504532 3300025936 Unclassified 983
353 Ga0207669_10004397 3300025937 Bacteria 6198
354 Ga0207669_10011101 3300025937 Bacteria 4369
355 Ga0207669_10262346 3300025937 Bacteria 1293
356 Ga0207704_10712311 3300025938 Bacteria 832
357 Ga0207704_10717104 3300025938 Unclassified 829
358 Ga0207704_11958491 3300025938 Unclassified 504
359 Ga0207691_10053932 3300025940 Bacteria 3669
360 Ga0207691_10279225 3300025940 Unclassified 1437
361 Ga0207691_10322941 3300025940 Bacteria 1323
362 Ga0207711_10063742 3300025941 Bacteria 3182
363 Ga0207711_10072442 3300025941 Bacteria 2993
364 Ga0207711_10111147 3300025941 Bacteria 2437
365 Ga0207711_10471911 3300025941 Bacteria 1169
366 Ga0207711_11090207 3300025941 Bacteria 739
367 Ga0207711_11405655 3300025941 Unclassified 640
368 Ga0207689_10148658 3300025942 Bacteria 1931
369 Ga0207689_10893319 3300025942 Bacteria 750
370 Ga0207661_10012492 3300025944 Bacteria 6171
371 Ga0207661_10253033 3300025944 Bacteria 1567
372 Ga0207661_11640607 3300025944 Bacteria 588
373 Ga0207679_10222608 3300025945 Bacteria 1588
374 Ga0207679_10565898 3300025945 Unclassified 1021
375 Ga0207667_10017187 3300025949 Bacteria 8153
376 Ga0207667_10099947 3300025949 Bacteria 2993
377 Ga0207667_10157307 3300025949 Bacteria 2338
378 Ga0207667_10791480 3300025949 Bacteria 946
379 Ga0207667_11277576 3300025949 Unclassified 711
380 Ga0207667_11367616 3300025949 Bacteria 682
381 Ga0207651_10104874 3300025960 Bacteria 2107
382 Ga0207651_11798364 3300025960 Bacteria 551
383 Ga0207712_10416024 3300025961 Bacteria 1133
384 Ga0207640_10165669 3300025981 Bacteria 1641
385 Ga0207658_10035056 3300025986 Bacteria 3592
386 Ga0207658_10131514 3300025986 Bacteria 2011
387 Ga0207658_10177795 3300025986 Bacteria 1759
388 Ga0207658_10475723 3300025986 Unclassified 1109
389 Ga0207658_11284322 3300025986 Unclassified 669
390 Ga0207677_10003235 3300026023 Bacteria 8604
391 Ga0207677_10119623 3300026023 Unclassified 1978
392 Ga0207677_11198665 3300026023 Bacteria 695
393 Ga0207677_11658928 3300026023 Bacteria 592
394 Ga0207703_10007019 3300026035 Bacteria 8960
395 Ga0207703_11182490 3300026035 Bacteria 735
396 Ga0207678_10019064 3300026067 Bacteria 6024
397 Ga0207678_10185130 3300026067 Bacteria 1778
398 Ga0207702_10105173 3300026078 Bacteria 2499
399 Ga0207702_10111574 3300026078 Bacteria 2432
400 Ga0207702_10277279 3300026078 Bacteria 1584
401 Ga0207702_12452862 3300026078 Unclassified 508
402 Ga0207641_10002331 3300026088 Bacteria 17616
403 Ga0207641_10370216 3300026088 Bacteria 1370
404 Ga0207648_10109953 3300026089 Bacteria 2419
405 Ga0207648_10312537 3300026089 Bacteria 1411
406 Ga0207648_10347989 3300026089 Bacteria 1335
407 Ga0207648_10490794 3300026089 Bacteria 1123
408 Ga0207648_10512326 3300026089 Bacteria 1099
409 Ga0207648_11160300 3300026089 Unclassified 725
410 Ga0207674_10097431 3300026116 Bacteria 2925
411 Ga0207674_10233545 3300026116 Bacteria 1787
412 Ga0207674_10920868 3300026116 Bacteria 842
413 Ga0207683_10002192 3300026121 Bacteria 17170
414 Ga0207683_10108450 3300026121 Bacteria 2485
415 Ga0207683_10362823 3300026121 Unclassified 1330
416 Ga0207698_11508719 3300026142 Bacteria 687
417 Ga0207428_10021904 3300027907 Bacteria 5403
418 Ga0207428_10518508 3300027907 Bacteria 864
419 Ga0268266_10005093 3300028379 Bacteria 12388
420 Ga0268266_10006491 3300028379 Bacteria 10706
421 Ga0268266_10234107 3300028379 Bacteria 1693
422 Ga0268264_10141538 3300028381 Bacteria 2146
423 Ga0268264_10281851 3300028381 Bacteria 1557
