F468024

General Info

Members Datasets Scaffolds Average Seq Length
600 362 573 431

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_0187434|Ga0501080_0187434_256_1791
Length 480
Sequence MIPTVNVAPATGWPTGTTPVAAAGLEVAAFASGLEHPRWLYVLPNGDVLVAESNRPPAPEGSAGGGLKKWVMKRMMARAGAGVASANRITLLRDADGDGVAETRSVFLQDLNSPFGMALIGNAFYVANADAIVRFPYTAGATTMDSGAGVKVVDLPAGINHHWTKNLLASRDGTRLYATVGSNSNIAEKGMAAEEGRAAIWEIDPKAGTKRLFAAGLRNPNGLAWEPRTGALWTVVNERDELGSDLVPDYLTSVVDGGFYGWPYSYWGQNVDERVQPQQPDLVAKAIKPDYALGAHVAPLGLTTSEGAASLPSTYSSGMFVGQHGSWNRRPLSGYSVVFVPFRDGKPSDMPAEILTGFVNSDGEAHGRPVGVAIDKRGALLVADDVGNTIWRVASAAQSGQRSDRPGERTSSDARGRPAKLLLAALSVALADAVAADEEIRPQDRPAAFRELDVDGDGWISVVALNRSDQPGKFRNPDQG

