F468024
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 600 | 362 | 573 | 431 |
Family's Representative Sequence
| Representative Sequence | 3300049742|Ga0501080_0187434|Ga0501080_0187434_256_1791 |
| Length | 480 |
| Sequence | MIPTVNVAPATGWPTGTTPVAAAGLEVAAFASGLEHPRWLYVLPNGDVLVAESNRPPAPEGSAGGGLKKWVMKRMMARAGAGVASANRITLLRDADGDGVAETRSVFLQDLNSPFGMALIGNAFYVANADAIVRFPYTAGATTMDSGAGVKVVDLPAGINHHWTKNLLASRDGTRLYATVGSNSNIAEKGMAAEEGRAAIWEIDPKAGTKRLFAAGLRNPNGLAWEPRTGALWTVVNERDELGSDLVPDYLTSVVDGGFYGWPYSYWGQNVDERVQPQQPDLVAKAIKPDYALGAHVAPLGLTTSEGAASLPSTYSSGMFVGQHGSWNRRPLSGYSVVFVPFRDGKPSDMPAEILTGFVNSDGEAHGRPVGVAIDKRGALLVADDVGNTIWRVASAAQSGQRSDRPGERTSSDARGRPAKLLLAALSVALADAVAADEEIRPQDRPAAFRELDVDGDGWISVVALNRSDQPGKFRNPDQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 2 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 3 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 4 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 5 | 2643221570 | Acidovorax sp. Root568 | Isolate | Unclassified |
| 6 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 7 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 8 | 2643221652 | Acidovorax sp. Root402 | Isolate | Unclassified |
| 9 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 10 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 11 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 12 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 13 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 14 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 15 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 16 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 17 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 18 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 19 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 20 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 21 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 22 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 23 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 24 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 25 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 26 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 27 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 28 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 29 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 30 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 31 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 34 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 35 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 37 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 40 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 42 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 44 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 53 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 55 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 65 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 74 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 75 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 93 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 94 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 95 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 96 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 99 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 100 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 101 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 104 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 107 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 108 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 109 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 125 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 126 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 136 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 139 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 140 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 141 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 143 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 151 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 152 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 156 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 212 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 213 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 219 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 220 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 223 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 224 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 225 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 229 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 230 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 