424 Ga0265336_10022999 3300028666 Bacteria 1981
425 Ga0265330_10000229 3300031235 Bacteria 42883
426 Ga0265332_10027342 3300031238 Bacteria 2499
427 Ga0265328_10014696 3300031239 Unclassified 3078
428 Ga0265320_10050567 3300031240 Bacteria 2019
429 Ga0265325_10000037 3300031241 Bacteria 93463
430 Ga0265340_10026830 3300031247 Bacteria 2909
431 Ga0265339_10020292 3300031249 Unclassified 3884
432 Ga0265339_10070595 3300031249 Bacteria 1862
433 Ga0265316_10001378 3300031344 Bacteria 26195
434 Ga0307408_100017353 3300031548 Bacteria 4816
435 Ga0307408_100096690 3300031548 Bacteria 2241
436 Ga0265313_10003220 3300031595 Bacteria 13423
437 Ga0265314_10000098 3300031711 Bacteria 133427
438 Ga0265342_10005455 3300031712 Bacteria 9684
439 Ga0307405_10105078 3300031731 Bacteria 1901
440 Ga0307405_11015928 3300031731 Unclassified 708
441 Ga0307413_11225810 3300031824 Unclassified 653
442 Ga0307410_10125020 3300031852 Bacteria 1881
443 Ga0307406_10561860 3300031901 Bacteria 935
444 Ga0307406_11075370 3300031901 Bacteria 693
445 Ga0307412_10170435 3300031911 Unclassified 1627
446 Ga0307409_100248149 3300031995 Bacteria 1625
447 Ga0307416_100107104 3300032002 Bacteria 2452
448 Ga0307414_10369057 3300032004 Bacteria 1237
449 Ga0307411_10488694 3300032005 Unclassified 1038
450 Ga0307411_10529514 3300032005 Unclassified 1002
451 Ga0307415_100211202 3300032126 Bacteria 1548
452 Ga0316583_10000017 3300032133 Bacteria 32029
453 Ga0316583_10216196 3300032133 Unclassified 665
454 Ga0373923_0542085 3300035111 Bacteria 570
455 Ga0373943_0711411 3300035170 Bacteria 595
456 Ga0373946_0028815 3300035171 Bacteria 2205
457 Ga0373924_0093040 3300035410 Unclassified 1291
458 Ga0373931_0140064 3300035691 Bacteria 1400
459 Ga0373931_0266228 3300035691 Bacteria 1048
460 Ga0373935_0091973 3300035692 Bacteria 1987
461 Ga0373935_0653646 3300035692 Unclassified 771
462 Ga0373935_0805352 3300035692 Bacteria 694
463 Ga0373927_0002899 3300035695 Bacteria 12471
464 Ga0373927_0349648 3300035695 Bacteria 974
465 Ga0373933_0191599 3300035724 Unclassified 1306
466 Ga0373947_0000488 3300035725 Bacteria 22824
467 Ga0373937_0019487 3300036401 Bacteria 6072
468 Ga0373925_0001046 3300037068 Bacteria 25096
469 Ga0373925_0078628 3300037068 Bacteria 2505
470 Ga0373925_0231313 3300037068 Bacteria 1478
471 Ga0395898_1774011 3300037466 Bacteria 539
472 Ga0395905_0902157 3300037471 Bacteria 787
473 Ga0439444_0066937 3300042437 Bacteria 761
474 Ga0451577_0043579 3300042876 Bacteria 4019
475 Ga0453683_0033065 3300044673 Bacteria 3262
476 Ga0466966_0648761 3300044684 Bacteria 636
477 Ga0453684_0134432 3300044712 Bacteria 2963
478 Ga0451576_0017206 3300045051 Bacteria 7952
479 Ga0451576_0993538 3300045051 Bacteria 880
480 Ga0495580_0378526 3300046472 Unclassified 956
481 Ga0495582_0158463 3300046473 Unclassified 1287
482 Ga0495639_0210111 3300046475 Bacteria 955
483 Ga0495639_0391264 3300046475 Unclassified 701
484 Ga0495594_0039794 3300046499 Bacteria 2571
485 Ga0495630_0167897 3300046517 Bacteria 1671
486 Ga0495630_0461569 3300046517 Bacteria 973
487 Ga0495640_0094024 3300046533 Bacteria 1975
488 Ga0495587_0109579 3300046536 Bacteria 1587
489 Ga0495634_0459457 3300046642 Bacteria 750
490 Ga0495659_0487139 3300046664 Bacteria 539
491 Ga0495588_0005354 3300046674 Bacteria 5705
492 Ga0495646_0646302 3300046680 Bacteria 535
493 Ga0495647_0004918 3300046681 Bacteria 4373
494 Ga0495647_0138603 3300046681 Bacteria 1036
495 Ga0495658_0042149 3300046683 Bacteria 2547