Samples

Sample ID Description Type Environment
1 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
2 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
3 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
4 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
5 2643221570 Acidovorax sp. Root568 Isolate Unclassified
6 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
7 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
8 2643221652 Acidovorax sp. Root402 Isolate Unclassified
9 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
10 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
11 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
12 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
13 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
14 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
15 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
16 2857564685 Duganella sp. R-74599 Isolate Unclassified
17 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
18 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
19 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
20 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
21 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
22 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
23 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
24 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
25 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
26 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
27 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
28 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
29 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
30 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
32 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
33 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
34 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
39 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
40 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
41 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
44 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
47 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
48 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
49 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
50 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
51 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
52 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
53 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
54 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
55 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
56 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
57 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
58 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
59 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
60 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
63 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
64 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
65 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
66 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
67 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
68 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
69 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
70 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
84 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
87 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
101 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
104 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
107 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
108 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
109 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
112 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
113 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
121 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
125 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
126 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
127 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
128 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
129 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
130 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
134 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
135 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
136 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
137 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
138 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
139 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
140 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
141 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
142 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
143 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
144 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
151 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
152 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
153 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
156 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
157 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
212 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
213 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
217 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
218 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
223 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
224 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
225 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
228 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
229 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
230 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
235 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
241 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
242 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
243 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
244 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
245 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
246 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
247 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
248 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
249 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
250 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
254 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
255 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
261 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
262 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
265 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
268 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
269 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
270 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
286 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
287 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
293 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
294 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
295 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
296 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
297 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
298 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
299 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
302 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
303 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
304 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
305 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
306 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
309 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
314 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
315 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
316 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
317 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
318 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
337 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
338 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
351 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
352 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
353 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
354 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
355 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
356 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
357 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
358 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
359 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
360 639633007 Azoarcus olearius BH72 Isolate Unclassified
361 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
362 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.5
Metatranscriptomes 0
Isolates 4.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9
Nodule 1.33
Rhizoplane 1.5
Rhizosphere 80.17
Stem 0
Stem Tuber 0
Unclassified 8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10011591 3300001991 Bacteria 1591
2 JGI25159J45721_1003747 3300002987 Bacteria 5262
3 JGI25153J46596_10028772 3300003215 Bacteria 1921
4 rootL2_10000892 3300003322 Bacteria 46839
5 rootH1_10019014 3300003323 Bacteria 8773
6 JGI25404J52841_10006004 3300003659 Bacteria 2526
7 Ga0055538_1000886 3300003751 Bacteria 7512
8 Ga0055539_1000794 3300003752 Bacteria 7512
9 Ga0055533_1001148 3300003756 Bacteria 7512
10 Ga0055532_1001240 3300003758 Bacteria 7508
11 Ga0055525_1001003 3300003759 Bacteria 7512
12 Ga0055526_1000052 3300003771 Bacteria 116035
13 Ga0055524_1000117 3300003775 Bacteria 93643
14 Ga0055524_1012896 3300003775 Bacteria 3184
15 Ga0055531_10004923 3300003794 Bacteria 7940
16 Ga0055531_10005573 3300003794 Bacteria 7344
17 Ga0055541_1000846 3300003841 Bacteria 7512
18 Ga0055543_1005977 3300004625 Bacteria 3021
19 Ga0065165_1000059 3300005262 Bacteria 182314
20 Ga0065165_1000099 3300005262 Bacteria 142245
21 Ga0065165_1000378 3300005262 Bacteria 72655
22 Ga0065165_1000598 3300005262 Bacteria 52772
23 Ga0065714_10004818 3300005288 Bacteria 4585
24 Ga0065712_10067802 3300005290 Bacteria 31985
25 Ga0065715_10097283 3300005293 Bacteria 3731
26 Ga0070658_10016477 3300005327 Bacteria 5915
27 Ga0070676_10013640 3300005328 Bacteria 4456
28 Ga0070676_10067197 3300005328 Bacteria 2143
29 Ga0070683_100042465 3300005329 Bacteria 4187
30 Ga0070670_100000155 3300005331 Bacteria 62949
31 Ga0070670_100008834 3300005331 Bacteria 8601
32 Ga0070670_100030930 3300005331 Bacteria 4611
33 Ga0070670_100127424 3300005331 Bacteria 2197
34 Ga0070666_10010244 3300005335 Bacteria 5858
35 Ga0070680_100007963 3300005336 Bacteria 8089
36 Ga0070680_100162156 3300005336 Bacteria 1879
37 Ga0070680_100183242 3300005336 Bacteria 1764
38 Ga0070682_100027876 3300005337 Bacteria 3392
39 Ga0070682_100046482 3300005337 Bacteria 2694
40 Ga0068868_100127726 3300005338 Bacteria 2078
41 Ga0070660_100006633 3300005339 Bacteria 8030
42 Ga0070689_100028511 3300005340 Bacteria 4220
43 Ga0070689_100035468 3300005340 Bacteria 3811
44 Ga0070691_10002047 3300005341 Bacteria 8897
45 Ga0070691_10007419 3300005341 Bacteria 5024
46 Ga0070687_100000955 3300005343 Bacteria 9832
47 Ga0070687_100034798 3300005343 Bacteria 2496
48 Ga0070687_100039170 3300005343 Bacteria 2380
49 Ga0070687_100053725 3300005343 Bacteria 2096
50 Ga0070661_100008546 3300005344 Bacteria 7080
51 Ga0070692_10001360 3300005345 Bacteria 8818
52 Ga0070692_10025118 3300005345 Bacteria 2935
53 Ga0070668_100024477 3300005347 Bacteria 4576
54 Ga0070668_100026469 3300005347 Bacteria 4402
55 Ga0070669_100001083 3300005353 Bacteria 19929
56 Ga0070669_100010755 3300005353 Bacteria 6495
57 Ga0070669_100026167 3300005353 Bacteria 4197
58 Ga0070669_100049063 3300005353 Bacteria 3082
59 Ga0070671_100110412 3300005355 Bacteria 2310
60 Ga0070674_100034832 3300005356 Bacteria 3366
61 Ga0070674_100044169 3300005356 Bacteria 3036
62 Ga0070673_100025028 3300005364 Bacteria 4386
63 Ga0070673_100074412 3300005364 Bacteria 2737
64 Ga0070673_100078360 3300005364 Bacteria 2673
65 Ga0070688_100009644 3300005365 Bacteria 5294