231 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 232 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 240 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 241 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 242 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 243 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 244 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 245 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 246 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 247 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 248 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 249 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 250 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 253 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 302 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 303 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 304 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 309 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 310 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 311 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 312 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 313 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 314 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 315 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 316 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 317 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 337 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 339 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 340 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 341 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 342 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 351 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 352 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 353 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 354 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 355 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 356 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 357 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 358 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 359 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 361 | 640427133 | Stutzerimonas stutzeri A1501 | Isolate | Rhizosphere |
| 362 | 651053060 | Stutzerimonas stutzeri CMT.A.9 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.5 |
| Metatranscriptomes | 0 |
| Isolates | 4.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9 |
| Nodule | 1.33 |
| Rhizoplane | 1.5 |
| Rhizosphere | 80.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10011591 | 3300001991 | Bacteria | 1591 |
| 2 | JGI25159J45721_1003747 | 3300002987 | Bacteria | 5262 |
| 3 | JGI25153J46596_10028772 | 3300003215 | Bacteria | 1921 |
| 4 | rootL2_10000892 | 3300003322 | Bacteria | 46839 |
| 5 | rootH1_10019014 | 3300003323 | Bacteria | 8773 |
| 6 | JGI25404J52841_10006004 | 3300003659 | Bacteria | 2526 |
| 7 | Ga0055538_1000886 | 3300003751 | Bacteria | 7512 |
| 8 | Ga0055539_1000794 | 3300003752 | Bacteria | 7512 |
| 9 | Ga0055533_1001148 | 3300003756 | Bacteria | 7512 |
| 10 | Ga0055532_1001240 | 3300003758 | Bacteria | 7508 |
| 11 | Ga0055525_1001003 | 3300003759 | Bacteria | 7512 |
| 12 | Ga0055526_1000052 | 3300003771 | Bacteria | 116035 |
| 13 | Ga0055524_1000117 | 3300003775 | Bacteria | 93643 |
| 14 | Ga0055524_1012896 | 3300003775 | Bacteria | 3184 |
| 15 | Ga0055531_10004923 | 3300003794 | Bacteria | 7940 |
| 16 | Ga0055531_10005573 | 3300003794 | Bacteria | 7344 |
| 17 | Ga0055541_1000846 | 3300003841 | Bacteria | 7512 |
| 18 | Ga0055543_1005977 | 3300004625 | Bacteria | 3021 |
| 19 | Ga0065165_1000059 | 3300005262 | Bacteria | 182314 |
| 20 | Ga0065165_1000099 | 3300005262 | Bacteria | 142245 |
| 21 | Ga0065165_1000378 | 3300005262 | Bacteria | 72655 |
| 22 | Ga0065165_1000598 | 3300005262 | Bacteria | 52772 |
| 23 | Ga0065714_10004818 | 3300005288 | Bacteria | 4585 |
| 24 | Ga0065712_10067802 | 3300005290 | Bacteria | 31985 |
| 25 | Ga0065715_10097283 | 3300005293 | Bacteria | 3731 |
| 26 | Ga0070658_10016477 | 3300005327 | Bacteria | 5915 |
| 27 | Ga0070676_10013640 | 3300005328 | Bacteria | 4456 |
| 28 | Ga0070676_10067197 | 3300005328 | Bacteria | 2143 |
| 29 | Ga0070683_100042465 | 3300005329 | Bacteria | 4187 |
| 30 | Ga0070670_100000155 | 3300005331 | Bacteria | 62949 |
| 31 | Ga0070670_100008834 | 3300005331 | Bacteria | 8601 |
| 32 | Ga0070670_100030930 | 3300005331 | Bacteria | 4611 |
| 33 | Ga0070670_100127424 | 3300005331 | Bacteria | 2197 |
| 34 | Ga0070666_10010244 | 3300005335 | Bacteria | 5858 |
| 35 | Ga0070680_100007963 | 3300005336 | Bacteria | 8089 |
| 36 | Ga0070680_100162156 | 3300005336 | Bacteria | 1879 |