496 Ga0495658_0239615 3300046683 Bacteria 1139
497 Ga0495658_0611351 3300046683 Bacteria 698
498 Ga0495669_0348046 3300046684 Unclassified 716
499 Ga0495613_0153982 3300046689 Bacteria 1638
500 Ga0495670_0121519 3300046691 Bacteria 1357
501 Ga0495581_0599261 3300047315 Bacteria 638
502 Ga0495604_0696221 3300047317 Bacteria 645
503 Ga0495674_0589084 3300047319 Unclassified 882
504 Ga0495676_0448596 3300047321 Bacteria 851
505 Ga0495602_0179088 3300048088 Bacteria 1637
506 Ga0496100_0390143 3300048903 Bacteria 1059
507 Ga0496101_0337020 3300048904 Bacteria 1184
508 Ga0496101_0731782 3300048904 Bacteria 781
509 Ga0496101_0932603 3300048904 Bacteria 683
510 Ga0496101_1324940 3300048904 Unclassified 563
511 Ga0496104_0000182 3300048907 Bacteria 56117
512 Ga0496104_0029652 3300048907 Bacteria 5076
513 Ga0496104_0120067 3300048907 Bacteria 2524
514 Ga0496105_0016358 3300048908 Bacteria 5921
515 Ga0496105_0638887 3300048908 Bacteria 822
516 Ga0496105_1095920 3300048908 Unclassified 591
517 Ga0496106_0268118 3300048909 Bacteria 1367
518 Ga0496107_1112708 3300048910 Unclassified 570
519 Ga0496108_0001152 3300048911 Bacteria 20646
520 Ga0496108_0897119 3300048911 Bacteria 761
521 Ga0496109_0002055 3300048912 Bacteria 16695
522 Ga0496109_0138088 3300048912 Bacteria 2279
523 Ga0496109_0240080 3300048912 Unclassified 1705
524 Ga0496109_0762181 3300048912 Unclassified 906
525 Ga0496110_0261719 3300048913 Bacteria 1574
526 Ga0496111_0012429 3300048914 Bacteria 5764
527 Ga0496112_0013651 3300048915 Bacteria 7506
528 Ga0496112_0352621 3300048915 Bacteria 1414
529 Ga0496112_0928582 3300048915 Bacteria 792
530 Ga0496113_0020005 3300048916 Bacteria 4696
531 Ga0496113_0587583 3300048916 Bacteria 892
532 Ga0496114_0197286 3300048917 Bacteria 1762
533 Ga0496114_0913117 3300048917 Bacteria 760
534 Ga0496114_1479915 3300048917 Bacteria 567
535 Ga0496125_0154594 3300048928 Bacteria 1569
536 Ga0501291_014901 3300049514 Unclassified 1169
537 Ga0501299_069905 3300049522 Bacteria 760
538 Ga0501031_0093318 3300049568 Unclassified 1964
539 Ga0501032_0014675 3300049569 Bacteria 5547
540 Ga0501033_0401092 3300049570 Unclassified 956
541 Ga0501034_0017367 3300049571 Bacteria 7379
542 Ga0501034_0642102 3300049571 Bacteria 964
543 Ga0501036_0072976 3300049572 Plasmid 2901
544 Ga0501037_0011596 3300049573 Bacteria 6489
545 Ga0501038_0011655 3300049574 Bacteria 8018
546 Ga0501039_0624266 3300049575 Bacteria 844
547 Ga0501041_0779624 3300049577 Bacteria 613
548 Ga0501042_0111831 3300049578 Unclassified 1967
549 Ga0501043_0020706 3300049579 Bacteria 5159
550 Ga0501046_0007804 3300049580 Bacteria 9389
551 Ga0501047_0183756 3300049581 Unclassified 1956
552 Ga0501048_0012945 3300049582 Bacteria 6198
553 Ga0501067_0010113 3300049583 Bacteria 5219
554 Ga0501068_0033538 3300049584 Plasmid 3057
555 Ga0501069_0035561 3300049585 Plasmid 2745
556 Ga0501070_0018121 3300049586 Bacteria 5906
557 Ga0501072_0008674 3300049588 Bacteria 7718
558 Ga0501073_0066015 3300049589 Plasmid 2522
559 Ga0501073_0068554 3300049589 Bacteria 2472
560 Ga0501074_0057267 3300049590 Plasmid 2807
561 Ga0501077_0006001 3300049593 Bacteria 7422
562 Ga0501208_037309 3300049655 Bacteria 886
563 Ga0501217_020812 3300049661 Bacteria 1544
564 Ga0501251_079637 3300049681 Unclassified 573
565 Ga0501258_042538 3300049687 Bacteria 611
566 Ga0501225_0148060 3300049705 Unclassified 714
567 Ga0501079_0007099 3300049741 Bacteria 8450
568 Ga0501083_0048307 3300049744 Unclassified 2872
569 Ga0501044_0298772 3300049823 Unclassified 1539