66 Ga0070659_100010688 3300005366 Bacteria 6762
67 Ga0070667_100040210 3300005367 Bacteria 3921
68 Ga0070667_100121522 3300005367 Bacteria 2272
69 Ga0070714_100005978 3300005435 Bacteria 9342
70 Ga0070701_10002657 3300005438 Bacteria 6929
71 Ga0070700_100001557 3300005441 Bacteria 11439
72 Ga0070694_100007042 3300005444 Bacteria 6841
73 Ga0070678_100013489 3300005456 Bacteria 5126
74 Ga0070678_100118045 3300005456 Bacteria 2087
75 Ga0070662_100045607 3300005457 Bacteria 3146
76 Ga0070662_100086660 3300005457 Bacteria 2343
77 Ga0070681_10021034 3300005458 Bacteria 6537
78 Ga0070681_10105664 3300005458 Bacteria 2758
79 Ga0068867_100131378 3300005459 Bacteria 1946
80 Ga0070685_10004412 3300005466 Bacteria 7106
81 Ga0070685_10010094 3300005466 Bacteria 4898
82 Ga0070679_100109683 3300005530 Bacteria 2746
83 Ga0070684_100012745 3300005535 Bacteria 6750
84 Ga0070684_100102751 3300005535 Bacteria 2556
85 Ga0070672_100096097 3300005543 Bacteria 2397
86 Ga0070686_100005320 3300005544 Bacteria 7121
87 Ga0070686_100046432 3300005544 Bacteria 2741
88 Ga0070696_100000013 3300005546 Bacteria 78718
89 Ga0070665_100002087 3300005548 Bacteria 22404
90 Ga0070665_100041560 3300005548 Bacteria 4622
91 Ga0070665_100124454 3300005548 Unclassified 2580
92 Ga0068855_100139220 3300005563 Bacteria 2768
93 Ga0068855_100155441 3300005563 Bacteria 2599
94 Ga0070664_100000651 3300005564 Bacteria 26520
95 Ga0068857_100013040 3300005577 Bacteria 7241
96 Ga0068856_100120658 3300005614 Bacteria 2623
97 Ga0070702_100068502 3300005615 Bacteria 2088
98 Ga0070702_100090282 3300005615 Bacteria 1857
99 Ga0068852_100029633 3300005616 Bacteria 4498
100 Ga0068864_100011396 3300005618 Bacteria 7344
101 Ga0068864_100027732 3300005618 Bacteria 4785
102 Ga0068866_10009938 3300005718 Bacteria 4060
103 Ga0068861_100002744 3300005719 Bacteria 11537
104 Ga0068861_100024260 3300005719 Bacteria 4385
105 Ga0068851_10000197 3300005834 Bacteria 29386
106 Ga0068851_10007001 3300005834 Bacteria 5171
107 Ga0068870_10013996 3300005840 Bacteria 3780
108 Ga0068863_100007312 3300005841 Bacteria 10812
109 Ga0068863_100050649 3300005841 Bacteria 3936
110 Ga0068858_100002537 3300005842 Bacteria 18405
111 Ga0068858_100014317 3300005842 Bacteria 7480
112 Ga0068858_100037191 3300005842 Bacteria 4513
113 Ga0068860_100026094 3300005843 Bacteria 5636
114 Ga0068860_100054358 3300005843 Bacteria 3806
115 Ga0068860_100069151 3300005843 Bacteria 3355
116 Ga0068862_100001151 3300005844 Bacteria 25015
117 Ga0068862_100031145 3300005844 Bacteria 4500
118 Ga0068862_100040741 3300005844 Bacteria 3948
119 Ga0068862_100043353 3300005844 Bacteria 3835
120 Ga0081540_1000663 3300005983 Bacteria 32432
121 Ga0081540_1043087 3300005983 Bacteria 2320
122 Ga0075365_10199719 3300006038 Bacteria 1400
123 Ga0075364_10016895 3300006051 Bacteria 4547
124 Ga0075432_10001028 3300006058 Bacteria 8868
125 Ga0075427_10000673 3300006194 Bacteria 4068
126 Ga0097621_100003933 3300006237 Bacteria 10292
127 Ga0075370_10139923 3300006353 Bacteria 1414
128 Ga0075430_100000332 3300006846 Bacteria 33904
129 Ga0075430_100003367 3300006846 Bacteria 13388
130 Ga0075431_100008089 3300006847 Bacteria 10498
131 Ga0075434_100000647 3300006871 Bacteria 26943
132 Ga0075429_100000296 3300006880 Bacteria 35293
133 Ga0075429_100000451 3300006880 Bacteria 30628
134 Ga0068865_100001035 3300006881 Bacteria 16020
135 Ga0068865_100034470 3300006881 Bacteria 3396
136 Ga0079104_1017736 3300006946 Bacteria 2038
137 Ga0075435_100000630 3300007076 Bacteria 21640
138 Ga0105251_10001791 3300009011 Bacteria 17849
139 Ga0105251_10002666 3300009011 Bacteria 13754
140 Ga0105251_10003271 3300009011 Bacteria 11881
141 Ga0105251_10013975 3300009011 Bacteria 4460
142 Ga0105251_10014963 3300009011 Bacteria 4259
143 Ga0105244_10000181 3300009036 Bacteria 63616
144 Ga0105244_10002140 3300009036 Bacteria 15155
145 Ga0105244_10002479 3300009036 Bacteria 13897
146 Ga0105244_10029049 3300009036 Bacteria 2960
147 Ga0105244_10041777 3300009036 Bacteria 2375
148 Ga0105244_10058508 3300009036 Bacteria 1945
149 Ga0105250_10000088 3300009092 Bacteria 80904
150 Ga0105250_10000261 3300009092 Bacteria 43192
151 Ga0105250_10009888 3300009092 Bacteria 4003
152 Ga0105240_10009287 3300009093 Bacteria 13943
153 Ga0105240_10142449 3300009093 Bacteria 2865
154 Ga0105240_10191888 3300009093 Bacteria 2401
155 Ga0111539_10002056 3300009094 Bacteria 26910
156 Ga0111539_10022347 3300009094 Bacteria 7774
157 Ga0111539_10172607 3300009094 Bacteria 2526
158 Ga0114129_10016414 3300009147 Bacteria 10538
159 Ga0114129_10189357 3300009147 Bacteria 2795
160 Ga0105243_10019654 3300009148 Bacteria 5121
161 Ga0105243_10020789 3300009148 Bacteria 4980
162 Ga0105243_10057254 3300009148 Bacteria 3103
163 Ga0105243_10070754 3300009148 Bacteria 2818
164 Ga0105243_10123536 3300009148 Bacteria 2186
165 Ga0105243_10176723 3300009148 Bacteria 1853
166 Ga0105241_10000171 3300009174 Bacteria 47968
167 Ga0105242_10003223 3300009176 Bacteria 12720
168 Ga0105238_10000865 3300009551 Bacteria 31282
169 Ga0105238_10142860 3300009551 Bacteria 2370
170 Ga0105249_10037049 3300009553 Bacteria 4426
171 Ga0105239_10008186 3300010375 Bacteria 11925
172 Ga0105246_10000174 3300011119 Bacteria 31284
173 Ga0105246_10024242 3300011119 Bacteria 3939
174 Ga0157317_1000800 3300012475 Bacteria 1517
175 Ga0157319_1000024 3300012497 Bacteria 65569
176 Ga0157373_10002145 3300013100 Bacteria 14933
177 Ga0157373_10006136 3300013100 Bacteria 8985
178 Ga0157373_10014390 3300013100 Bacteria 5800
179 Ga0157373_10036326 3300013100 Bacteria 3537
180 Ga0157371_10031143 3300013102 Bacteria 3843
181 Ga0157371_10045904 3300013102 Bacteria 3108
182 Ga0157371_10133262 3300013102 Bacteria 1768
183 Ga0157370_10009550 3300013104 Bacteria 10342
184 Ga0157370_10023529 3300013104 Bacteria 6113
185 Ga0157370_10065730 3300013104 Bacteria 3431
186 Ga0157369_10004166 3300013105 Bacteria 17134
187 Ga0157369_10028384 3300013105 Bacteria 6193
188 Ga0157369_10207891 3300013105 Bacteria 2052
189 Ga0157374_10000958 3300013296 Bacteria 25036
190 Ga0157374_10004803 3300013296 Bacteria 11342
191 Ga0157374_10051673 3300013296 Bacteria 3825
192 Ga0163162_10117349 3300013306 Bacteria 2763
193 Ga0157375_10000050 3300013308 Bacteria 134913
194 Ga0157375_10056502 3300013308 Bacteria 3875
195 Ga0157375_10267250 3300013308 Bacteria 1872
196 Ga0163163_10034762 3300014325 Bacteria 4884
197 Ga0157380_10002683 3300014326 Bacteria 12072
198 Ga0157380_10013364 3300014326 Bacteria 5984
199 Ga0157380_10018593 3300014326 Bacteria 5161
200 Ga0182008_10032776 3300014497 Bacteria 2608
201 Ga0157377_10025602 3300014745 Bacteria 3148
202 Ga0157379_10002335 3300014968 Bacteria 15815
203 Ga0157379_10010681 3300014968 Bacteria 7999
204 Ga0157379_10034552 3300014968 Bacteria 4508
205 Ga0157379_10082432 3300014968 Bacteria 2882
206 Ga0182006_1000116 3300015261 Bacteria 86100
207 Ga0182007_10000771 3300015262 Bacteria 17935
208 Ga0182005_1000003 3300015265 Bacteria 683269
209 Ga0163161_10002851 3300017792 Bacteria 12263
210 Ga0163161_10003420 3300017792 Bacteria 11129
211 Ga0163161_10081985 3300017792 Bacteria 2376
212 Ga0163161_10082863 3300017792 Bacteria 2364
213 Ga0213872_10001285 3300021361 Bacteria 16783
214 Ga0209435_103668 3300025206 Bacteria 1744
215 Ga0209784_100414 3300025224 Bacteria 19015
216 Ga0209566_100716 3300025225 Bacteria 18941
217 Ga0209674_100446 3300025226 Bacteria 19015
218 Ga0209147_100742 3300025229 Bacteria 16146
219 Ga0209563_100319 3300025230 Bacteria 19015
220 Ga0209258_100860 3300025242 Bacteria 16144
221 Ga0207425_1000346 3300025245 Bacteria 32243
222 Ga0209646_1000543 3300025246 Bacteria 16214
223 Ga0209677_100627 3300025253 Bacteria 18940
224 Ga0209759_1004314 3300025256 Bacteria 5351
225 Ga0209676_1007332 3300025292 Bacteria 5212
226 Ga0209564_1000026 3300025295 Bacteria 519154
227 Ga0209564_1000097 3300025295 Bacteria 231436
228 Ga0209758_1000314 3300025297 Bacteria 93818
229 Ga0209050_1002726 3300025298 Bacteria 14271
230 Ga0209256_1000075 3300025299 Bacteria 236149
231 Ga0209256_1001776 3300025299 Bacteria 20464
232 Ga0209051_1001190 3300025303 Bacteria 23511
233 Ga0209257_1000244 3300025304 Bacteria 126098
234 Ga0209257_1002005 3300025304 Bacteria 21776
235 Ga0207697_10003666 3300025315 Bacteria 7522
236 Ga0207656_10005798 3300025321 Bacteria 4395
237 Ga0207656_10061085 3300025321 Bacteria 1653
238 Ga0207696_1000091 3300025711 Bacteria 187999
239 Ga0207655_1000113 3300025728 Bacteria 167376
240 Ga0207655_1003222 3300025728 Bacteria 12266
241 Ga0207655_1018389 3300025728 Bacteria 3708
242 Ga0207655_1021767 3300025728 Bacteria 3240
243 Ga0207655_1027492 3300025728 Bacteria 2708
244 Ga0207713_1000432 3300025735 Bacteria 44225
245 Ga0207713_1001595 3300025735 Bacteria 17730
246 Ga0207713_1026716 3300025735 Bacteria 2638
247 Ga0207682_10000905 3300025893 Bacteria 13733
248 Ga0207642_10030927 3300025899 Bacteria 2237
249 Ga0207688_10000676 3300025901 Bacteria 16826
250 Ga0207680_10029668 3300025903 Bacteria 3076
251 Ga0207645_10000860 3300025907 Bacteria 25221
252 Ga0207645_10003294 3300025907 Bacteria 12321
253 Ga0207645_10076298 3300025907 Bacteria 2146
254 Ga0207643_10000205 3300025908 Bacteria 41221
255 Ga0207643_10046800 3300025908 Bacteria 2446
256 Ga0207705_10022392 3300025909 Bacteria 4505
257 Ga0207705_10023899 3300025909 Bacteria 4361
258 Ga0207705_10057204 3300025909 Bacteria 2813
259 Ga0207705_10147410 3300025909 Bacteria 1761
260 Ga0207654_10000134 3300025911 Bacteria 47957
261 Ga0207707_10184056 3300025912 Bacteria 1823
262 Ga0207695_10061489 3300025913 Bacteria 3881
263 Ga0207695_10135915 3300025913 Bacteria 2411
264 Ga0207660_10013510 3300025917 Bacteria 5351
265 Ga0207662_10002164 3300025918 Bacteria 9790
266 Ga0207662_10002300 3300025918 Bacteria 9566
267 Ga0207662_10027596 3300025918 Bacteria 3277
268 Ga0207662_10033083 3300025918 Bacteria 3011
269 Ga0207657_10005467 3300025919 Bacteria 13262
270 Ga0207657_10008770 3300025919 Bacteria 10236
271 Ga0207657_10010663 3300025919 Bacteria 9153
272 Ga0207652_10212463 3300025921 Bacteria 1742
273 Ga0207681_10000690 3300025923 Bacteria 22223
274 Ga0207681_10000883 3300025923 Bacteria 19643
275 Ga0207681_10045876 3300025923 Bacteria 2937
276 Ga0207681_10076723 3300025923 Bacteria 2347
277 Ga0207650_10000373 3300025925 Bacteria 42334
278 Ga0207650_10001078 3300025925 Bacteria 20212
279 Ga0207650_10009278 3300025925 Bacteria 6722
280 Ga0207659_10019339 3300025926 Bacteria 4481
281 Ga0207664_10015167 3300025929 Bacteria 5584
282 Ga0207644_10054444 3300025931 Bacteria 2881
283 Ga0207644_10080072 3300025931 Bacteria 2412
284 Ga0207644_10177020 3300025931 Bacteria 1669
285 Ga0207690_10003250 3300025932 Bacteria 9750
286 Ga0207706_10000618 3300025933 Bacteria 37720
287 Ga0207706_10000935 3300025933 Bacteria 29879
288 Ga0207706_10088459 3300025933 Bacteria 2723
289 Ga0207706_10119314 3300025933 Bacteria 2319
290 Ga0207686_10003655 3300025934 Bacteria 8241
291 Ga0207709_10006905 3300025935 Bacteria 6353
292 Ga0207709_10013101 3300025935 Bacteria 4571
293 Ga0207709_10022219 3300025935 Bacteria 3597
294 Ga0207709_10034258 3300025935 Bacteria 2992
295 Ga0207670_10007157 3300025936 Bacteria 6218
296 Ga0207670_10016919 3300025936 Bacteria 4396
297 Ga0207669_10005612 3300025937 Bacteria 5649
298 Ga0207669_10013934 3300025937 Bacteria 4014
299 Ga0207704_10001205 3300025938 Bacteria 11527
300 Ga0207704_10046148 3300025938 Bacteria 2594
301 Ga0207691_10025775 3300025940 Bacteria 5518
302 Ga0207691_10040837 3300025940 Bacteria 4286
303 Ga0207691_10063173 3300025940 Bacteria 3359
304 Ga0207691_10152739 3300025940 Bacteria 2029
305 Ga0207711_10036064 3300025941 Bacteria 4195
306 Ga0207711_10105405 3300025941 Bacteria 2500
307 Ga0207689_10000451 3300025942 Bacteria 38688
308 Ga0207689_10001368 3300025942 Bacteria 23383
309 Ga0207661_10066704 3300025944 Bacteria 2924
310 Ga0207651_10009135 3300025960 Bacteria 5401
311 Ga0207651_10073619 3300025960 Bacteria 2429
312 Ga0207712_10052028 3300025961 Bacteria 2867
313 Ga0207668_10015582 3300025972 Bacteria 4725
314 Ga0207668_10018685 3300025972 Bacteria 4369
315 Ga0207658_10023813 3300025986 Bacteria 4278
316 Ga0207703_10026738 3300026035 Bacteria 4545
317 Ga0207703_10047521 3300026035 Bacteria 3461
318 Ga0207703_10062701 3300026035 Bacteria 3045