| 37 | Ga0070680_100183242 | 3300005336 | Bacteria | 1764 |
| 38 | Ga0070682_100027876 | 3300005337 | Bacteria | 3392 |
| 39 | Ga0070682_100046482 | 3300005337 | Bacteria | 2694 |
| 40 | Ga0068868_100127726 | 3300005338 | Bacteria | 2078 |
| 41 | Ga0070660_100006633 | 3300005339 | Bacteria | 8030 |
| 42 | Ga0070689_100028511 | 3300005340 | Bacteria | 4220 |
| 43 | Ga0070689_100035468 | 3300005340 | Bacteria | 3811 |
| 44 | Ga0070691_10002047 | 3300005341 | Bacteria | 8897 |
| 45 | Ga0070691_10007419 | 3300005341 | Bacteria | 5024 |
| 46 | Ga0070687_100000955 | 3300005343 | Bacteria | 9832 |
| 47 | Ga0070687_100034798 | 3300005343 | Bacteria | 2496 |
| 48 | Ga0070687_100039170 | 3300005343 | Bacteria | 2380 |
| 49 | Ga0070687_100053725 | 3300005343 | Bacteria | 2096 |
| 50 | Ga0070661_100008546 | 3300005344 | Bacteria | 7080 |
| 51 | Ga0070692_10001360 | 3300005345 | Bacteria | 8818 |
| 52 | Ga0070692_10025118 | 3300005345 | Bacteria | 2935 |
| 53 | Ga0070668_100024477 | 3300005347 | Bacteria | 4576 |
| 54 | Ga0070668_100026469 | 3300005347 | Bacteria | 4402 |
| 55 | Ga0070669_100001083 | 3300005353 | Bacteria | 19929 |
| 56 | Ga0070669_100010755 | 3300005353 | Bacteria | 6495 |
| 57 | Ga0070669_100026167 | 3300005353 | Bacteria | 4197 |
| 58 | Ga0070669_100049063 | 3300005353 | Bacteria | 3082 |
| 59 | Ga0070671_100110412 | 3300005355 | Bacteria | 2310 |
| 60 | Ga0070674_100034832 | 3300005356 | Bacteria | 3366 |
| 61 | Ga0070674_100044169 | 3300005356 | Bacteria | 3036 |
| 62 | Ga0070673_100025028 | 3300005364 | Bacteria | 4386 |
| 63 | Ga0070673_100074412 | 3300005364 | Bacteria | 2737 |
| 64 | Ga0070673_100078360 | 3300005364 | Bacteria | 2673 |
| 65 | Ga0070688_100009644 | 3300005365 | Bacteria | 5294 |
| 66 | Ga0070659_100010688 | 3300005366 | Bacteria | 6762 |
| 67 | Ga0070667_100040210 | 3300005367 | Bacteria | 3921 |
| 68 | Ga0070667_100121522 | 3300005367 | Bacteria | 2272 |
| 69 | Ga0070714_100005978 | 3300005435 | Bacteria | 9342 |
| 70 | Ga0070701_10002657 | 3300005438 | Bacteria | 6929 |
| 71 | Ga0070700_100001557 | 3300005441 | Bacteria | 11439 |
| 72 | Ga0070694_100007042 | 3300005444 | Bacteria | 6841 |
| 73 | Ga0070678_100013489 | 3300005456 | Bacteria | 5126 |
| 74 | Ga0070678_100118045 | 3300005456 | Bacteria | 2087 |
| 75 | Ga0070662_100045607 | 3300005457 | Bacteria | 3146 |
| 76 | Ga0070662_100086660 | 3300005457 | Bacteria | 2343 |
| 77 | Ga0070681_10021034 | 3300005458 | Bacteria | 6537 |
| 78 | Ga0070681_10105664 | 3300005458 | Bacteria | 2758 |
| 79 | Ga0068867_100131378 | 3300005459 | Bacteria | 1946 |
| 80 | Ga0070685_10004412 | 3300005466 | Bacteria | 7106 |
| 81 | Ga0070685_10010094 | 3300005466 | Bacteria | 4898 |
| 82 | Ga0070679_100109683 | 3300005530 | Bacteria | 2746 |
| 83 | Ga0070684_100012745 | 3300005535 | Bacteria | 6750 |
| 84 | Ga0070684_100102751 | 3300005535 | Bacteria | 2556 |
| 85 | Ga0070672_100096097 | 3300005543 | Bacteria | 2397 |
| 86 | Ga0070686_100005320 | 3300005544 | Bacteria | 7121 |
| 87 | Ga0070686_100046432 | 3300005544 | Bacteria | 2741 |
| 88 | Ga0070696_100000013 | 3300005546 | Bacteria | 78718 |
| 89 | Ga0070665_100002087 | 3300005548 | Bacteria | 22404 |
| 90 | Ga0070665_100041560 | 3300005548 | Bacteria | 4622 |
| 91 | Ga0070665_100124454 | 3300005548 | Unclassified | 2580 |
| 92 | Ga0068855_100139220 | 3300005563 | Bacteria | 2768 |
| 93 | Ga0068855_100155441 | 3300005563 | Bacteria | 2599 |
| 94 | Ga0070664_100000651 | 3300005564 | Bacteria | 26520 |
| 95 | Ga0068857_100013040 | 3300005577 | Bacteria | 7241 |
| 96 | Ga0068856_100120658 | 3300005614 | Bacteria | 2623 |
| 97 | Ga0070702_100068502 | 3300005615 | Bacteria | 2088 |
| 98 | Ga0070702_100090282 | 3300005615 | Bacteria | 1857 |
| 99 | Ga0068852_100029633 | 3300005616 | Bacteria | 4498 |
| 100 | Ga0068864_100011396 | 3300005618 | Bacteria | 7344 |
| 101 | Ga0068864_100027732 | 3300005618 | Bacteria | 4785 |
| 102 | Ga0068866_10009938 | 3300005718 | Bacteria | 4060 |
| 103 | Ga0068861_100002744 | 3300005719 | Bacteria | 11537 |
| 104 | Ga0068861_100024260 | 3300005719 | Bacteria | 4385 |
| 105 | Ga0068851_10000197 | 3300005834 | Bacteria | 29386 |
| 106 | Ga0068851_10007001 | 3300005834 | Bacteria | 5171 |
| 107 | Ga0068870_10013996 | 3300005840 | Bacteria | 3780 |
| 108 | Ga0068863_100007312 | 3300005841 | Bacteria | 10812 |
| 109 | Ga0068863_100050649 | 3300005841 | Bacteria | 3936 |
| 110 | Ga0068858_100002537 | 3300005842 | Bacteria | 18405 |
| 111 | Ga0068858_100014317 | 3300005842 | Bacteria | 7480 |
| 112 | Ga0068858_100037191 | 3300005842 | Bacteria | 4513 |
| 113 | Ga0068860_100026094 | 3300005843 | Bacteria | 5636 |
| 114 | Ga0068860_100054358 | 3300005843 | Bacteria | 3806 |
| 115 | Ga0068860_100069151 | 3300005843 | Bacteria | 3355 |
| 116 | Ga0068862_100001151 | 3300005844 | Bacteria | 25015 |
| 117 | Ga0068862_100031145 | 3300005844 | Bacteria | 4500 |