570 nmdc:mga0yw44_52371_c1 3300050492 Bacteria 2474
571 nmdc:mga05p37_44301_c1 3300050507 Bacteria 5474
572 nmdc:mga05p37_8663_c1 3300050507 Bacteria 12023
573 nmdc:mga09592_13909_c1 3300050508 Bacteria 6575
574 nmdc:mga09592_2423_c1 3300050508 Bacteria 15039
575 nmdc:mga09592_939586_c1 3300050508 Bacteria 725
576 nmdc:mga0qj67_541841_c1 3300050509 Unclassified 934
577 nmdc:mga0qj67_697445_c1 3300050509 Bacteria 808
578 nmdc:mga0qj67_7722_c1 3300050509 Bacteria 7948
579 nmdc:mga06r32_6251_c1 3300050510 Bacteria 10690
580 nmdc:mga06r32_9946_c1 3300050510 Bacteria 8584
581 nmdc:mga08y16_12358_c1 3300050511 Bacteria 8979
582 nmdc:mga08y16_14353_c1 3300050511 Bacteria 8338
583 nmdc:mga08y16_233630_c1 3300050511 Bacteria 1901
584 nmdc:mga08y16_268071_c1 3300050511 Bacteria 1763
585 nmdc:mga0n895_35432_c1 3300050512 Bacteria 4811
586 nmdc:mga0n895_37088_c1 3300050512 Bacteria 4713
587 nmdc:mga0n895_58301_c1 3300050512 Bacteria 3806
588 nmdc:mga08x19_28163_c1 3300050514 Bacteria 3517
589 nmdc:mga08x19_513119_c1 3300050514 Bacteria 847
590 nmdc:mga0a205_15399_c1 3300050515 Bacteria 7147
591 Ga0495601_0179668 3300053077 Bacteria 1384
592 Ga0495601_0343157 3300053077 Bacteria 971
593 Ga0495595_0548997 3300053084 Bacteria 590
594 Ga0495619_0056287 3300053085 Bacteria 2607
595 Ga0495619_0853959 3300053085 Bacteria 614
596 Ga0500555_000139 3300053103 Bacteria 34376
597 Ga0500645_000010 3300053730 Bacteria 186517
598 Ga0501084_0082394 3300054114 Plasmid 2699
599 Ga0501082_0043413 3300060353 Plasmid 3876
600 Ga0530510_0713883 3300061734 Unclassified 764
601 2585401157 2582581867 Bacteria 7184437
602 2585821693 2585427590 Bacteria 6824633
603 Ga0070681_10033450
604 MBSR1b_contig_4311323
605 Ga0065712_10128329
606 Ga0065715_10150235
607 Ga0065715_10615300
608 Ga0070658_10013201
609 Ga0070658_10177928
610 Ga0070658_10330696
611 Ga0070658_10496032
612 Ga0070658_10587266
613 Ga0070676_10159816
614 Ga0070676_10557994
615 Ga0070683_100025964
616 Ga0070683_100327804
617 Ga0070690_100134692
618 Ga0070670_100099863
619 Ga0070677_10111752
620 Ga0070677_10374881
621 Ga0070666_10166686
622 Ga0070666_10190177
623 Ga0070680_100003177
624 Ga0070680_100124512
625 Ga0070680_100199163
626 Ga0070680_100228706
627 Ga0070680_101212128
628 Ga0070682_100237275
629 Ga0068868_100013018
630 Ga0068868_100181287
631 Ga0068868_100312838
632 Ga0068868_100602952
633 Ga0070660_100061095
634 Ga0070660_100235911
635 Ga0070660_100562011
636 Ga0070689_100212915
637 Ga0070689_101310690
638 Ga0070691_10388099
639 Ga0070691_10460529
640 Ga0070687_100040681
641 Ga0070661_100099406
642 Ga0070661_100186334
643 Ga0070661_100359523
644 Ga0070669_100021184
645 Ga0070675_100064828
646 Ga0070675_100098498
647 Ga0070671_100222112
648 Ga0070671_100368985
649 Ga0070674_100000514
650 Ga0070674_100003466
651 Ga0070674_100143667
652 Ga0070674_100753412
653 Ga0070673_101304549
654 Ga0070688_100239531
655 Ga0070659_100357755
656 Ga0070659_100550612
657 Ga0070667_100043236
658 Ga0070667_100050740
659 Ga0070667_100141459
660 Ga0070667_100203017
661 Ga0070714_100301944
662 Ga0070711_100258915
663 Ga0070711_101520218
664 Ga0070708_100461482
665 Ga0070663_100138271
666 Ga0070678_100080768
667 Ga0070678_100943133
668 Ga0070662_100105522
669 Ga0070681_10011291
670 Ga0070681_10038302
671 Ga0070681_10251323
672 Ga0068867_100123717
673 Ga0068867_100335717
674 Ga0068867_100411952
675 Ga0068867_100550768
676 Ga0070706_100240724
677 Ga0070706_100279557
678 Ga0070707_100315210