319 Ga0207703_10229393 3300026035 Bacteria 1664
320 Ga0207639_10022982 3300026041 Bacteria 4496
321 Ga0207639_10232614 3300026041 Bacteria 1598
322 Ga0207678_10132975 3300026067 Bacteria 2122
323 Ga0207708_10000114 3300026075 Bacteria 61971
324 Ga0207708_10000557 3300026075 Bacteria 28820
325 Ga0207708_10003529 3300026075 Bacteria 11520
326 Ga0207708_10004301 3300026075 Bacteria 10482
327 Ga0207641_10032348 3300026088 Bacteria 4342
328 Ga0207641_10112818 3300026088 Bacteria 2412
329 Ga0207641_10220374 3300026088 Bacteria 1759
330 Ga0207648_10001471 3300026089 Bacteria 25924
331 Ga0207648_10026748 3300026089 Bacteria 5124
332 Ga0207648_10028967 3300026089 Bacteria 4909
333 Ga0207648_10073941 3300026089 Bacteria 2970
334 Ga0207676_10025509 3300026095 Bacteria 4385
335 Ga0207676_10025835 3300026095 Bacteria 4360
336 Ga0207674_10099881 3300026116 Bacteria 2884
337 Ga0207675_100001090 3300026118 Bacteria 26881
338 Ga0207675_100003064 3300026118 Bacteria 16393
339 Ga0207675_100003701 3300026118 Bacteria 14900
340 Ga0207675_100009061 3300026118 Bacteria 9339
341 Ga0207683_10011402 3300026121 Bacteria 7585
342 Ga0207698_10035718 3300026142 Bacteria 3639
343 Ga0207698_10051297 3300026142 Bacteria 3153
344 Ga0207698_10192873 3300026142 Bacteria 1817
345 Ga0209281_1007615 3300027111 Bacteria 2705
346 Ga0207428_10000180 3300027907 Bacteria 88557
347 Ga0207428_10063229 3300027907 Bacteria 2924
348 Ga0207428_10119781 3300027907 Bacteria 2019
349 Ga0268266_10069528 3300028379 Bacteria 3050
350 Ga0268265_10000621 3300028380 Bacteria 35352
351 Ga0268265_10128985 3300028380 Bacteria 2098
352 Ga0268264_10097899 3300028381 Bacteria 2543
353 Ga0265336_10000039 3300028666 Bacteria 149376
354 Ga0265324_10000223 3300029957 Bacteria 43654
355 Ga0265328_10002757 3300031239 Bacteria 7861
356 Ga0307513_10000066 3300031456 Bacteria 141617
357 Ga0307513_10019665 3300031456 Bacteria 8032
358 Ga0307509_10002265 3300031507 Bacteria 31503
359 Ga0307508_10117654 3300031616 Bacteria 2259
360 Ga0307516_10029384 3300031730 Bacteria 5557
361 Ga0307405_10000054 3300031731 Bacteria 58365
362 Ga0307413_10054238 3300031824 Bacteria 2431
363 Ga0307410_10028059 3300031852 Bacteria 3566
364 Ga0307410_10152065 3300031852 Bacteria 1724
365 Ga0307410_10187076 3300031852 Bacteria 1572
366 Ga0307406_10083892 3300031901 Bacteria 2126
367 Ga0307412_10060034 3300031911 Bacteria 2551
368 Ga0307409_100011300 3300031995 Bacteria 5618
369 Ga0307409_100129374 3300031995 Bacteria 2154
370 Ga0307409_100238299 3300031995 Bacteria 1654
371 Ga0307416_100110227 3300032002 Bacteria 2423
372 Ga0307414_10011556 3300032004 Bacteria 5183
373 Ga0307414_10061929 3300032004 Bacteria 2652
374 Ga0307411_10001564 3300032005 Bacteria 9479
375 Ga0307510_10008623 3300033180 Bacteria 12150
376 Ga0373944_0019089 3300035089 Bacteria 1965
377 Ga0373949_0020485 3300035090 Bacteria 1514
378 Ga0373941_0019456 3300035115 Bacteria 1891
379 Ga0373943_0023996 3300035170 Bacteria 2841
380 Ga0373943_0037106 3300035170 Bacteria 2338
381 Ga0373947_0007862 3300035725 Bacteria 6157
382 Ga0373947_0164796 3300035725 Bacteria 1435
383 Ga0395905_0019451 3300037471 Bacteria 6437
384 Ga0395905_0081841 3300037471 Bacteria 3026
385 Ga0436361_0165235 3300039447 Bacteria 5547
386 Ga0436361_0303811 3300039447 Bacteria 2268
387 Ga0436361_1035230 3300039447 Bacteria 5145
388 Ga0436362_0866046 3300039453 Bacteria 2229
389 Ga0439466_0053396 3300041411 Bacteria 1318
390 Ga0439462_0020776 3300042015 Bacteria 1713
391 Ga0450913_000144 3300042117 Bacteria 2203
392 Ga0450923_003832 3300042125 Bacteria 2311
393 Ga0450904_000412 3300042139 Bacteria 8738
394 Ga0439446_0008790 3300042156 Bacteria 2691
395 Ga0439446_0018222 3300042156 Bacteria 1965
396 Ga0439434_0004984 3300042435 Bacteria 3880
397 Ga0439459_0007697 3300042438 Bacteria 1825
398 Ga0450918_003841 3300042531 Bacteria 2768
399 Ga0451577_0181761 3300042876 Bacteria 1896
400 Ga0466963_0113030 3300044694 Bacteria 1865
401 Ga0451576_0000220 3300045051 Bacteria 141261
402 Ga0451576_0011312 3300045051 Bacteria 10154
403 Ga0495627_000530 3300046453 Bacteria 31551
404 Ga0495627_000888 3300046453 Bacteria 20978
405 Ga0495592_0053899 3300046454 Bacteria 2981
406 Ga0495591_000529 3300046458 Bacteria 29837
407 Ga0495638_0001443 3300046460 Bacteria 21511
408 Ga0495638_0003221 3300046460 Bacteria 12910
409 Ga0495638_0005791 3300046460 Bacteria 9094
410 Ga0495638_0011834 3300046460 Bacteria 6003
411 Ga0495638_0091408 3300046460 Bacteria 1833
412 Ga0495653_0009457 3300046463 Bacteria 7975
413 Ga0495650_0002849 3300046471 Bacteria 13231
414 Ga0495650_0003122 3300046471 Bacteria 12416
415 Ga0495580_0001063 3300046472 Bacteria 24156
416 Ga0495605_0017853 3300046474 Bacteria 3812
417 Ga0495605_0025507 3300046474 Bacteria 3080
418 Ga0495584_0000875 3300046491 Bacteria 19432
419 Ga0495585_0001381 3300046492 Bacteria 19179
420 Ga0495596_0002737 3300046500 Bacteria 9261
421 Ga0495607_0002057 3300046501 Bacteria 16829
422 Ga0495607_0008751 3300046501 Bacteria 6896
423 Ga0495607_0010963 3300046501 Bacteria 6062
424 Ga0495583_0001527 3300046506 Bacteria 22952
425 Ga0495583_0005777 3300046506 Bacteria 8273
426 Ga0495606_0000725 3300046507 Bacteria 50954
427 Ga0495606_0004441 3300046507 Bacteria 14017
428 Ga0495606_0009506 3300046507 Bacteria 8212
429 Ga0495610_0000021 3300046512 Bacteria 336300
430 Ga0495610_0001114 3300046512 Bacteria 24484
431 Ga0495610_0008547 3300046512 Bacteria 6609
432 Ga0495610_0030819 3300046512 Bacteria 2804
433 Ga0495620_0000224 3300046515 Bacteria 42576
434 Ga0495630_0087358 3300046517 Bacteria 2355
435 Ga0495631_0006268 3300046518 Bacteria 6158
436 Ga0495632_0000275 3300046519 Bacteria 50568
437 Ga0495632_0003902 3300046519 Bacteria 10361
438 Ga0495632_0006116 3300046519 Bacteria 7803
439 Ga0495632_0008775 3300046519 Bacteria 6159
440 Ga0495632_0062559 3300046519 Bacteria 1804
441 Ga0495637_0000057 3300046520 Bacteria 97433
442 Ga0495637_0005703 3300046520 Bacteria 6314
443 Ga0495637_0038642 3300046520 Bacteria 2065
444 Ga0495654_0000005 3300046530 Bacteria 491381
445 Ga0495654_0001418 3300046530 Bacteria 16564
446 Ga0495609_0002721 3300046538 Bacteria 10667
447 Ga0495621_0003116 3300046539 Bacteria 4537
448 Ga0495621_0012488 3300046539 Bacteria 2649
449 Ga0495633_0000587 3300046558 Bacteria 35276
450 Ga0495656_0000940 3300046615 Bacteria 9423
451 Ga0495668_0000008 3300046616 Bacteria 498364
452 Ga0495668_0012451 3300046616 Bacteria 5043
453 Ga0495668_0061189 3300046616 Bacteria 2077
454 Ga0495625_0002093 3300046660 Bacteria 22302
455 Ga0495625_0006426 3300046660 Bacteria 10463
456 Ga0495625_0035111 3300046660 Bacteria 3697
457 Ga0495659_0003719 3300046664 Bacteria 4851
458 Ga0495661_0000150 3300046665 Bacteria 81419
459 Ga0495661_0000193 3300046665 Bacteria 70300
460 Ga0495661_0000698 3300046665 Bacteria 33395
461 Ga0495661_0000780 3300046665 Bacteria 30377
462 Ga0495661_0003350 3300046665 Bacteria 11878
463 Ga0495647_0003356 3300046681 Bacteria 5129
464 Ga0495658_0035972 3300046683 Bacteria 2729
465 Ga0495669_0002301 3300046684 Bacteria 7829
466 Ga0495671_0002178 3300046692 Bacteria 12484
467 Ga0495649_0001376 3300046694 Bacteria 18410
468 Ga0495649_0003451 3300046694 Bacteria 10654
469 Ga0495649_0007309 3300046694 Bacteria 6750
470 Ga0495589_0000490 3300046794 Bacteria 28284
471 Ga0495660_0000072 3300046810 Bacteria 109692
472 Ga0495660_0044433 3300046810 Bacteria 2444
473 Ga0495660_0047438 3300046810 Bacteria 2352
474 Ga0495636_0006614 3300047318 Bacteria 4557
475 Ga0495672_0000014 3300047320 Bacteria 505636
476 Ga0495672_0003595 3300047320 Bacteria 13168
477 Ga0495676_0001551 3300047321 Bacteria 19928
478 Ga0495683_0001223 3300047323 Bacteria 17497
479 Ga0495687_014395 3300047443 Bacteria 4076
480 Ga0495679_000226 3300047446 Bacteria 47732
481 Ga0495679_010966 3300047446 Bacteria 3526
482 Ga0495685_007440 3300047447 Bacteria 3615
483 Ga0495673_0000033 3300047469 Bacteria 354152
484 Ga0495673_0004969 3300047469 Bacteria 8178
485 Ga0495681_0004774 3300047470 Bacteria 9180
486 Ga0495681_0059744 3300047470 Bacteria 1761
487 Ga0495686_0000075 3300047472 Bacteria 208031
488 Ga0495686_0001396 3300047472 Bacteria 26729
489 Ga0495686_0032698 3300047472 Bacteria 3364
490 Ga0495626_0000796 3300048091 Bacteria 28573
491 Ga0496102_0089208 3300048905 Bacteria 2852
492 Ga0496104_0015068 3300048907 Bacteria 6997
493 Ga0496105_0007157 3300048908 Bacteria 8610
494 Ga0496106_0032321 3300048909 Bacteria 3901
495 Ga0496108_0013198 3300048911 Bacteria 6733
496 Ga0496109_0012841 3300048912 Bacteria 7239
497 Ga0496110_0006943 3300048913 Bacteria 9006
498 Ga0496110_0197765 3300048913 Bacteria 1826
499 Ga0496112_0093879 3300048915 Bacteria 2970
500 Ga0496117_0000597 3300048920 Bacteria 59321
501 Ga0496117_0073991 3300048920 Bacteria 2270
502 Ga0496118_0014825 3300048921 Bacteria 7268
503 Ga0496118_0016520 3300048921 Bacteria 6768
504 Ga0496120_0007305 3300048923 Bacteria 8248
505 Ga0496120_0111207 3300048923 Bacteria 1431
506 Ga0496121_0028522 3300048924 Bacteria 5193
507 Ga0496122_0040668 3300048925 Bacteria 3689
508 Ga0496123_0001590 3300048926 Bacteria 30876
509 Ga0496123_0037309 3300048926 Bacteria 3432
510 Ga0496124_0001080 3300048927 Bacteria 43080
511 Ga0496124_0015231 3300048927 Bacteria 7380
512 Ga0496124_0044863 3300048927 Bacteria 3791
513 Ga0496124_0158316 3300048927 Bacteria 1768
514 Ga0496125_0000465 3300048928 Bacteria 72631
515 Ga0496125_0010799 3300048928 Bacteria 9196
516 Ga0496125_0019156 3300048928 Bacteria 6468
517 Ga0496125_0023871 3300048928 Bacteria 5634
518 Ga0496125_0036515 3300048928 Bacteria 4288
519 Ga0496126_0005176 3300048929 Bacteria 15077
520 Ga0496126_0005612 3300048929 Bacteria 14267
521 Ga0496126_0092616 3300048929 Bacteria 2655
522 Ga0495678_021657 3300049459 Bacteria 2826
523 Ga0495682_0000234 3300049460 Bacteria 43711
524 Ga0501033_0140251 3300049570 Bacteria 1748
525 Ga0501036_0113813 3300049572 Bacteria 2286
526 Ga0501038_0071930 3300049574 Bacteria 2932
527 Ga0501042_0022237 3300049578 Bacteria 4430
528 Ga0501046_0048746 3300049580 Bacteria 3353
529 Ga0501048_0117177 3300049582 Bacteria 1881
530 Ga0501068_0125863 3300049584 Bacteria 1600
531 Ga0501070_0087678 3300049586 Bacteria 2576
532 Ga0501071_0006469 3300049587 Bacteria 7603
533 Ga0501072_0009204 3300049588 Bacteria 7502
534 Ga0501073_0242638 3300049589 Bacteria 1244
535 Ga0501074_0081114 3300049590 Bacteria 2326
536 Ga0501076_0007362 3300049592 Bacteria 8008
537 Ga0501077_0024467 3300049593 Bacteria 3835
538 Ga0501079_0020373 3300049741 Bacteria 5068
539 Ga0501080_0187434 3300049742 Bacteria 1902
540 Ga0501081_0046870 3300049743 Bacteria 2972
541 Ga0501269_000526 3300049766 Bacteria 7696
542 Ga0501045_0013719 3300049824 Bacteria 5728
543 nmdc:mga00v17_103677_c1 3300050491 Bacteria 1798
544 nmdc:mga0yw44_18038_c1 3300050492 Bacteria 3857
545 nmdc:mga0k408_26218_c1 3300050493 Bacteria 3303
546 nmdc:mga0k408_68597_c1 3300050493 Bacteria 2069
547 nmdc:mga07m45_73054_c1 3300050496 Bacteria 1953
548 nmdc:mga05p37_863_c1 3300050507 Bacteria 34108
549 nmdc:mga09592_15927_c1 3300050508 Bacteria 6143
550 nmdc:mga09592_436_c1 3300050508 Bacteria 30720
551 nmdc:mga0qj67_1189_c1 3300050509 Bacteria 18042
552 nmdc:mga0qj67_3156_c1 3300050509 Bacteria 11863
553 nmdc:mga06r32_7419_c1 3300050510 Bacteria 9864
554 nmdc:mga08y16_132262_c1 3300050511 Bacteria 2594
555 nmdc:mga08y16_15204_c1 3300050511 Bacteria 8095
556 nmdc:mga08y16_156910_c1 3300050511 Bacteria 2365
557 nmdc:mga08y16_83618_c1 3300050511 Bacteria 3327
558 nmdc:mga0n895_427_c1 3300050512 Bacteria 28261
559 nmdc:mga0rr50_2839_c1 3300050513 Bacteria 9853
560 nmdc:mga0a205_1001_c1 3300050515 Bacteria 23411
561 Ga0500635_0000449 3300053080 Bacteria 11894
562 Ga0500643_000169 3300053087 Bacteria 64699
563 Ga0500608_000123 3300053122 Bacteria 32276
564 Ga0500618_000601 3300053125 Bacteria 22092
565 Ga0500618_013509 3300053125 Bacteria 2106
566 Ga0500559_0000954 3300053136 Bacteria 18188
567 Ga0500577_0000079 3300053142 Bacteria 22454
568 Ga0500604_0020364 3300053151 Bacteria 1867
569 Ga0500622_0003490 3300053156 Bacteria 10437
570 Ga0500645_010478 3300053730 Bacteria 3064
571 Ga0501082_0010412 3300060353 Bacteria 8005
572 Ga0501082_0023373 3300060353 Bacteria 5332
573 Ga0501082_0257624 3300060353 Bacteria 1518