| 118 | Ga0068862_100040741 | 3300005844 | Bacteria | 3948 |
| 119 | Ga0068862_100043353 | 3300005844 | Bacteria | 3835 |
| 120 | Ga0081540_1000663 | 3300005983 | Bacteria | 32432 |
| 121 | Ga0081540_1043087 | 3300005983 | Bacteria | 2320 |
| 122 | Ga0075365_10199719 | 3300006038 | Bacteria | 1400 |
| 123 | Ga0075364_10016895 | 3300006051 | Bacteria | 4547 |
| 124 | Ga0075432_10001028 | 3300006058 | Bacteria | 8868 |
| 125 | Ga0075427_10000673 | 3300006194 | Bacteria | 4068 |
| 126 | Ga0097621_100003933 | 3300006237 | Bacteria | 10292 |
| 127 | Ga0075370_10139923 | 3300006353 | Bacteria | 1414 |
| 128 | Ga0075430_100000332 | 3300006846 | Bacteria | 33904 |
| 129 | Ga0075430_100003367 | 3300006846 | Bacteria | 13388 |
| 130 | Ga0075431_100008089 | 3300006847 | Bacteria | 10498 |
| 131 | Ga0075434_100000647 | 3300006871 | Bacteria | 26943 |
| 132 | Ga0075429_100000296 | 3300006880 | Bacteria | 35293 |
| 133 | Ga0075429_100000451 | 3300006880 | Bacteria | 30628 |
| 134 | Ga0068865_100001035 | 3300006881 | Bacteria | 16020 |
| 135 | Ga0068865_100034470 | 3300006881 | Bacteria | 3396 |
| 136 | Ga0079104_1017736 | 3300006946 | Bacteria | 2038 |
| 137 | Ga0075435_100000630 | 3300007076 | Bacteria | 21640 |
| 138 | Ga0105251_10001791 | 3300009011 | Bacteria | 17849 |
| 139 | Ga0105251_10002666 | 3300009011 | Bacteria | 13754 |
| 140 | Ga0105251_10003271 | 3300009011 | Bacteria | 11881 |
| 141 | Ga0105251_10013975 | 3300009011 | Bacteria | 4460 |
| 142 | Ga0105251_10014963 | 3300009011 | Bacteria | 4259 |
| 143 | Ga0105244_10000181 | 3300009036 | Bacteria | 63616 |
| 144 | Ga0105244_10002140 | 3300009036 | Bacteria | 15155 |
| 145 | Ga0105244_10002479 | 3300009036 | Bacteria | 13897 |
| 146 | Ga0105244_10029049 | 3300009036 | Bacteria | 2960 |
| 147 | Ga0105244_10041777 | 3300009036 | Bacteria | 2375 |
| 148 | Ga0105244_10058508 | 3300009036 | Bacteria | 1945 |
| 149 | Ga0105250_10000088 | 3300009092 | Bacteria | 80904 |
| 150 | Ga0105250_10000261 | 3300009092 | Bacteria | 43192 |
| 151 | Ga0105250_10009888 | 3300009092 | Bacteria | 4003 |
| 152 | Ga0105240_10009287 | 3300009093 | Bacteria | 13943 |
| 153 | Ga0105240_10142449 | 3300009093 | Bacteria | 2865 |
| 154 | Ga0105240_10191888 | 3300009093 | Bacteria | 2401 |
| 155 | Ga0111539_10002056 | 3300009094 | Bacteria | 26910 |
| 156 | Ga0111539_10022347 | 3300009094 | Bacteria | 7774 |
| 157 | Ga0111539_10172607 | 3300009094 | Bacteria | 2526 |
| 158 | Ga0114129_10016414 | 3300009147 | Bacteria | 10538 |
| 159 | Ga0114129_10189357 | 3300009147 | Bacteria | 2795 |
| 160 | Ga0105243_10019654 | 3300009148 | Bacteria | 5121 |
| 161 | Ga0105243_10020789 | 3300009148 | Bacteria | 4980 |
| 162 | Ga0105243_10057254 | 3300009148 | Bacteria | 3103 |
| 163 | Ga0105243_10070754 | 3300009148 | Bacteria | 2818 |
| 164 | Ga0105243_10123536 | 3300009148 | Bacteria | 2186 |
| 165 | Ga0105243_10176723 | 3300009148 | Bacteria | 1853 |
| 166 | Ga0105241_10000171 | 3300009174 | Bacteria | 47968 |
| 167 | Ga0105242_10003223 | 3300009176 | Bacteria | 12720 |
| 168 | Ga0105238_10000865 | 3300009551 | Bacteria | 31282 |
| 169 | Ga0105238_10142860 | 3300009551 | Bacteria | 2370 |
| 170 | Ga0105249_10037049 | 3300009553 | Bacteria | 4426 |
| 171 | Ga0105239_10008186 | 3300010375 | Bacteria | 11925 |
| 172 | Ga0105246_10000174 | 3300011119 | Bacteria | 31284 |
| 173 | Ga0105246_10024242 | 3300011119 | Bacteria | 3939 |
| 174 | Ga0157317_1000800 | 3300012475 | Bacteria | 1517 |
| 175 | Ga0157319_1000024 | 3300012497 | Bacteria | 65569 |
| 176 | Ga0157373_10002145 | 3300013100 | Bacteria | 14933 |
| 177 | Ga0157373_10006136 | 3300013100 | Bacteria | 8985 |
| 178 | Ga0157373_10014390 | 3300013100 | Bacteria | 5800 |
| 179 | Ga0157373_10036326 | 3300013100 | Bacteria | 3537 |
| 180 | Ga0157371_10031143 | 3300013102 | Bacteria | 3843 |
| 181 | Ga0157371_10045904 | 3300013102 | Bacteria | 3108 |
| 182 | Ga0157371_10133262 | 3300013102 | Bacteria | 1768 |
| 183 | Ga0157370_10009550 | 3300013104 | Bacteria | 10342 |
| 184 | Ga0157370_10023529 | 3300013104 | Bacteria | 6113 |
| 185 | Ga0157370_10065730 | 3300013104 | Bacteria | 3431 |
| 186 | Ga0157369_10004166 | 3300013105 | Bacteria | 17134 |
| 187 | Ga0157369_10028384 | 3300013105 | Bacteria | 6193 |
| 188 | Ga0157369_10207891 | 3300013105 | Bacteria | 2052 |
| 189 | Ga0157374_10000958 | 3300013296 | Bacteria | 25036 |
| 190 | Ga0157374_10004803 | 3300013296 | Bacteria | 11342 |
| 191 | Ga0157374_10051673 | 3300013296 | Bacteria | 3825 |
| 192 | Ga0163162_10117349 | 3300013306 | Bacteria | 2763 |
| 193 | Ga0157375_10000050 | 3300013308 | Bacteria | 134913 |
| 194 | Ga0157375_10056502 | 3300013308 | Bacteria | 3875 |
| 195 | Ga0157375_10267250 | 3300013308 | Bacteria | 1872 |
| 196 | Ga0163163_10034762 | 3300014325 | Bacteria | 4884 |
| 197 | Ga0157380_10002683 | 3300014326 | Bacteria | 12072 |