679 Ga0070699_100956284
680 Ga0070679_100010031
681 Ga0070679_100084099
682 Ga0070679_100130783
683 Ga0070684_100354388
684 Ga0070684_100727309
685 Ga0070684_100826068
686 Ga0070684_100907749
687 Ga0070697_100475620
688 Ga0068853_100454874
689 Ga0070672_100043257
690 Ga0070672_100104052
691 Ga0070672_100261162
692 Ga0070672_100693155
693 Ga0070686_100136782
694 Ga0070686_100672034
695 Ga0070695_101092688
696 Ga0070696_100406723
697 Ga0070665_100022809
698 Ga0070665_100149319
699 Ga0070665_100436315
700 Ga0070665_101092878
701 Ga0068855_100044266
702 Ga0068855_100102070
703 Ga0068855_100148837
704 Ga0068855_100474647
705 Ga0068855_100489984
706 Ga0068855_100515011
707 Ga0068855_100796675
708 Ga0068855_100800477
709 Ga0068855_101467874
710 Ga0070664_100034878
711 Ga0070664_100261087
712 Ga0070664_100602378
713 Ga0070664_101025743
714 Ga0068857_100115729
715 Ga0068857_100295305
716 Ga0068857_100682838
717 Ga0068856_100043239
718 Ga0068856_100129426
719 Ga0068856_100767889
720 Ga0068856_101430088
721 Ga0070702_100168199
722 Ga0068852_100465675
723 Ga0068852_101738862
724 Ga0068859_100097206
725 Ga0068859_100158662
726 Ga0068864_100820464
727 Ga0068866_10040555
728 Ga0068851_10326423
729 Ga0068870_10453490
730 Ga0068863_101223266
731 Ga0068863_101420041
732 Ga0068858_100218396
733 Ga0068858_100267349
734 Ga0068858_100354272
735 Ga0068858_100426985
736 Ga0068858_101034721
737 Ga0068860_100031450
738 Ga0068860_100234346
739 Ga0068860_100352333
740 Ga0068862_100094264
741 Ga0075365_10008126
742 Ga0075363_100165517
743 Ga0075364_10014717
744 Ga0070712_100552912
745 Ga0097621_100049342
746 Ga0097621_100072157
747 Ga0097621_100555612
748 Ga0097621_100681875
749 Ga0097621_101005574
750 Ga0097621_101147734
751 Ga0075370_10032639
752 Ga0068871_100157609
753 Ga0068871_100532187
754 Ga0068871_100903319
755 Ga0075428_100001438
756 Ga0075428_100003801
757 Ga0075428_100009870
758 Ga0075430_100004373
759 Ga0075430_100004916
760 Ga0075431_100014728
761 Ga0075431_100142609
762 Ga0075433_10022412
763 Ga0075434_100001624
764 Ga0075434_100172234
765 Ga0075434_100190547
766 Ga0075434_101209053
767 Ga0075429_100006454
768 Ga0075429_100162175
769 Ga0068865_100056721
770 Ga0068865_100187196
771 Ga0068865_100273584
772 Ga0068865_100418115
773 Ga0075436_100005768
774 Ga0075436_100304472
775 Ga0097620_100097206
776 Ga0097620_100158656
777 Ga0075435_101161926
778 Ga0105251_10417784
779 Ga0105240_10016206
780 Ga0105240_10044733
781 Ga0105240_10085178
782 Ga0105240_10121764
783 Ga0105240_10380802
784 Ga0105240_10806481
785 Ga0111539_10005424
786 Ga0111539_10145490
787 Ga0111539_10173391
788 Ga0111539_10441194
789 Ga0105245_10057139
790 Ga0105245_10149017
791 Ga0105245_10200038
792 Ga0105245_10266503
793 Ga0105245_10358280
794 Ga0105245_10359286
795 Ga0105247_10048781
796 Ga0105247_10200372
797 Ga0114129_10024687
798 Ga0114129_11406850
799 Ga0105243_10250331
800 Ga0105241_10337158
801 Ga0105241_10680841
802 Ga0105241_11662756
803 Ga0105242_10257036
804 Ga0105242_10304046
805 Ga0105242_10362476
806 Ga0105248_10120967
807 Ga0105248_10134199
808 Ga0105248_10261926
809 Ga0105248_10275529
810 Ga0105248_10292362
811 Ga0105248_10558347
812 Ga0105248_10843005
813 Ga0105248_11023241
814 Ga0105237_10537770
815 Ga0105238_10052907
816 Ga0105238_10112687
817 Ga0105238_10135284
818 Ga0105238_12013507
819 Ga0105249_10685446
820 Ga0105249_10693688
821 Ga0105239_10099908
822 Ga0105239_10276594
823 Ga0105239_11674568
824 Ga0105239_11839200
825 Ga0105246_10087320