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009092 Ga0105250_10009888 Ga0105250_100098885 329
2 3300014326 Ga0157380_10018593 Ga0157380_100185932 366
3 3300013104 Ga0157370_10065730 Ga0157370_100657302 369
4 3300048926 Ga0496123_0001590 Ga0496123_0001590_8741_10048 369
5 3300046474 Ga0495605_0017853 Ga0495605_0017853_728_1987 379
6 3300049589 Ga0501073_0242638 Ga0501073_0242638_24_1166 380
7 iso_pu_bacteria 2876808645 2876812346 380
8 3300031852 Ga0307410_10028059 Ga0307410_100280593 382
9 3300046558 Ga0495633_0000587 Ga0495633_0000587_177_1484 383
10 3300048928 Ga0496125_0019156 Ga0496125_0019156_3486_4793 383
11 3300013102 Ga0157371_10045904 Ga0157371_100459044 384
12 3300013105 Ga0157369_10028384 Ga0157369_100283845 384
13 3300005290 Ga0065712_10067802 Ga0065712_1006780216 385
14 3300009036 Ga0105244_10041777 Ga0105244_100417773 385
15 3300015262 Ga0182007_10000771 Ga0182007_100007718 385
16 3300009036 Ga0105244_10000181 Ga0105244_100001817 386
17 3300011119 Ga0105246_10024242 Ga0105246_100242423 386
18 3300025728 Ga0207655_1027492 Ga0207655_10274922 386
19 3300005353 Ga0070669_100001083 Ga0070669_10000108315 387
20 3300005834 Ga0068851_10000197 Ga0068851_1000019721 387
21 3300009011 Ga0105251_10001791 Ga0105251_100017913 387
22 3300009036 Ga0105244_10002479 Ga0105244_1000247912 387
23 3300013100 Ga0157373_10036326 Ga0157373_100363262 387
24 3300013102 Ga0157371_10031143 Ga0157371_100311434 387
25 3300013104 Ga0157370_10023529 Ga0157370_100235295 387
26 3300013105 Ga0157369_10004166 Ga0157369_1000416613 387
27 3300013308 Ga0157375_10000050 Ga0157375_1000005092 387
28 3300025321 Ga0207656_10061085 Ga0207656_100610852 387
29 3300025728 Ga0207655_1018389 Ga0207655_10183892 387
30 3300025735 Ga0207713_1001595 Ga0207713_100159511 387
31 3300025923 Ga0207681_10000690 Ga0207681_1000069015 387
32 3300025933 Ga0207706_10000935 Ga0207706_100009355 387
33 3300048927 Ga0496124_0015231 Ga0496124_0015231_5984_7270 387
34 3300005331 Ga0070670_100000155 Ga0070670_10000015531 388
35 3300009011 Ga0105251_10014963 Ga0105251_100149633 388
36 3300009036 Ga0105244_10058508 Ga0105244_100585082 388
37 3300025925 Ga0207650_10000373 Ga0207650_1000037314 388
38 3300046538 Ga0495609_0002721 Ga0495609_0002721_7739_9040 390
39 3300047469 Ga0495673_0004969 Ga0495673_0004969_458_1759 390
40 3300003751 Ga0055538_1000886 Ga0055538_10008867 391
41 3300003752 Ga0055539_1000794 Ga0055539_10007947 391
42 3300003756 Ga0055533_1001148 Ga0055533_10011487 391
43 3300003758 Ga0055532_1001240 Ga0055532_10012402 391
44 3300003759 Ga0055525_1001003 Ga0055525_10010037 391
45 3300003841 Ga0055541_1000846 Ga0055541_10008467 391
46 3300005288 Ga0065714_10004818 Ga0065714_100048186 391
47 3300009011 Ga0105251_10003271 Ga0105251_100032716 391
48 3300009092 Ga0105250_10000088 Ga0105250_1000008828 391
49 3300009148 Ga0105243_10176723 Ga0105243_101767232 391
50 3300011119 Ga0105246_10000174 Ga0105246_100001745 391
51 3300013100 Ga0157373_10002145 Ga0157373_1000214511 391
52 3300017792 Ga0163161_10002851 Ga0163161_100028519 391
53 3300017792 Ga0163161_10003420 Ga0163161_1000342012 391
54 3300025206 Ga0209435_103668 Ga0209435_1036682 391
55 3300025224 Ga0209784_100414 Ga0209784_1004147 391
56 3300025225 Ga0209566_100716 Ga0209566_1007167 391
57 3300025226 Ga0209674_100446 Ga0209674_1004467 391
58 3300025229 Ga0209147_100742 Ga0209147_1007422 391
59 3300025230 Ga0209563_100319 Ga0209563_1003197 391
60 3300025242 Ga0209258_100860 Ga0209258_1008602 391
61 3300025246 Ga0209646_1000543 Ga0209646_10005432 391
62 3300025253 Ga0209677_100627 Ga0209677_1006277 391
63 3300025711 Ga0207696_1000091 Ga0207696_1000091130 391
64 3300025735 Ga0207713_1000432 Ga0207713_10004325 391
65 3300025735 Ga0207713_1026716 Ga0207713_10267162 391
66 3300031731 Ga0307405_10000054 Ga0307405_1000005415 391
67 3300046453 Ga0495627_000530 Ga0495627_000530_8028_9320 391
68 3300046458 Ga0495591_000529 Ga0495591_000529_20663_21955 391
69 3300046501 Ga0495607_0008751 Ga0495607_0008751_3408_4700 391
70 3300046507 Ga0495606_0000725 Ga0495606_0000725_25963_27255 391
71 3300046512 Ga0495610_0001114 Ga0495610_0001114_10322_11614 391
72 3300046512 Ga0495610_0030819 Ga0495610_0030819_402_1694 391
73 3300046515 Ga0495620_0000224 Ga0495620_0000224_32616_33908 391
74 3300046519 Ga0495632_0000275 Ga0495632_0000275_20677_21969 391
75 3300046665 Ga0495661_0000698 Ga0495661_0000698_9665_10957 391
76 3300046665 Ga0495661_0000780 Ga0495661_0000780_21123_22415 391
77 3300046794 Ga0495589_0000490 Ga0495589_0000490_19364_20656 391
78 3300047446 Ga0495679_000226 Ga0495679_000226_11675_12970 391
79 3300047446 Ga0495679_010966 Ga0495679_010966_850_2142 391
80 3300047470 Ga0495681_0004774 Ga0495681_0004774_276_1568 391
81 3300048920 Ga0496117_0000597 Ga0496117_0000597_4260_5552 391
82 3300048920 Ga0496117_0073991 Ga0496117_0073991_223_1515 391
83 3300048921 Ga0496118_0014825 Ga0496118_0014825_2154_3446 391
84 3300048921 Ga0496118_0016520 Ga0496118_0016520_2331_3623 391
85 3300048923 Ga0496120_0007305 Ga0496120_0007305_6769_8061 391
86 3300048925 Ga0496122_0040668 Ga0496122_0040668_1864_3156 391
87 3300048926 Ga0496123_0037309 Ga0496123_0037309_818_2110 391
88 3300048927 Ga0496124_0001080 Ga0496124_0001080_6330_7622 391
89 3300048927 Ga0496124_0044863 Ga0496124_0044863_1523_2815 391
90 3300048928 Ga0496125_0000465 Ga0496125_0000465_20954_22246 391
91 3300048928 Ga0496125_0010799 Ga0496125_0010799_6621_7913 391
92 3300048928 Ga0496125_0023871 Ga0496125_0023871_1267_2559 391
93 3300048928 Ga0496125_0036515 Ga0496125_0036515_1688_2980 391
94 3300048929 Ga0496126_0005612 Ga0496126_0005612_9113_10405 391
95 3300035170 Ga0373943_0037106 Ga0373943_0037106_28_1206 392
96 3300035725 Ga0373947_0007862 Ga0373947_0007862_18_1196 392
97 3300046517 Ga0495630_0087358 Ga0495630_0087358_45_1229 392
98 3300046474 Ga0495605_0025507 Ga0495605_0025507_469_1761 393
99 3300046616 Ga0495668_0061189 Ga0495668_0061189_511_1803 393
100 3300046810 Ga0495660_0000072 Ga0495660_0000072_93120_94412 393
101 3300060353 Ga0501082_0010412 Ga0501082_0010412_2389_3702 394
102 iso_pu_bacteria 2886848708 2886854934 394
103 3300005327 Ga0070658_10016477 Ga0070658_100164774 395
104 3300025909 Ga0207705_10057204 Ga0207705_100572042 395
105 3300035090 Ga0373949_0020485 Ga0373949_0020485_208_1410 395
106 3300035725 Ga0373947_0164796 Ga0373947_0164796_232_1425 397
107 3300046539 Ga0495621_0012488 Ga0495621_0012488_861_2054 397
108 3300048905 Ga0496102_0089208 Ga0496102_0089208_363_1556 397
109 3300046694 Ga0495649_0007309 Ga0495649_0007309_5348_6559 400
110 3300049742 Ga0501080_0187434 Ga0501080_0187434_256_1791 400
111 3300046681 Ga0495647_0003356 Ga0495647_0003356_3415_4620 401
112 3300046683 Ga0495658_0035972 Ga0495658_0035972_535_1740 401
113 3300053087 Ga0500643_000169 Ga0500643_000169_43554_44765 401
114 3300025292 Ga0209676_1007332 Ga0209676_10073325 403
115 3300006353 Ga0075370_10139923 Ga0075370_101399231 406
116 3300032005 Ga0307411_10001564 Ga0307411_100015645 406
117 3300050496 nmdc:mga07m45_73054_c1 nmdc:mga07m45_73054_c1_412_1728 406
118 3300042876 Ga0451577_0181761 Ga0451577_0181761_610_1836 408
119 3300047323 Ga0495683_0001223 Ga0495683_0001223_16065_17357 408
120 3300005341 Ga0070691_10007419 Ga0070691_100074195 409
121 3300005347 Ga0070668_100026469 Ga0070668_1000264692 409
122 3300025918 Ga0207662_10033083 Ga0207662_100330832 409
123 3300025923 Ga0207681_10000883 Ga0207681_1000088314 409
124 3300025972 Ga0207668_10015582 Ga0207668_100155822 409
125 3300026075 Ga0207708_10004301 Ga0207708_100043015 409
126 3300005328 Ga0070676_10013640 Ga0070676_100136402 410
127 3300005345 Ga0070692_10025118 Ga0070692_100251182 410
128 3300005353 Ga0070669_100010755 Ga0070669_1000107553 410
129 3300005356 Ga0070674_100034832 Ga0070674_1000348323 410
130 3300005364 Ga0070673_100074412 Ga0070673_1000744122 410
131 3300005367 Ga0070667_100121522 Ga0070667_1001215222 410
132 3300005457 Ga0070662_100086660 Ga0070662_1000866602 410
133 3300005544 Ga0070686_100005320 Ga0070686_1000053205 410
134 3300005719 Ga0068861_100024260 Ga0068861_1000242602 410
135 3300005843 Ga0068860_100069151 Ga0068860_1000691512 410
136 3300005844 Ga0068862_100040741 Ga0068862_1000407415 410
137 3300006881 Ga0068865_100001035 Ga0068865_1000010355 410
138 3300009148 Ga0105243_10070754 Ga0105243_100707543 410
139 3300025907 Ga0207645_10003294 Ga0207645_100032946 410
140 3300025933 Ga0207706_10088459 Ga0207706_100884593 410
141 3300025937 Ga0207669_10005612 Ga0207669_100056122 410
142 3300025938 Ga0207704_10001205 Ga0207704_100012054 410
143 3300026089 Ga0207648_10026748 Ga0207648_100267483 410
144 3300026118 Ga0207675_100003701 Ga0207675_1000037016 410
145 3300026121 Ga0207683_10011402 Ga0207683_100114028 410
146 3300032004 Ga0307414_10011556 Ga0307414_100115563 411
147 3300048923 Ga0496120_0111207 Ga0496120_0111207_18_1253 411
148 3300053730 Ga0500645_010478 Ga0500645_010478_1672_2994 411
149 3300009093 Ga0105240_10009287 Ga0105240_100092876 412
150 3300025913 Ga0207695_10061489 Ga0207695_100614892 412
151 3300046492 Ga0495585_0001381 Ga0495585_0001381_12178_13491 412
152 3300046616 Ga0495668_0000008 Ga0495668_0000008_277549_278865 412
153 3300046665 Ga0495661_0000150 Ga0495661_0000150_37434_38747 412
154 3300049584 Ga0501068_0125863 Ga0501068_0125863_311_1549 412
155 iso_pu_bacteria 2879110137 2879118308 412
156 3300005456 Ga0070678_100013489 Ga0070678_1000134892 413
157 3300041411 Ga0439466_0053396 Ga0439466_0053396_36_1277 413
158 3300031911 Ga0307412_10060034 Ga0307412_100600342 414
159 3300031995 Ga0307409_100129374 Ga0307409_1001293742 414
160 3300046471 Ga0495650_0003122 Ga0495650_0003122_5183_6433 414
161 3300046472 Ga0495580_0001063 Ga0495580_0001063_16735_17979 414
162 3300046506 Ga0495583_0001527 Ga0495583_0001527_10897_12147 414
163 3300046512 Ga0495610_0008547 Ga0495610_0008547_2699_3949 414
164 3300046519 Ga0495632_0003902 Ga0495632_0003902_6082_7332 414
165 3300046520 Ga0495637_0005703 Ga0495637_0005703_4414_5664 414
166 3300046665 Ga0495661_0000193 Ga0495661_0000193_26394_27644 414
167 3300004625 Ga0055543_1005977 Ga0055543_10059772 415
168 3300005262 Ga0065165_1000059 Ga0065165_100005915 415
169 3300005842 Ga0068858_100002537 Ga0068858_10000253712 415
170 3300026035 Ga0207703_10026738 Ga0207703_100267383 415
171 3300048915 Ga0496112_0093879 Ga0496112_0093879_1158_2468 415
172 3300028666 Ga0265336_10000039 Ga0265336_1000003969 417
173 3300029957 Ga0265324_10000223 Ga0265324_1000022330 417
174 3300031239 Ga0265328_10002757 Ga0265328_100027573 417
175 3300042015 Ga0439462_0020776 Ga0439462_0020776_370_1689 417
176 3300060353 Ga0501082_0257624 Ga0501082_0257624_30_1325 417
177 iso_pu_bacteria 2928972540 2928975396 417
178 3300005343 Ga0070687_100039170 Ga0070687_1000391702 418
179 3300005367 Ga0070667_100040210 Ga0070667_1000402101 418
180 3300005616 Ga0068852_100029633 Ga0068852_1000296332 418
181 3300005842 Ga0068858_100014317 Ga0068858_1000143172 418
182 3300013308 Ga0157375_10056502 Ga0157375_100565023 418
183 3300014326 Ga0157380_10013364 Ga0157380_100133645 418
184 3300014968 Ga0157379_10002335 Ga0157379_100023353 418
185 3300025918 Ga0207662_10027596 Ga0207662_100275962 418
186 3300025940 Ga0207691_10040837 Ga0207691_100408373 418
187 3300025941 Ga0207711_10036064 Ga0207711_100360643 418
188 3300026035 Ga0207703_10047521 Ga0207703_100475213 418
189 3300026142 Ga0207698_10192873 Ga0207698_101928732 418
190 3300028381 Ga0268264_10097899 Ga0268264_100978992 418
191 3300042139 Ga0450904_000412 Ga0450904_000412_3578_4900 418
192 3300046512 Ga0495610_0000021 Ga0495610_0000021_215680_217020 418
193 3300046660 Ga0495625_0035111 Ga0495625_0035111_464_1804 418
194 3300046500 Ga0495596_0002737 Ga0495596_0002737_4291_5589 419
195 3300046519 Ga0495632_0062559 Ga0495632_0062559_240_1583 419
196 3300048091 Ga0495626_0000796 Ga0495626_0000796_17772_19070 419
197 3300031824 Ga0307413_10054238 Ga0307413_100542383 420
198 3300031852 Ga0307410_10152065 Ga0307410_101520652 420
199 3300039447 Ga0436361_0303811 Ga0436361_0303811_688_2022 420
200 3300046460 Ga0495638_0001443 Ga0495638_0001443_10383_11711 420