| 198 | Ga0157380_10013364 | 3300014326 | Bacteria | 5984 |
| 199 | Ga0157380_10018593 | 3300014326 | Bacteria | 5161 |
| 200 | Ga0182008_10032776 | 3300014497 | Bacteria | 2608 |
| 201 | Ga0157377_10025602 | 3300014745 | Bacteria | 3148 |
| 202 | Ga0157379_10002335 | 3300014968 | Bacteria | 15815 |
| 203 | Ga0157379_10010681 | 3300014968 | Bacteria | 7999 |
| 204 | Ga0157379_10034552 | 3300014968 | Bacteria | 4508 |
| 205 | Ga0157379_10082432 | 3300014968 | Bacteria | 2882 |
| 206 | Ga0182006_1000116 | 3300015261 | Bacteria | 86100 |
| 207 | Ga0182007_10000771 | 3300015262 | Bacteria | 17935 |
| 208 | Ga0182005_1000003 | 3300015265 | Bacteria | 683269 |
| 209 | Ga0163161_10002851 | 3300017792 | Bacteria | 12263 |
| 210 | Ga0163161_10003420 | 3300017792 | Bacteria | 11129 |
| 211 | Ga0163161_10081985 | 3300017792 | Bacteria | 2376 |
| 212 | Ga0163161_10082863 | 3300017792 | Bacteria | 2364 |
| 213 | Ga0213872_10001285 | 3300021361 | Bacteria | 16783 |
| 214 | Ga0209435_103668 | 3300025206 | Bacteria | 1744 |
| 215 | Ga0209784_100414 | 3300025224 | Bacteria | 19015 |
| 216 | Ga0209566_100716 | 3300025225 | Bacteria | 18941 |
| 217 | Ga0209674_100446 | 3300025226 | Bacteria | 19015 |
| 218 | Ga0209147_100742 | 3300025229 | Bacteria | 16146 |
| 219 | Ga0209563_100319 | 3300025230 | Bacteria | 19015 |
| 220 | Ga0209258_100860 | 3300025242 | Bacteria | 16144 |
| 221 | Ga0207425_1000346 | 3300025245 | Bacteria | 32243 |
| 222 | Ga0209646_1000543 | 3300025246 | Bacteria | 16214 |
| 223 | Ga0209677_100627 | 3300025253 | Bacteria | 18940 |
| 224 | Ga0209759_1004314 | 3300025256 | Bacteria | 5351 |
| 225 | Ga0209676_1007332 | 3300025292 | Bacteria | 5212 |
| 226 | Ga0209564_1000026 | 3300025295 | Bacteria | 519154 |
| 227 | Ga0209564_1000097 | 3300025295 | Bacteria | 231436 |
| 228 | Ga0209758_1000314 | 3300025297 | Bacteria | 93818 |
| 229 | Ga0209050_1002726 | 3300025298 | Bacteria | 14271 |
| 230 | Ga0209256_1000075 | 3300025299 | Bacteria | 236149 |
| 231 | Ga0209256_1001776 | 3300025299 | Bacteria | 20464 |
| 232 | Ga0209051_1001190 | 3300025303 | Bacteria | 23511 |
| 233 | Ga0209257_1000244 | 3300025304 | Bacteria | 126098 |
| 234 | Ga0209257_1002005 | 3300025304 | Bacteria | 21776 |
| 235 | Ga0207697_10003666 | 3300025315 | Bacteria | 7522 |
| 236 | Ga0207656_10005798 | 3300025321 | Bacteria | 4395 |
| 237 | Ga0207656_10061085 | 3300025321 | Bacteria | 1653 |
| 238 | Ga0207696_1000091 | 3300025711 | Bacteria | 187999 |
| 239 | Ga0207655_1000113 | 3300025728 | Bacteria | 167376 |
| 240 | Ga0207655_1003222 | 3300025728 | Bacteria | 12266 |
| 241 | Ga0207655_1018389 | 3300025728 | Bacteria | 3708 |
| 242 | Ga0207655_1021767 | 3300025728 | Bacteria | 3240 |
| 243 | Ga0207655_1027492 | 3300025728 | Bacteria | 2708 |
| 244 | Ga0207713_1000432 | 3300025735 | Bacteria | 44225 |
| 245 | Ga0207713_1001595 | 3300025735 | Bacteria | 17730 |
| 246 | Ga0207713_1026716 | 3300025735 | Bacteria | 2638 |
| 247 | Ga0207682_10000905 | 3300025893 | Bacteria | 13733 |
| 248 | Ga0207642_10030927 | 3300025899 | Bacteria | 2237 |
| 249 | Ga0207688_10000676 | 3300025901 | Bacteria | 16826 |
| 250 | Ga0207680_10029668 | 3300025903 | Bacteria | 3076 |
| 251 | Ga0207645_10000860 | 3300025907 | Bacteria | 25221 |
| 252 | Ga0207645_10003294 | 3300025907 | Bacteria | 12321 |
| 253 | Ga0207645_10076298 | 3300025907 | Bacteria | 2146 |
| 254 | Ga0207643_10000205 | 3300025908 | Bacteria | 41221 |
| 255 | Ga0207643_10046800 | 3300025908 | Bacteria | 2446 |
| 256 | Ga0207705_10022392 | 3300025909 | Bacteria | 4505 |
| 257 | Ga0207705_10023899 | 3300025909 | Bacteria | 4361 |
| 258 | Ga0207705_10057204 | 3300025909 | Bacteria | 2813 |
| 259 | Ga0207705_10147410 | 3300025909 | Bacteria | 1761 |
| 260 | Ga0207654_10000134 | 3300025911 | Bacteria | 47957 |
| 261 | Ga0207707_10184056 | 3300025912 | Bacteria | 1823 |
| 262 | Ga0207695_10061489 | 3300025913 | Bacteria | 3881 |
| 263 | Ga0207695_10135915 | 3300025913 | Bacteria | 2411 |
| 264 | Ga0207660_10013510 | 3300025917 | Bacteria | 5351 |
| 265 | Ga0207662_10002164 | 3300025918 | Bacteria | 9790 |
| 266 | Ga0207662_10002300 | 3300025918 | Bacteria | 9566 |
| 267 | Ga0207662_10027596 | 3300025918 | Bacteria | 3277 |
| 268 | Ga0207662_10033083 | 3300025918 | Bacteria | 3011 |
| 269 | Ga0207657_10005467 | 3300025919 | Bacteria | 13262 |
| 270 | Ga0207657_10008770 | 3300025919 | Bacteria | 10236 |
| 271 | Ga0207657_10010663 | 3300025919 | Bacteria | 9153 |
| 272 | Ga0207652_10212463 | 3300025921 | Bacteria | 1742 |
| 273 | Ga0207681_10000690 | 3300025923 | Bacteria | 22223 |
| 274 | Ga0207681_10000883 | 3300025923 | Bacteria | 19643 |
| 275 | Ga0207681_10045876 | 3300025923 | Bacteria | 2937 |
| 276 | Ga0207681_10076723 | 3300025923 | Bacteria | 2347 |
| 277 | Ga0207650_10000373 | 3300025925 | Bacteria | 42334 |
| 278 | Ga0207650_10001078 | 3300025925 | Bacteria | 20212 |