826 Ga0105246_10386963
827 Ga0105246_10474056
828 Ga0157373_10468000
829 Ga0157371_10447537
830 Ga0157370_10002290
831 Ga0157370_10012502
832 Ga0157370_10053425
833 Ga0157370_11034172
834 Ga0157370_11251226
835 Ga0157369_10022081
836 Ga0157369_10063957
837 Ga0157369_10298935
838 Ga0157374_10016443
839 Ga0157374_10406179
840 Ga0157374_10477947
841 Ga0157378_10337357
842 Ga0157378_10407083
843 Ga0157378_10605381
844 Ga0157378_11019830
845 Ga0157378_11410580
846 Ga0163162_10023037
847 Ga0163162_10056528
848 Ga0163162_10333311
849 Ga0163162_11788820
850 Ga0157372_10008164
851 Ga0157372_10093145
852 Ga0157372_10138581
853 Ga0157372_10289350
854 Ga0157372_10346873
855 Ga0157372_10388266
856 Ga0157372_12540615
857 Ga0157375_10038762
858 Ga0157375_10267179
859 Ga0157375_10516294
860 Ga0157375_10670336
861 Ga0157375_11374223
862 Ga0163163_10467152
863 Ga0163163_10578781
864 Ga0163163_10796941
865 Ga0157380_10027742
866 Ga0157380_10171365
867 Ga0157380_10227106
868 Ga0157380_10738772
869 Ga0157380_11015145
870 Ga0182008_10048654
871 Ga0157377_10152885
872 Ga0157377_10675829
873 Ga0157379_10107315
874 Ga0157379_10113140
875 Ga0157379_10238276
876 Ga0157379_10642809
877 Ga0157379_11500999
878 Ga0157376_10059684
879 Ga0157376_10150833
880 Ga0157376_10252598
881 Ga0157376_10301699
882 Ga0157376_10643442
883 Ga0157376_10675454
884 Ga0157376_10933944
885 Ga0163161_10048691
886 Ga0207697_10089698
887 Ga0207682_10172435
888 Ga0207682_10190128
889 Ga0207682_10191189
890 Ga0207642_10418801
891 Ga0207680_10155814
892 Ga0207647_10050299
893 Ga0207647_10051231
894 Ga0207645_10098230
895 Ga0207645_10483748
896 Ga0207705_10297277
897 Ga0207705_10970112
898 Ga0207684_10298989
899 Ga0207654_11134597
900 Ga0207707_10105914
901 Ga0207707_10108504
902 Ga0207707_10164042
903 Ga0207707_10210802
904 Ga0207707_10244274
905 Ga0207707_10308455
906 Ga0207707_10660472
907 Ga0207695_10018908
908 Ga0207695_10220098
909 Ga0207695_10384436
910 Ga0207671_10177378
911 Ga0207660_10050583
912 Ga0207660_10168480
913 Ga0207660_10868570
914 Ga0207662_10069720
915 Ga0207657_10016418
916 Ga0207657_10032446
917 Ga0207657_10105159
918 Ga0207657_10143035
919 Ga0207657_10187059
920 Ga0207657_10224965
921 Ga0207649_10054563
922 Ga0207649_10080320
923 Ga0207649_10385441
924 Ga0207649_11244094
925 Ga0207649_11603313
926 Ga0207652_10025013
927 Ga0207652_10234319
928 Ga0207652_10244865
929 Ga0207646_10728002
930 Ga0207681_10010028
931 Ga0207694_10067860
932 Ga0207694_10180210
933 Ga0207694_10228398
934 Ga0207650_10100491
935 Ga0207650_10477100
936 Ga0207687_10084273
937 Ga0207687_10145611
938 Ga0207687_10248010
939 Ga0207687_10257658
940 Ga0207687_10429604
941 Ga0207687_10433563
942 Ga0207664_10043173
943 Ga0207664_10574815
944 Ga0207644_10210323
945 Ga0207644_10416175
946 Ga0207644_10662945
947 Ga0207644_10954813
948 Ga0207690_10130351
949 Ga0207690_10480779
950 Ga0207706_10091216
951 Ga0207706_11209977
952 Ga0207686_10142162
953 Ga0207686_10149775
954 Ga0207670_10504532
955 Ga0207669_10004397
956 Ga0207669_10011101
957 Ga0207669_10262346
958 Ga0207704_10712311
959 Ga0207704_10717104
960 Ga0207704_11958491
961 Ga0207691_10053932
962 Ga0207691_10279225
963 Ga0207691_10322941
964 Ga0207711_10063742
965 Ga0207711_10072442
966 Ga0207711_10111147
967 Ga0207711_10471911
968 Ga0207711_11090207
969 Ga0207711_11405655
970 Ga0207689_10148658
971 Ga0207689_10893319
972 Ga0207661_10012492
973 Ga0207661_10253033
974 Ga0207661_11640607
975 Ga0207679_10222608
976 Ga0207679_10565898