201 3300048913 Ga0496110_0197765 Ga0496110_0197765_274_1542 420
202 3300048927 Ga0496124_0158316 Ga0496124_0158316_409_1677 420
203 3300050493 nmdc:mga0k408_26218_c1 nmdc:mga0k408_26218_c1_1105_2448 420
204 iso_pu_bacteria 2643221614 2644085854 420
205 iso_pu_bacteria 2643221661 2644344970 420
206 iso_pu_bacteria 2643221666 2644369244 420
207 3300013104 Ga0157370_10009550 Ga0157370_1000955011 421
208 3300025925 Ga0207650_10009278 Ga0207650_100092787 421
209 iso_pu_bacteria 2842805378 2842807655 421
210 3300005355 Ga0070671_100110412 Ga0070671_1001104121 422
211 3300005618 Ga0068864_100027732 Ga0068864_1000277322 422
212 3300005841 Ga0068863_100007312 Ga0068863_10000731210 422
213 3300005843 Ga0068860_100026094 Ga0068860_1000260944 422
214 3300006880 Ga0075429_100000296 Ga0075429_10000029618 422
215 3300010375 Ga0105239_10008186 Ga0105239_100081866 422
216 3300013308 Ga0157375_10267250 Ga0157375_102672502 422
217 3300014968 Ga0157379_10034552 Ga0157379_100345526 422
218 3300015261 Ga0182006_1000116 Ga0182006_100011653 422
219 3300015265 Ga0182005_1000003 Ga0182005_1000003178 422
220 3300025931 Ga0207644_10177020 Ga0207644_101770201 422
221 3300026035 Ga0207703_10229393 Ga0207703_102293932 422
222 3300026088 Ga0207641_10032348 Ga0207641_100323482 422
223 3300026095 Ga0207676_10025509 Ga0207676_100255093 422
224 3300037471 Ga0395905_0081841 Ga0395905_0081841_1427_2734 422
225 3300050508 nmdc:mga09592_436_c1 nmdc:mga09592_436_c1_12168_13493 422
226 3300050509 nmdc:mga0qj67_3156_c1 nmdc:mga0qj67_3156_c1_3716_5041 422
227 3300005336 Ga0070680_100007963 Ga0070680_1000079632 423
228 3300005337 Ga0070682_100046482 Ga0070682_1000464821 423
229 3300005340 Ga0070689_100035468 Ga0070689_1000354682 423
230 3300005341 Ga0070691_10002047 Ga0070691_100020474 423
231 3300005343 Ga0070687_100000955 Ga0070687_10000095510 423
232 3300005438 Ga0070701_10002657 Ga0070701_100026577 423
233 3300005444 Ga0070694_100007042 Ga0070694_1000070428 423
234 3300005458 Ga0070681_10105664 Ga0070681_101056643 423
235 3300005546 Ga0070696_100000013 Ga0070696_1000000139 423
236 3300005844 Ga0068862_100043353 Ga0068862_1000433532 423
237 3300006237 Ga0097621_100003933 Ga0097621_1000039332 423
238 3300009176 Ga0105242_10003223 Ga0105242_100032238 423
239 3300025909 Ga0207705_10022392 Ga0207705_100223921 423
240 3300025918 Ga0207662_10002300 Ga0207662_100023005 423
241 3300025934 Ga0207686_10003655 Ga0207686_100036553 423
242 3300025935 Ga0207709_10006905 Ga0207709_100069057 423
243 3300025936 Ga0207670_10007157 Ga0207670_100071573 423
244 3300025940 Ga0207691_10152739 Ga0207691_101527391 423
245 3300025942 Ga0207689_10001368 Ga0207689_1000136827 423
246 3300026075 Ga0207708_10000114 Ga0207708_1000011416 423
247 3300026088 Ga0207641_10220374 Ga0207641_102203741 423
248 3300026118 Ga0207675_100009061 Ga0207675_1000090612 423
249 3300035115 Ga0373941_0019456 Ga0373941_0019456_10_1293 423
250 3300045051 Ga0451576_0000220 Ga0451576_0000220_53965_55248 423
251 3300045051 Ga0451576_0011312 Ga0451576_0011312_2462_3745 423
252 3300047472 Ga0495686_0001396 Ga0495686_0001396_6475_7767 423
253 3300050491 nmdc:mga00v17_103677_c1 nmdc:mga00v17_103677_c1_72_1355 423
254 3300050492 nmdc:mga0yw44_18038_c1 nmdc:mga0yw44_18038_c1_91_1374 423
255 3300005262 Ga0065165_1000598 Ga0065165_100059816 424
256 3300005844 Ga0068862_100031145 Ga0068862_1000311456 424
257 3300006038 Ga0075365_10199719 Ga0075365_101997191 424
258 3300006051 Ga0075364_10016895 Ga0075364_100168953 424
259 3300006946 Ga0079104_1017736 Ga0079104_10177361 424
260 3300014326 Ga0157380_10002683 Ga0157380_100026836 424
261 3300026067 Ga0207678_10132975 Ga0207678_101329753 424
262 3300026089 Ga0207648_10073941 Ga0207648_100739412 424
263 3300027111 Ga0209281_1007615 Ga0209281_10076152 424
264 3300028380 Ga0268265_10128985 Ga0268265_101289852 424
265 3300032004 Ga0307414_10061929 Ga0307414_100619292 424
266 3300046460 Ga0495638_0003221 Ga0495638_0003221_7102_8448 424
267 3300005329 Ga0070683_100042465 Ga0070683_1000424653 425
268 3300005339 Ga0070660_100006633 Ga0070660_1000066332 425
269 3300005435 Ga0070714_100005978 Ga0070714_1000059782 425
270 3300025919 Ga0207657_10010663 Ga0207657_100106639 425
271 3300025929 Ga0207664_10015167 Ga0207664_100151672 425
272 3300025932 Ga0207690_10003250 Ga0207690_100032508 425
273 3300048924 Ga0496121_0028522 Ga0496121_0028522_2283_3563 425
274 iso_pu_bacteria 639633007 639787302 425
275 3300046460 Ga0495638_0091408 Ga0495638_0091408_281_1639 426
276 3300009092 Ga0105250_10000261 Ga0105250_100002617 427
277 3300009147 Ga0114129_10189357 Ga0114129_101893572 427
278 3300013100 Ga0157373_10006136 Ga0157373_100061368 427
279 3300013105 Ga0157369_10207891 Ga0157369_102078911 427
280 3300014745 Ga0157377_10025602 Ga0157377_100256022 427
281 3300025908 Ga0207643_10046800 Ga0207643_100468002 427
282 3300039447 Ga0436361_1035230 Ga0436361_1035230_2339_3694 427
283 3300046810 Ga0495660_0044433 Ga0495660_0044433_466_1749 427
284 3300047470 Ga0495681_0059744 Ga0495681_0059744_467_1750 427
285 3300003215 JGI25153J46596_10028772 JGI25153J46596_100287722 428
286 3300003771 Ga0055526_1000052 Ga0055526_1000052109 428
287 3300009036 Ga0105244_10002140 Ga0105244_1000214012 428
288 3300025245 Ga0207425_1000346 Ga0207425_100034610 428
289 3300025295 Ga0209564_1000026 Ga0209564_1000026258 428
290 3300025297 Ga0209758_1000314 Ga0209758_100031410 428
291 3300025728 Ga0207655_1003222 Ga0207655_100322212 428
292 3300046501 Ga0495607_0010963 Ga0495607_0010963_2396_3706 428
293 3300046507 Ga0495606_0004441 Ga0495606_0004441_2625_3941 428
294 3300053125 Ga0500618_000601 Ga0500618_000601_18635_19972 428
295 3300002987 JGI25159J45721_1003747 JGI25159J45721_10037476 429
296 3300005262 Ga0065165_1000099 Ga0065165_100009949 429
297 3300005615 Ga0070702_100090282 Ga0070702_1000902822 429
298 3300046460 Ga0495638_0011834 Ga0495638_0011834_614_1912 429
299 3300046491 Ga0495584_0000875 Ga0495584_0000875_6291_7589 429
300 3300046506 Ga0495583_0005777 Ga0495583_0005777_4803_6101 429
301 3300046616 Ga0495668_0012451 Ga0495668_0012451_105_1403 429
302 3300046660 Ga0495625_0002093 Ga0495625_0002093_767_2065 429
303 3300046664 Ga0495659_0003719 Ga0495659_0003719_566_1864 429
304 3300046665 Ga0495661_0003350 Ga0495661_0003350_6697_7995 429
305 3300046684 Ga0495669_0002301 Ga0495669_0002301_5129_6427 429
306 3300046694 Ga0495649_0003451 Ga0495649_0003451_9151_10449 429
307 3300046810 Ga0495660_0047438 Ga0495660_0047438_429_1727 429
308 3300047318 Ga0495636_0006614 Ga0495636_0006614_665_1963 429
309 3300047443 Ga0495687_014395 Ga0495687_014395_312_1610 429
310 3300047447 Ga0495685_007440 Ga0495685_007440_1803_3101 429
311 3300053080 Ga0500635_0000449 Ga0500635_0000449_1551_2861 429
312 3300005336 Ga0070680_100183242 Ga0070680_1001832421 430
313 3300005345 Ga0070692_10001360 Ga0070692_100013608 430
314 3300005347 Ga0070668_100024477 Ga0070668_1000244773 430
315 3300005353 Ga0070669_100026167 Ga0070669_1000261672 430
316 3300005441 Ga0070700_100001557 Ga0070700_10000155712 430
317 3300005459 Ga0068867_100131378 Ga0068867_1001313782 430
318 3300005466 Ga0070685_10004412 Ga0070685_100044124 430
319 3300005719 Ga0068861_100002744 Ga0068861_1000027449 430
320 3300005844 Ga0068862_100001151 Ga0068862_10000115117 430
321 3300006846 Ga0075430_100003367 Ga0075430_10000336715 430
322 3300009094 Ga0111539_10172607 Ga0111539_101726072 430
323 3300009148 Ga0105243_10020789 Ga0105243_100207894 430
324 3300009551 Ga0105238_10142860 Ga0105238_101428602 430
325 3300013296 Ga0157374_10004803 Ga0157374_100048035 430
326 3300025899 Ga0207642_10030927 Ga0207642_100309272 430
327 3300025917 Ga0207660_10013510 Ga0207660_100135105 430
328 3300025923 Ga0207681_10045876 Ga0207681_100458762 430
329 3300025933 Ga0207706_10119314 Ga0207706_101193142 430
330 3300025935 Ga0207709_10013101 Ga0207709_100131014 430
331 3300025937 Ga0207669_10013934 Ga0207669_100139343 430
332 3300025972 Ga0207668_10018685 Ga0207668_100186853 430
333 3300026075 Ga0207708_10003529 Ga0207708_100035293 430
334 3300026089 Ga0207648_10001471 Ga0207648_1000147119 430
335 3300026118 Ga0207675_100003064 Ga0207675_1000030643 430
336 3300027907 Ga0207428_10119781 Ga0207428_101197812 430
337 3300028380 Ga0268265_10000621 Ga0268265_1000062141 430
338 3300031852 Ga0307410_10187076 Ga0307410_101870762 430
339 3300031901 Ga0307406_10083892 Ga0307406_100838921 430
340 3300031995 Ga0307409_100011300 Ga0307409_1000113004 430
341 3300031995 Ga0307409_100238299 Ga0307409_1002382991 430
342 3300042117 Ga0450913_000144 Ga0450913_000144_387_1700 430
343 3300047320 Ga0495672_0000014 Ga0495672_0000014_204517_205911 430
344 3300050511 nmdc:mga08y16_132262_c1 nmdc:mga08y16_132262_c1_784_2091 430
345 3300053151 Ga0500604_0020364 Ga0500604_0020364_189_1481 430
346 iso_pu_bacteria 2643221577 2643894702 430
347 iso_pu_bacteria 2643221685 2644476851 430
348 iso_pu_bacteria 2857564685 2857566204 430
349 3300021361 Ga0213872_10001285 Ga0213872_100012853 431
350 3300032002 Ga0307416_100110227 Ga0307416_1001102272 431
351 3300039447 Ga0436361_0165235 Ga0436361_0165235_3532_4869 431
352 3300046471 Ga0495650_0002849 Ga0495650_0002849_6922_8256 431
353 3300046520 Ga0495637_0000057 Ga0495637_0000057_7207_8541 431
354 3300046530 Ga0495654_0000005 Ga0495654_0000005_184992_186326 431
355 3300047469 Ga0495673_0000033 Ga0495673_0000033_199344_200669 431
356 3300048929 Ga0496126_0005176 Ga0496126_0005176_3301_4626 431
357 3300003775 Ga0055524_1012896 Ga0055524_10128963 432
358 3300003794 Ga0055531_10004923 Ga0055531_100049237 432
359 3300005614 Ga0068856_100120658 Ga0068856_1001206582 432
360 3300013296 Ga0157374_10000958 Ga0157374_1000095811 432
361 3300025298 Ga0209050_1002726 Ga0209050_10027263 432
362 3300025299 Ga0209256_1001776 Ga0209256_10017763 432
363 3300025303 Ga0209051_1001190 Ga0209051_100119016 432
364 3300025304 Ga0209257_1002005 Ga0209257_100200514 432
365 3300031456 Ga0307513_10000066 Ga0307513_1000006690 432
366 3300044694 Ga0466963_0113030 Ga0466963_0113030_140_1585 432
367 3300048929 Ga0496126_0092616 Ga0496126_0092616_1259_2581 432
368 3300049460 Ga0495682_0000234 Ga0495682_0000234_9621_10925 432
369 3300053122 Ga0500608_000123 Ga0500608_000123_328_1650 432
370 iso_pu_bacteria 2838074704 2838077047 432
371 iso_pu_bacteria 2896384573 2896385849 432
372 iso_pu_bacteria 2920760137 2920761782 432
373 3300005262 Ga0065165_1000378 Ga0065165_10003787 433
374 3300009093 Ga0105240_10191888 Ga0105240_101918882 433
375 3300025256 Ga0209759_1004314 Ga0209759_10043146 433
376 3300025909 Ga0207705_10023899 Ga0207705_100238995 433
377 3300025913 Ga0207695_10135915 Ga0207695_101359152 433
378 3300025986 Ga0207658_10023813 Ga0207658_100238134 433
379 3300037471 Ga0395905_0019451 Ga0395905_0019451_4149_5477 433
380 3300039453 Ga0436362_0866046 Ga0436362_0866046_882_2210 433
381 3300046615 Ga0495656_0000940 Ga0495656_0000940_2572_3909 433
382 3300047472 Ga0495686_0032698 Ga0495686_0032698_2010_3350 433
383 3300049766 Ga0501269_000526 Ga0501269_000526_4556_5980 433
384 3300005343 Ga0070687_100034798 Ga0070687_1000347981 434
385 3300005343 Ga0070687_100053725 Ga0070687_1000537252 434
386 3300005366 Ga0070659_100010688 Ga0070659_1000106883 434
387 3300005563 Ga0068855_100155441 Ga0068855_1001554412 434
388 3300009011 Ga0105251_10002666 Ga0105251_100026668 434
389 3300009011 Ga0105251_10013975 Ga0105251_100139753 434
390 3300009036 Ga0105244_10029049 Ga0105244_100290492 434
391 3300009148 Ga0105243_10019654 Ga0105243_100196544 434
392 3300014968 Ga0157379_10082432 Ga0157379_100824322 434
393 3300025728 Ga0207655_1000113 Ga0207655_1000113131 434
394 3300025728 Ga0207655_1021767 Ga0207655_10217673 434
395 3300025919 Ga0207657_10008770 Ga0207657_100087705 434
396 3300025935 Ga0207709_10034258 Ga0207709_100342582 434
397 3300046453 Ga0495627_000888 Ga0495627_000888_8202_9518 434
398 3300046463 Ga0495653_0009457 Ga0495653_0009457_5661_6974 434
399 3300046507 Ga0495606_0009506 Ga0495606_0009506_822_2135 434
400 3300046518 Ga0495631_0006268 Ga0495631_0006268_710_2026 434