| 279 | Ga0207650_10009278 | 3300025925 | Bacteria | 6722 |
| 280 | Ga0207659_10019339 | 3300025926 | Bacteria | 4481 |
| 281 | Ga0207664_10015167 | 3300025929 | Bacteria | 5584 |
| 282 | Ga0207644_10054444 | 3300025931 | Bacteria | 2881 |
| 283 | Ga0207644_10080072 | 3300025931 | Bacteria | 2412 |
| 284 | Ga0207644_10177020 | 3300025931 | Bacteria | 1669 |
| 285 | Ga0207690_10003250 | 3300025932 | Bacteria | 9750 |
| 286 | Ga0207706_10000618 | 3300025933 | Bacteria | 37720 |
| 287 | Ga0207706_10000935 | 3300025933 | Bacteria | 29879 |
| 288 | Ga0207706_10088459 | 3300025933 | Bacteria | 2723 |
| 289 | Ga0207706_10119314 | 3300025933 | Bacteria | 2319 |
| 290 | Ga0207686_10003655 | 3300025934 | Bacteria | 8241 |
| 291 | Ga0207709_10006905 | 3300025935 | Bacteria | 6353 |
| 292 | Ga0207709_10013101 | 3300025935 | Bacteria | 4571 |
| 293 | Ga0207709_10022219 | 3300025935 | Bacteria | 3597 |
| 294 | Ga0207709_10034258 | 3300025935 | Bacteria | 2992 |
| 295 | Ga0207670_10007157 | 3300025936 | Bacteria | 6218 |
| 296 | Ga0207670_10016919 | 3300025936 | Bacteria | 4396 |
| 297 | Ga0207669_10005612 | 3300025937 | Bacteria | 5649 |
| 298 | Ga0207669_10013934 | 3300025937 | Bacteria | 4014 |
| 299 | Ga0207704_10001205 | 3300025938 | Bacteria | 11527 |
| 300 | Ga0207704_10046148 | 3300025938 | Bacteria | 2594 |
| 301 | Ga0207691_10025775 | 3300025940 | Bacteria | 5518 |
| 302 | Ga0207691_10040837 | 3300025940 | Bacteria | 4286 |
| 303 | Ga0207691_10063173 | 3300025940 | Bacteria | 3359 |
| 304 | Ga0207691_10152739 | 3300025940 | Bacteria | 2029 |
| 305 | Ga0207711_10036064 | 3300025941 | Bacteria | 4195 |
| 306 | Ga0207711_10105405 | 3300025941 | Bacteria | 2500 |
| 307 | Ga0207689_10000451 | 3300025942 | Bacteria | 38688 |
| 308 | Ga0207689_10001368 | 3300025942 | Bacteria | 23383 |
| 309 | Ga0207661_10066704 | 3300025944 | Bacteria | 2924 |
| 310 | Ga0207651_10009135 | 3300025960 | Bacteria | 5401 |
| 311 | Ga0207651_10073619 | 3300025960 | Bacteria | 2429 |
| 312 | Ga0207712_10052028 | 3300025961 | Bacteria | 2867 |
| 313 | Ga0207668_10015582 | 3300025972 | Bacteria | 4725 |
| 314 | Ga0207668_10018685 | 3300025972 | Bacteria | 4369 |
| 315 | Ga0207658_10023813 | 3300025986 | Bacteria | 4278 |
| 316 | Ga0207703_10026738 | 3300026035 | Bacteria | 4545 |
| 317 | Ga0207703_10047521 | 3300026035 | Bacteria | 3461 |
| 318 | Ga0207703_10062701 | 3300026035 | Bacteria | 3045 |
| 319 | Ga0207703_10229393 | 3300026035 | Bacteria | 1664 |
| 320 | Ga0207639_10022982 | 3300026041 | Bacteria | 4496 |
| 321 | Ga0207639_10232614 | 3300026041 | Bacteria | 1598 |
| 322 | Ga0207678_10132975 | 3300026067 | Bacteria | 2122 |
| 323 | Ga0207708_10000114 | 3300026075 | Bacteria | 61971 |
| 324 | Ga0207708_10000557 | 3300026075 | Bacteria | 28820 |
| 325 | Ga0207708_10003529 | 3300026075 | Bacteria | 11520 |
| 326 | Ga0207708_10004301 | 3300026075 | Bacteria | 10482 |
| 327 | Ga0207641_10032348 | 3300026088 | Bacteria | 4342 |
| 328 | Ga0207641_10112818 | 3300026088 | Bacteria | 2412 |
| 329 | Ga0207641_10220374 | 3300026088 | Bacteria | 1759 |
| 330 | Ga0207648_10001471 | 3300026089 | Bacteria | 25924 |
| 331 | Ga0207648_10026748 | 3300026089 | Bacteria | 5124 |
| 332 | Ga0207648_10028967 | 3300026089 | Bacteria | 4909 |
| 333 | Ga0207648_10073941 | 3300026089 | Bacteria | 2970 |
| 334 | Ga0207676_10025509 | 3300026095 | Bacteria | 4385 |
| 335 | Ga0207676_10025835 | 3300026095 | Bacteria | 4360 |
| 336 | Ga0207674_10099881 | 3300026116 | Bacteria | 2884 |
| 337 | Ga0207675_100001090 | 3300026118 | Bacteria | 26881 |
| 338 | Ga0207675_100003064 | 3300026118 | Bacteria | 16393 |
| 339 | Ga0207675_100003701 | 3300026118 | Bacteria | 14900 |
| 340 | Ga0207675_100009061 | 3300026118 | Bacteria | 9339 |
| 341 | Ga0207683_10011402 | 3300026121 | Bacteria | 7585 |
| 342 | Ga0207698_10035718 | 3300026142 | Bacteria | 3639 |
| 343 | Ga0207698_10051297 | 3300026142 | Bacteria | 3153 |
| 344 | Ga0207698_10192873 | 3300026142 | Bacteria | 1817 |
| 345 | Ga0209281_1007615 | 3300027111 | Bacteria | 2705 |
| 346 | Ga0207428_10000180 | 3300027907 | Bacteria | 88557 |
| 347 | Ga0207428_10063229 | 3300027907 | Bacteria | 2924 |
| 348 | Ga0207428_10119781 | 3300027907 | Bacteria | 2019 |
| 349 | Ga0268266_10069528 | 3300028379 | Bacteria | 3050 |
| 350 | Ga0268265_10000621 | 3300028380 | Bacteria | 35352 |
| 351 | Ga0268265_10128985 | 3300028380 | Bacteria | 2098 |
| 352 | Ga0268264_10097899 | 3300028381 | Bacteria | 2543 |
| 353 | Ga0265336_10000039 | 3300028666 | Bacteria | 149376 |
| 354 | Ga0265324_10000223 | 3300029957 | Bacteria | 43654 |
| 355 | Ga0265328_10002757 | 3300031239 | Bacteria | 7861 |
| 356 | Ga0307513_10000066 | 3300031456 | Bacteria | 141617 |
| 357 | Ga0307513_10019665 | 3300031456 | Bacteria | 8032 |
| 358 | Ga0307509_10002265 | 3300031507 | Bacteria | 31503 |