977 Ga0207667_10017187
978 Ga0207667_10099947
979 Ga0207667_10157307
980 Ga0207667_10791480
981 Ga0207667_11277576
982 Ga0207667_11367616
983 Ga0207651_10104874
984 Ga0207651_11798364
985 Ga0207712_10416024
986 Ga0207640_10165669
987 Ga0207658_10035056
988 Ga0207658_10131514
989 Ga0207658_10177795
990 Ga0207658_10475723
991 Ga0207658_11284322
992 Ga0207677_10003235
993 Ga0207677_10119623
994 Ga0207677_11198665
995 Ga0207677_11658928
996 Ga0207703_10007019
997 Ga0207703_11182490
998 Ga0207678_10019064
999 Ga0207678_10185130
1000 Ga0207702_10105173
1001 Ga0207702_10111574
1002 Ga0207702_10277279
1003 Ga0207702_12452862
1004 Ga0207641_10002331
1005 Ga0207641_10370216
1006 Ga0207648_10109953
1007 Ga0207648_10312537
1008 Ga0207648_10347989
1009 Ga0207648_10490794
1010 Ga0207648_10512326
1011 Ga0207648_11160300
1012 Ga0207674_10097431
1013 Ga0207674_10233545
1014 Ga0207674_10920868
1015 Ga0207683_10002192
1016 Ga0207683_10108450
1017 Ga0207683_10362823
1018 Ga0207698_11508719
1019 Ga0207428_10021904
1020 Ga0207428_10518508
1021 Ga0268266_10005093
1022 Ga0268266_10006491
1023 Ga0268266_10234107
1024 Ga0268264_10141538
1025 Ga0268264_10281851
1026 Ga0265336_10022999
1027 Ga0265330_10000229
1028 Ga0265332_10027342
1029 Ga0265328_10014696
1030 Ga0265320_10050567
1031 Ga0265325_10000037
1032 Ga0265340_10026830
1033 Ga0265339_10020292
1034 Ga0265339_10070595
1035 Ga0265316_10001378
1036 Ga0307408_100017353
1037 Ga0307408_100096690
1038 Ga0265313_10003220
1039 Ga0265314_10000098
1040 Ga0265342_10005455
1041 Ga0307405_10105078
1042 Ga0307405_11015928
1043 Ga0307413_11225810
1044 Ga0307410_10125020
1045 Ga0307406_10561860
1046 Ga0307406_11075370
1047 Ga0307412_10170435
1048 Ga0307409_100248149
1049 Ga0307416_100107104
1050 Ga0307414_10369057
1051 Ga0307411_10488694
1052 Ga0307411_10529514
1053 Ga0307415_100211202
1054 Ga0316583_10000017
1055 Ga0316583_10216196
1056 Ga0373923_0542085
1057 Ga0373943_0711411
1058 Ga0373946_0028815
1059 Ga0373924_0093040
1060 Ga0373931_0140064
1061 Ga0373931_0266228
1062 Ga0373935_0091973
1063 Ga0373935_0653646
1064 Ga0373935_0805352
1065 Ga0373927_0002899
1066 Ga0373927_0349648
1067 Ga0373933_0191599
1068 Ga0373947_0000488
1069 Ga0373937_0019487
1070 Ga0373925_0001046
1071 Ga0373925_0078628
1072 Ga0373925_0231313
1073 Ga0395898_1774011
1074 Ga0395905_0902157
1075 Ga0439444_0066937
1076 Ga0451577_0043579
1077 Ga0453683_0033065
1078 Ga0466966_0648761
1079 Ga0453684_0134432
1080 Ga0451576_0017206
1081 Ga0451576_0993538
1082 Ga0495580_0378526
1083 Ga0495582_0158463
1084 Ga0495639_0210111
1085 Ga0495639_0391264
1086 Ga0495594_0039794
1087 Ga0495630_0167897
1088 Ga0495630_0461569
1089 Ga0495640_0094024
1090 Ga0495587_0109579
1091 Ga0495634_0459457
1092 Ga0495659_0487139
1093 Ga0495588_0005354
1094 Ga0495646_0646302
1095 Ga0495647_0004918
1096 Ga0495647_0138603
1097 Ga0495658_0042149
1098 Ga0495658_0239615
1099 Ga0495658_0611351
1100 Ga0495669_0348046
1101 Ga0495613_0153982
1102 Ga0495670_0121519
1103 Ga0495581_0599261
1104 Ga0495604_0696221
1105 Ga0495674_0589084
1106 Ga0495676_0448596
1107 Ga0495602_0179088
1108 Ga0496100_0390143
1109 Ga0496101_0337020
1110 Ga0496101_0731782
1111 Ga0496101_0932603
1112 Ga0496101_1324940
1113 Ga0496104_0000182
1114 Ga0496104_0029652
1115 Ga0496104_0120067
1116 Ga0496105_0016358
1117 Ga0496105_0638887
1118 Ga0496105_1095920
1119 Ga0496106_0268118
1120 Ga0496107_1112708
1121 Ga0496108_0001152
1122 Ga0496108_0897119
1123 Ga0496109_0002055
1124 Ga0496109_0138088