401 3300046519 Ga0495632_0006116 Ga0495632_0006116_5914_7230 434
402 3300046519 Ga0495632_0008775 Ga0495632_0008775_10_1326 434
403 3300046520 Ga0495637_0038642 Ga0495637_0038642_597_1910 434
404 3300046530 Ga0495654_0001418 Ga0495654_0001418_5763_7079 434
405 3300046692 Ga0495671_0002178 Ga0495671_0002178_3192_4508 434
406 3300047320 Ga0495672_0003595 Ga0495672_0003595_1581_2897 434
407 3300049459 Ga0495678_021657 Ga0495678_021657_793_2106 434
408 iso_pu_bacteria 2513237144 2513912122 434
409 iso_pu_bacteria 2513237146 2513924029 434
410 iso_pu_bacteria 2599185170 2599416073 434
411 iso_pu_bacteria 2838035591 2838036195 434
412 iso_pu_bacteria 2838661181 2838666466 434
413 iso_pu_bacteria 3005409236 3005413418 434
414 iso_pu_bacteria 3007419365 3007424613 434
415 3300005328 Ga0070676_10067197 Ga0070676_100671973 435
416 3300005337 Ga0070682_100027876 Ga0070682_1000278762 435
417 3300009148 Ga0105243_10057254 Ga0105243_100572543 435
418 3300009148 Ga0105243_10123536 Ga0105243_101235363 435
419 3300017792 Ga0163161_10082863 Ga0163161_100828633 435
420 3300025907 Ga0207645_10076298 Ga0207645_100762981 435
421 3300025935 Ga0207709_10022219 Ga0207709_100222193 435
422 3300026041 Ga0207639_10022982 Ga0207639_100229823 435
423 3300031456 Ga0307513_10019665 Ga0307513_100196656 435
424 3300031730 Ga0307516_10029384 Ga0307516_100293846 435
425 3300042125 Ga0450923_003832 Ga0450923_003832_514_1857 435
426 3300042156 Ga0439446_0008790 Ga0439446_0008790_689_2032 435
427 3300042156 Ga0439446_0018222 Ga0439446_0018222_449_1774 435
428 3300042435 Ga0439434_0004984 Ga0439434_0004984_2236_3579 435
429 3300042531 Ga0450918_003841 Ga0450918_003841_676_2001 435
430 3300046460 Ga0495638_0005791 Ga0495638_0005791_196_1521 435
431 3300046501 Ga0495607_0002057 Ga0495607_0002057_1014_2330 435
432 3300046539 Ga0495621_0003116 Ga0495621_0003116_2998_4482 435
433 3300046660 Ga0495625_0006426 Ga0495625_0006426_1651_2976 435
434 3300046694 Ga0495649_0001376 Ga0495649_0001376_16156_17472 435
435 3300047321 Ga0495676_0001551 Ga0495676_0001551_16780_18096 435
436 3300050493 nmdc:mga0k408_68597_c1 nmdc:mga0k408_68597_c1_90_1418 435
437 3300053125 Ga0500618_013509 Ga0500618_013509_592_2040 435
438 iso_pu_bacteria 2597489887 2597859534 435
439 3300005336 Ga0070680_100162156 Ga0070680_1001621562 436
440 3300005530 Ga0070679_100109683 Ga0070679_1001096832 436
441 3300013100 Ga0157373_10014390 Ga0157373_100143902 436
442 3300013306 Ga0163162_10117349 Ga0163162_101173492 436
443 3300031616 Ga0307508_10117654 Ga0307508_101176541 436
444 3300047472 Ga0495686_0000075 Ga0495686_0000075_34978_36348 436
445 3300049570 Ga0501033_0140251 Ga0501033_0140251_84_1412 436
446 3300049572 Ga0501036_0113813 Ga0501036_0113813_739_2067 436
447 3300049574 Ga0501038_0071930 Ga0501038_0071930_1525_2853 436
448 3300049578 Ga0501042_0022237 Ga0501042_0022237_2851_4179 436
449 3300049580 Ga0501046_0048746 Ga0501046_0048746_1509_2837 436
450 3300049582 Ga0501048_0117177 Ga0501048_0117177_371_1699 436
451 3300049586 Ga0501070_0087678 Ga0501070_0087678_60_1388 436
452 3300049587 Ga0501071_0006469 Ga0501071_0006469_3361_4689 436
453 3300049588 Ga0501072_0009204 Ga0501072_0009204_861_2189 436
454 3300049590 Ga0501074_0081114 Ga0501074_0081114_433_1761 436
455 3300049592 Ga0501076_0007362 Ga0501076_0007362_4313_5641 436
456 3300049593 Ga0501077_0024467 Ga0501077_0024467_1542_2870 436
457 3300049741 Ga0501079_0020373 Ga0501079_0020373_3714_5042 436
458 3300049743 Ga0501081_0046870 Ga0501081_0046870_381_1709 436
459 3300049824 Ga0501045_0013719 Ga0501045_0013719_100_1428 436
460 3300060353 Ga0501082_0023373 Ga0501082_0023373_462_1790 436
461 iso_pu_bacteria 2643221570 2643865711 436
462 iso_pu_bacteria 2643221652 2644294411 436
463 3300003659 JGI25404J52841_10006004 JGI25404J52841_100060042 437
464 3300003775 Ga0055524_1000117 Ga0055524_100011723 437
465 3300003794 Ga0055531_10005573 Ga0055531_100055739 437
466 3300005548 Ga0070665_100124454 Ga0070665_1001244543 437
467 3300005983 Ga0081540_1000663 Ga0081540_100066353 437
468 3300009174 Ga0105241_10000171 Ga0105241_1000017129 437
469 3300012475 Ga0157317_1000800 Ga0157317_10008001 437
470 3300012497 Ga0157319_1000024 Ga0157319_100002437 437
471 3300025299 Ga0209256_1000075 Ga0209256_100007560 437
472 3300025304 Ga0209257_1000244 Ga0209257_100024451 437
473 3300025911 Ga0207654_10000134 Ga0207654_1000013430 437
474 3300031507 Ga0307509_10002265 Ga0307509_1000226524 437
475 3300033180 Ga0307510_10008623 Ga0307510_1000862312 437
476 3300042438 Ga0439459_0007697 Ga0439459_0007697_76_1497 437
477 3300046454 Ga0495592_0053899 Ga0495592_0053899_661_1983 437
478 3300053136 Ga0500559_0000954 Ga0500559_0000954_1076_2398 437
479 3300053156 Ga0500622_0003490 Ga0500622_0003490_1458_2780 437
480 3300005458 Ga0070681_10021034 Ga0070681_100210341 438
481 3300006058 Ga0075432_10001028 Ga0075432_100010286 438
482 3300006194 Ga0075427_10000673 Ga0075427_100006732 438
483 3300006846 Ga0075430_100000332 Ga0075430_10000033211 438
484 3300006847 Ga0075431_100008089 Ga0075431_1000080897 438
485 3300006871 Ga0075434_100000647 Ga0075434_10000064727 438
486 3300006880 Ga0075429_100000451 Ga0075429_10000045126 438
487 3300007076 Ga0075435_100000630 Ga0075435_1000006306 438
488 3300009094 Ga0111539_10002056 Ga0111539_100020563 438
489 3300009147 Ga0114129_10016414 Ga0114129_100164143 438
490 3300014497 Ga0182008_10032776 Ga0182008_100327762 438
491 3300025295 Ga0209564_1000097 Ga0209564_100009776 438
492 3300025912 Ga0207707_10184056 Ga0207707_101840561 438
493 3300025921 Ga0207652_10212463 Ga0207652_102124632 438
494 3300027907 Ga0207428_10000180 Ga0207428_1000018060 438
495 3300050507 nmdc:mga05p37_863_c1 nmdc:mga05p37_863_c1_9609_10940 438
496 3300050508 nmdc:mga09592_15927_c1 nmdc:mga09592_15927_c1_4569_5900 438
497 3300050509 nmdc:mga0qj67_1189_c1 nmdc:mga0qj67_1189_c1_11248_12579 438
498 3300050510 nmdc:mga06r32_7419_c1 nmdc:mga06r32_7419_c1_2558_3889 438
499 3300050511 nmdc:mga08y16_83618_c1 nmdc:mga08y16_83618_c1_714_2045 438
500 3300050512 nmdc:mga0n895_427_c1 nmdc:mga0n895_427_c1_2539_3870 438
501 3300050513 nmdc:mga0rr50_2839_c1 nmdc:mga0rr50_2839_c1_5477_6808 438
502 3300050515 nmdc:mga0a205_1001_c1 nmdc:mga0a205_1001_c1_2436_3767 438
503 3300053142 Ga0500577_0000079 Ga0500577_0000079_14908_16248 438
504 iso_pu_bacteria 640427133 640487051 438
505 iso_pu_bacteria 651053060 651174924 438
506 3300005983 Ga0081540_1043087 Ga0081540_10430872 439
507 3300003322 rootL2_10000892 rootL2_1000089239 440
508 3300003323 rootH1_10019014 rootH1_100190146 440
509 3300005548 Ga0070665_100002087 Ga0070665_10000208712 440
510 3300025931 Ga0207644_10080072 Ga0207644_100800722 440
511 3300005564 Ga0070664_100000651 Ga0070664_10000065121 441
512 3300009093 Ga0105240_10142449 Ga0105240_101424493 441
513 3300009551 Ga0105238_10000865 Ga0105238_1000086522 441
514 3300050511 nmdc:mga08y16_15204_c1 nmdc:mga08y16_15204_c1_4097_5446 441
515 3300005331 Ga0070670_100008834 Ga0070670_1000088344 443
516 3300005364 Ga0070673_100025028 Ga0070673_1000250286 443
517 3300005543 Ga0070672_100096097 Ga0070672_1000960974 443
518 3300025940 Ga0207691_10063173 Ga0207691_100631734 443
519 3300025960 Ga0207651_10009135 Ga0207651_100091354 443
520 3300001991 JGI24743J22301_10011591 JGI24743J22301_100115912 444
521 3300005293 Ga0065715_10097283 Ga0065715_100972833 444
522 3300005331 Ga0070670_100030930 Ga0070670_1000309306 444
523 3300005331 Ga0070670_100127424 Ga0070670_1001274242 444
524 3300005335 Ga0070666_10010244 Ga0070666_100102443 444
525 3300005338 Ga0068868_100127726 Ga0068868_1001277261 444
526 3300005340 Ga0070689_100028511 Ga0070689_1000285112 444
527 3300005344 Ga0070661_100008546 Ga0070661_1000085467 444
528 3300005353 Ga0070669_100049063 Ga0070669_1000490633 444
529 3300005356 Ga0070674_100044169 Ga0070674_1000441692 444
530 3300005364 Ga0070673_100078360 Ga0070673_1000783602 444
531 3300005365 Ga0070688_100009644 Ga0070688_1000096446 444
532 3300005456 Ga0070678_100118045 Ga0070678_1001180452 444
533 3300005457 Ga0070662_100045607 Ga0070662_1000456074 444
534 3300005466 Ga0070685_10010094 Ga0070685_100100944 444
535 3300005535 Ga0070684_100012745 Ga0070684_1000127452 444
536 3300005535 Ga0070684_100102751 Ga0070684_1001027512 444
537 3300005544 Ga0070686_100046432 Ga0070686_1000464322 444
538 3300005548 Ga0070665_100041560 Ga0070665_1000415604 444
539 3300005563 Ga0068855_100139220 Ga0068855_1001392203 444
540 3300005577 Ga0068857_100013040 Ga0068857_1000130408 444
541 3300005615 Ga0070702_100068502 Ga0070702_1000685021 444
542 3300005618 Ga0068864_100011396 Ga0068864_1000113966 444
543 3300005718 Ga0068866_10009938 Ga0068866_100099384 444
544 3300005834 Ga0068851_10007001 Ga0068851_100070014 444
545 3300005840 Ga0068870_10013996 Ga0068870_100139961 444
546 3300005841 Ga0068863_100050649 Ga0068863_1000506494 444
547 3300005842 Ga0068858_100037191 Ga0068858_1000371912 444
548 3300005843 Ga0068860_100054358 Ga0068860_1000543585 444
549 3300006881 Ga0068865_100034470 Ga0068865_1000344702 444
550 3300009094 Ga0111539_10022347 Ga0111539_100223475 444
551 3300009553 Ga0105249_10037049 Ga0105249_100370493 444
552 3300013102 Ga0157371_10133262 Ga0157371_101332621 444
553 3300013296 Ga0157374_10051673 Ga0157374_100516734 444
554 3300014325 Ga0163163_10034762 Ga0163163_100347623 444
555 3300014968 Ga0157379_10010681 Ga0157379_100106814 444
556 3300017792 Ga0163161_10081985 Ga0163161_100819852 444
557 3300025315 Ga0207697_10003666 Ga0207697_100036666 444
558 3300025321 Ga0207656_10005798 Ga0207656_100057982 444
559 3300025893 Ga0207682_10000905 Ga0207682_1000090515 444
560 3300025901 Ga0207688_10000676 Ga0207688_100006764 444
561 3300025903 Ga0207680_10029668 Ga0207680_100296682 444
562 3300025907 Ga0207645_10000860 Ga0207645_100008604 444
563 3300025908 Ga0207643_10000205 Ga0207643_1000020510 444
564 3300025909 Ga0207705_10147410 Ga0207705_101474101 444
565 3300025918 Ga0207662_10002164 Ga0207662_100021646 444
566 3300025919 Ga0207657_10005467 Ga0207657_100054676 444
567 3300025923 Ga0207681_10076723 Ga0207681_100767232 444
568 3300025925 Ga0207650_10001078 Ga0207650_1000107810 444
569 3300025926 Ga0207659_10019339 Ga0207659_100193394 444
570 3300025931 Ga0207644_10054444 Ga0207644_100544443 444
571 3300025933 Ga0207706_10000618 Ga0207706_1000061821 444
572 3300025936 Ga0207670_10016919 Ga0207670_100169194 444
573 3300025938 Ga0207704_10046148 Ga0207704_100461483 444
574 3300025940 Ga0207691_10025775 Ga0207691_100257755 444
575 3300025941 Ga0207711_10105405 Ga0207711_101054052 444
576 3300025942 Ga0207689_10000451 Ga0207689_1000045116 444
577 3300025944 Ga0207661_10066704 Ga0207661_100667042 444
578 3300025960 Ga0207651_10073619 Ga0207651_100736191 444
579 3300025961 Ga0207712_10052028 Ga0207712_100520283 444
580 3300026035 Ga0207703_10062701 Ga0207703_100627012 444
581 3300026041 Ga0207639_10232614 Ga0207639_102326141 444
582 3300026075 Ga0207708_10000557 Ga0207708_1000055714 444
583 3300026088 Ga0207641_10112818 Ga0207641_101128184 444
584 3300026089 Ga0207648_10028967 Ga0207648_100289674 444
585 3300026095 Ga0207676_10025835 Ga0207676_100258352 444
586 3300026116 Ga0207674_10099881 Ga0207674_100998813 444
587 3300026118 Ga0207675_100001090 Ga0207675_10000109025 444
588 3300026142 Ga0207698_10035718 Ga0207698_100357184 444
589 3300026142 Ga0207698_10051297 Ga0207698_100512974 444
590 3300027907 Ga0207428_10063229 Ga0207428_100632293 444
591 3300028379 Ga0268266_10069528 Ga0268266_100695282 444
592 3300035089 Ga0373944_0019089 Ga0373944_0019089_564_1913 444
593 3300035170 Ga0373943_0023996 Ga0373943_0023996_823_2172 444
594 3300048907 Ga0496104_0015068 Ga0496104_0015068_473_1822 444
595 3300048908 Ga0496105_0007157 Ga0496105_0007157_5200_6549 444
596 3300048909 Ga0496106_0032321 Ga0496106_0032321_732_2081 444
597 3300048911 Ga0496108_0013198 Ga0496108_0013198_4534_5883 444
598 3300048912 Ga0496109_0012841 Ga0496109_0012841_1756_3105 444
599 3300048913 Ga0496110_0006943 Ga0496110_0006943_793_2142 444
600 3300050511 nmdc:mga08y16_156910_c1 nmdc:mga08y16_156910_c1_745_2094 444