| 359 | Ga0307508_10117654 | 3300031616 | Bacteria | 2259 |
| 360 | Ga0307516_10029384 | 3300031730 | Bacteria | 5557 |
| 361 | Ga0307405_10000054 | 3300031731 | Bacteria | 58365 |
| 362 | Ga0307413_10054238 | 3300031824 | Bacteria | 2431 |
| 363 | Ga0307410_10028059 | 3300031852 | Bacteria | 3566 |
| 364 | Ga0307410_10152065 | 3300031852 | Bacteria | 1724 |
| 365 | Ga0307410_10187076 | 3300031852 | Bacteria | 1572 |
| 366 | Ga0307406_10083892 | 3300031901 | Bacteria | 2126 |
| 367 | Ga0307412_10060034 | 3300031911 | Bacteria | 2551 |
| 368 | Ga0307409_100011300 | 3300031995 | Bacteria | 5618 |
| 369 | Ga0307409_100129374 | 3300031995 | Bacteria | 2154 |
| 370 | Ga0307409_100238299 | 3300031995 | Bacteria | 1654 |
| 371 | Ga0307416_100110227 | 3300032002 | Bacteria | 2423 |
| 372 | Ga0307414_10011556 | 3300032004 | Bacteria | 5183 |
| 373 | Ga0307414_10061929 | 3300032004 | Bacteria | 2652 |
| 374 | Ga0307411_10001564 | 3300032005 | Bacteria | 9479 |
| 375 | Ga0307510_10008623 | 3300033180 | Bacteria | 12150 |
| 376 | Ga0373944_0019089 | 3300035089 | Bacteria | 1965 |
| 377 | Ga0373949_0020485 | 3300035090 | Bacteria | 1514 |
| 378 | Ga0373941_0019456 | 3300035115 | Bacteria | 1891 |
| 379 | Ga0373943_0023996 | 3300035170 | Bacteria | 2841 |
| 380 | Ga0373943_0037106 | 3300035170 | Bacteria | 2338 |
| 381 | Ga0373947_0007862 | 3300035725 | Bacteria | 6157 |
| 382 | Ga0373947_0164796 | 3300035725 | Bacteria | 1435 |
| 383 | Ga0395905_0019451 | 3300037471 | Bacteria | 6437 |
| 384 | Ga0395905_0081841 | 3300037471 | Bacteria | 3026 |
| 385 | Ga0436361_0165235 | 3300039447 | Bacteria | 5547 |
| 386 | Ga0436361_0303811 | 3300039447 | Bacteria | 2268 |
| 387 | Ga0436361_1035230 | 3300039447 | Bacteria | 5145 |
| 388 | Ga0436362_0866046 | 3300039453 | Bacteria | 2229 |
| 389 | Ga0439466_0053396 | 3300041411 | Bacteria | 1318 |
| 390 | Ga0439462_0020776 | 3300042015 | Bacteria | 1713 |
| 391 | Ga0450913_000144 | 3300042117 | Bacteria | 2203 |
| 392 | Ga0450923_003832 | 3300042125 | Bacteria | 2311 |
| 393 | Ga0450904_000412 | 3300042139 | Bacteria | 8738 |
| 394 | Ga0439446_0008790 | 3300042156 | Bacteria | 2691 |
| 395 | Ga0439446_0018222 | 3300042156 | Bacteria | 1965 |
| 396 | Ga0439434_0004984 | 3300042435 | Bacteria | 3880 |
| 397 | Ga0439459_0007697 | 3300042438 | Bacteria | 1825 |
| 398 | Ga0450918_003841 | 3300042531 | Bacteria | 2768 |
| 399 | Ga0451577_0181761 | 3300042876 | Bacteria | 1896 |
| 400 | Ga0466963_0113030 | 3300044694 | Bacteria | 1865 |
| 401 | Ga0451576_0000220 | 3300045051 | Bacteria | 141261 |
| 402 | Ga0451576_0011312 | 3300045051 | Bacteria | 10154 |
| 403 | Ga0495627_000530 | 3300046453 | Bacteria | 31551 |
| 404 | Ga0495627_000888 | 3300046453 | Bacteria | 20978 |
| 405 | Ga0495592_0053899 | 3300046454 | Bacteria | 2981 |
| 406 | Ga0495591_000529 | 3300046458 | Bacteria | 29837 |
| 407 | Ga0495638_0001443 | 3300046460 | Bacteria | 21511 |
| 408 | Ga0495638_0003221 | 3300046460 | Bacteria | 12910 |
| 409 | Ga0495638_0005791 | 3300046460 | Bacteria | 9094 |
| 410 | Ga0495638_0011834 | 3300046460 | Bacteria | 6003 |
| 411 | Ga0495638_0091408 | 3300046460 | Bacteria | 1833 |
| 412 | Ga0495653_0009457 | 3300046463 | Bacteria | 7975 |
| 413 | Ga0495650_0002849 | 3300046471 | Bacteria | 13231 |
| 414 | Ga0495650_0003122 | 3300046471 | Bacteria | 12416 |
| 415 | Ga0495580_0001063 | 3300046472 | Bacteria | 24156 |
| 416 | Ga0495605_0017853 | 3300046474 | Bacteria | 3812 |
| 417 | Ga0495605_0025507 | 3300046474 | Bacteria | 3080 |
| 418 | Ga0495584_0000875 | 3300046491 | Bacteria | 19432 |
| 419 | Ga0495585_0001381 | 3300046492 | Bacteria | 19179 |
| 420 | Ga0495596_0002737 | 3300046500 | Bacteria | 9261 |
| 421 | Ga0495607_0002057 | 3300046501 | Bacteria | 16829 |
| 422 | Ga0495607_0008751 | 3300046501 | Bacteria | 6896 |
| 423 | Ga0495607_0010963 | 3300046501 | Bacteria | 6062 |
| 424 | Ga0495583_0001527 | 3300046506 | Bacteria | 22952 |
| 425 | Ga0495583_0005777 | 3300046506 | Bacteria | 8273 |
| 426 | Ga0495606_0000725 | 3300046507 | Bacteria | 50954 |
| 427 | Ga0495606_0004441 | 3300046507 | Bacteria | 14017 |
| 428 | Ga0495606_0009506 | 3300046507 | Bacteria | 8212 |
| 429 | Ga0495610_0000021 | 3300046512 | Bacteria | 336300 |
| 430 | Ga0495610_0001114 | 3300046512 | Bacteria | 24484 |
| 431 | Ga0495610_0008547 | 3300046512 | Bacteria | 6609 |
| 432 | Ga0495610_0030819 | 3300046512 | Bacteria | 2804 |
| 433 | Ga0495620_0000224 | 3300046515 | Bacteria | 42576 |
| 434 | Ga0495630_0087358 | 3300046517 | Bacteria | 2355 |
| 435 | Ga0495631_0006268 | 3300046518 | Bacteria | 6158 |
| 436 | Ga0495632_0000275 | 3300046519 | Bacteria | 50568 |
| 437 | Ga0495632_0003902 | 3300046519 | Bacteria | 10361 |
| 438 | Ga0495632_0006116 | 3300046519 | Bacteria | 7803 |
| 439 | Ga0495632_0008775 | 3300046519 | Bacteria | 6159 |
| 440 | Ga0495632_0062559 | 3300046519 | Bacteria | 1804 |