1125 Ga0496109_0240080
1126 Ga0496109_0762181
1127 Ga0496110_0261719
1128 Ga0496111_0012429
1129 Ga0496112_0013651
1130 Ga0496112_0352621
1131 Ga0496112_0928582
1132 Ga0496113_0020005
1133 Ga0496113_0587583
1134 Ga0496114_0197286
1135 Ga0496114_0913117
1136 Ga0496114_1479915
1137 Ga0496125_0154594
1138 Ga0501291_014901
1139 Ga0501299_069905
1140 Ga0501031_0093318
1141 Ga0501032_0014675
1142 Ga0501033_0401092
1143 Ga0501034_0017367
1144 Ga0501034_0642102
1145 Ga0501036_0072976
1146 Ga0501037_0011596
1147 Ga0501038_0011655
1148 Ga0501039_0624266
1149 Ga0501041_0779624
1150 Ga0501042_0111831
1151 Ga0501043_0020706
1152 Ga0501046_0007804
1153 Ga0501047_0183756
1154 Ga0501048_0012945
1155 Ga0501067_0010113
1156 Ga0501068_0033538
1157 Ga0501069_0035561
1158 Ga0501070_0018121
1159 Ga0501072_0008674
1160 Ga0501073_0066015
1161 Ga0501073_0068554
1162 Ga0501074_0057267
1163 Ga0501077_0006001
1164 Ga0501208_037309
1165 Ga0501217_020812
1166 Ga0501251_079637
1167 Ga0501258_042538
1168 Ga0501225_0148060
1169 Ga0501079_0007099
1170 Ga0501083_0048307
1171 Ga0501044_0298772
1172 nmdc:mga0yw44_52371_c1
1173 nmdc:mga05p37_44301_c1
1174 nmdc:mga05p37_8663_c1
1175 nmdc:mga09592_13909_c1
1176 nmdc:mga09592_2423_c1
1177 nmdc:mga09592_939586_c1
1178 nmdc:mga0qj67_541841_c1
1179 nmdc:mga0qj67_697445_c1
1180 nmdc:mga0qj67_7722_c1
1181 nmdc:mga06r32_6251_c1
1182 nmdc:mga06r32_9946_c1
1183 nmdc:mga08y16_12358_c1
1184 nmdc:mga08y16_14353_c1
1185 nmdc:mga08y16_233630_c1
1186 nmdc:mga08y16_268071_c1
1187 nmdc:mga0n895_35432_c1
1188 nmdc:mga0n895_37088_c1
1189 nmdc:mga0n895_58301_c1
1190 nmdc:mga08x19_28163_c1
1191 nmdc:mga08x19_513119_c1
1192 nmdc:mga0a205_15399_c1
1193 Ga0495601_0179668
1194 Ga0495601_0343157
1195 Ga0495595_0548997
1196 Ga0495619_0056287
1197 Ga0495619_0853959
1198 Ga0500555_000139
1199 Ga0500645_000010
1200 Ga0501084_0082394
1201 Ga0501082_0043413
1202 Ga0530510_0713883
1203 2585401157
1204 2585821693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

75

145

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y3t-assembly1.cif.gz_B crystal structure of yxag, a dioxygenase from bacillus subtilis 0.9262 16 124
4fag-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant in complex with gentisate 0.9248 35 113
4fbf-assembly1.cif.gz_A crystal structure of the salicylate 1,2-dioxygenase from pseudoaminobacter salicylatoxidans w104y mutant 0.9245 35 113
2phd-assembly1.cif.gz_B crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9234 35 113
2phd-assembly1.cif.gz_C crystal structure determination of a salicylate 1,2-dioxygenase from pseudaminobacter salicylatoxidans 0.9216 35 113
ID Description Score Start End Superfamily
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9157 22 113 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9106 18 113 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9087 20 113 2.60.120.10
1gqhB01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9081 16 115 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8941 20 114 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7W8JB94-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.974 15 154 GO:0051213
AF-A0A852V818-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.9735 53 155 GO:0051213
AF-A0A4Q7YXL5-F1-model_v4 Quercetin dioxygenase-like cupin family protein 0.9709 15 155 GO:0051213
AF-A0A0T6A0F8-F1-model_v4 Cupin type-2 domain-containing protein 0.9706 9 155
AF-A0A2S7SY55-F1-model_v4 Cupin domain-containing protein 0.9705 15 155

Map