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23500

26

226

0.77

PF07995

GSDH

Glucose / Sorbosone dehydrogenase

131

325

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7694 66 435
3a9h-assembly1.cif.gz_A crystal structure of pqq-dependent sugar dehydrogenase holo-form 0.7608 66 435
5v36-assembly1.cif.gz_A 1.88 angstrom resolution crystal structure of glutathione reductase from streptococcus mutans ua159 in complex with fad 0.76 402 431
7cgz-assembly1.cif.gz_A glucose dehydrogenase 0.7573 68 430
6i1t-assembly1.cif.gz_A calcium structure of trichoderma reesei carbohydrate-active enzymes family aa12 0.7555 47 434
ID Description Score Start End Superfamily
6n7fA02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.767 402 431 3.50.50.60
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7574 66 435 2.120.10.30
3a9gA00 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.749 66 435 2.120.10.30
af_P98164_2374_2695_2.120.10.30 Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain 0.7436 78 409 2.120.10.30
af_Q8TED0_158_333_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.734 70 275 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A350CV99-F1-model_v4 Sorbosone dehydrogenase 0.9918 252 434
AF-A0A257WQ46-F1-model_v4 deleted 0.991 325 432
AF-A0A2R7L948-F1-model_v4 deleted 0.9908 40 434
AF-A0A2A3CKE1-F1-model_v4 deleted 0.9898 339 434
AF-A0A0J6S040-F1-model_v4 L-sorbosone dehydrogenase 0.9895 261 430

Feature Viewer

pLDDT pTM Quality
87.54 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map