| 441 | Ga0495637_0000057 | 3300046520 | Bacteria | 97433 |
| 442 | Ga0495637_0005703 | 3300046520 | Bacteria | 6314 |
| 443 | Ga0495637_0038642 | 3300046520 | Bacteria | 2065 |
| 444 | Ga0495654_0000005 | 3300046530 | Bacteria | 491381 |
| 445 | Ga0495654_0001418 | 3300046530 | Bacteria | 16564 |
| 446 | Ga0495609_0002721 | 3300046538 | Bacteria | 10667 |
| 447 | Ga0495621_0003116 | 3300046539 | Bacteria | 4537 |
| 448 | Ga0495621_0012488 | 3300046539 | Bacteria | 2649 |
| 449 | Ga0495633_0000587 | 3300046558 | Bacteria | 35276 |
| 450 | Ga0495656_0000940 | 3300046615 | Bacteria | 9423 |
| 451 | Ga0495668_0000008 | 3300046616 | Bacteria | 498364 |
| 452 | Ga0495668_0012451 | 3300046616 | Bacteria | 5043 |
| 453 | Ga0495668_0061189 | 3300046616 | Bacteria | 2077 |
| 454 | Ga0495625_0002093 | 3300046660 | Bacteria | 22302 |
| 455 | Ga0495625_0006426 | 3300046660 | Bacteria | 10463 |
| 456 | Ga0495625_0035111 | 3300046660 | Bacteria | 3697 |
| 457 | Ga0495659_0003719 | 3300046664 | Bacteria | 4851 |
| 458 | Ga0495661_0000150 | 3300046665 | Bacteria | 81419 |
| 459 | Ga0495661_0000193 | 3300046665 | Bacteria | 70300 |
| 460 | Ga0495661_0000698 | 3300046665 | Bacteria | 33395 |
| 461 | Ga0495661_0000780 | 3300046665 | Bacteria | 30377 |
| 462 | Ga0495661_0003350 | 3300046665 | Bacteria | 11878 |
| 463 | Ga0495647_0003356 | 3300046681 | Bacteria | 5129 |
| 464 | Ga0495658_0035972 | 3300046683 | Bacteria | 2729 |
| 465 | Ga0495669_0002301 | 3300046684 | Bacteria | 7829 |
| 466 | Ga0495671_0002178 | 3300046692 | Bacteria | 12484 |
| 467 | Ga0495649_0001376 | 3300046694 | Bacteria | 18410 |
| 468 | Ga0495649_0003451 | 3300046694 | Bacteria | 10654 |
| 469 | Ga0495649_0007309 | 3300046694 | Bacteria | 6750 |
| 470 | Ga0495589_0000490 | 3300046794 | Bacteria | 28284 |
| 471 | Ga0495660_0000072 | 3300046810 | Bacteria | 109692 |
| 472 | Ga0495660_0044433 | 3300046810 | Bacteria | 2444 |
| 473 | Ga0495660_0047438 | 3300046810 | Bacteria | 2352 |
| 474 | Ga0495636_0006614 | 3300047318 | Bacteria | 4557 |
| 475 | Ga0495672_0000014 | 3300047320 | Bacteria | 505636 |
| 476 | Ga0495672_0003595 | 3300047320 | Bacteria | 13168 |
| 477 | Ga0495676_0001551 | 3300047321 | Bacteria | 19928 |
| 478 | Ga0495683_0001223 | 3300047323 | Bacteria | 17497 |
| 479 | Ga0495687_014395 | 3300047443 | Bacteria | 4076 |
| 480 | Ga0495679_000226 | 3300047446 | Bacteria | 47732 |
| 481 | Ga0495679_010966 | 3300047446 | Bacteria | 3526 |
| 482 | Ga0495685_007440 | 3300047447 | Bacteria | 3615 |
| 483 | Ga0495673_0000033 | 3300047469 | Bacteria | 354152 |
| 484 | Ga0495673_0004969 | 3300047469 | Bacteria | 8178 |
| 485 | Ga0495681_0004774 | 3300047470 | Bacteria | 9180 |
| 486 | Ga0495681_0059744 | 3300047470 | Bacteria | 1761 |
| 487 | Ga0495686_0000075 | 3300047472 | Bacteria | 208031 |
| 488 | Ga0495686_0001396 | 3300047472 | Bacteria | 26729 |
| 489 | Ga0495686_0032698 | 3300047472 | Bacteria | 3364 |
| 490 | Ga0495626_0000796 | 3300048091 | Bacteria | 28573 |
| 491 | Ga0496102_0089208 | 3300048905 | Bacteria | 2852 |
| 492 | Ga0496104_0015068 | 3300048907 | Bacteria | 6997 |
| 493 | Ga0496105_0007157 | 3300048908 | Bacteria | 8610 |
| 494 | Ga0496106_0032321 | 3300048909 | Bacteria | 3901 |
| 495 | Ga0496108_0013198 | 3300048911 | Bacteria | 6733 |
| 496 | Ga0496109_0012841 | 3300048912 | Bacteria | 7239 |
| 497 | Ga0496110_0006943 | 3300048913 | Bacteria | 9006 |
| 498 | Ga0496110_0197765 | 3300048913 | Bacteria | 1826 |
| 499 | Ga0496112_0093879 | 3300048915 | Bacteria | 2970 |
| 500 | Ga0496117_0000597 | 3300048920 | Bacteria | 59321 |
| 501 | Ga0496117_0073991 | 3300048920 | Bacteria | 2270 |
| 502 | Ga0496118_0014825 | 3300048921 | Bacteria | 7268 |
| 503 | Ga0496118_0016520 | 3300048921 | Bacteria | 6768 |
| 504 | Ga0496120_0007305 | 3300048923 | Bacteria | 8248 |
| 505 | Ga0496120_0111207 | 3300048923 | Bacteria | 1431 |
| 506 | Ga0496121_0028522 | 3300048924 | Bacteria | 5193 |
| 507 | Ga0496122_0040668 | 3300048925 | Bacteria | 3689 |
| 508 | Ga0496123_0001590 | 3300048926 | Bacteria | 30876 |
| 509 | Ga0496123_0037309 | 3300048926 | Bacteria | 3432 |
| 510 | Ga0496124_0001080 | 3300048927 | Bacteria | 43080 |
| 511 | Ga0496124_0015231 | 3300048927 | Bacteria | 7380 |
| 512 | Ga0496124_0044863 | 3300048927 | Bacteria | 3791 |
| 513 | Ga0496124_0158316 | 3300048927 | Bacteria | 1768 |
| 514 | Ga0496125_0000465 | 3300048928 | Bacteria | 72631 |
| 515 | Ga0496125_0010799 | 3300048928 | Bacteria | 9196 |
| 516 | Ga0496125_0019156 | 3300048928 | Bacteria | 6468 |
| 517 | Ga0496125_0023871 | 3300048928 | Bacteria | 5634 |
| 518 | Ga0496125_0036515 | 3300048928 | Bacteria | 4288 |
| 519 | Ga0496126_0005176 | 3300048929 | Bacteria | 15077 |
| 520 | Ga0496126_0005612 | 3300048929 | Bacteria | 14267 |
| 521 | Ga0496126_0092616 | 3300048929 | Bacteria | 2655 |
| 522 | Ga0495678_021657 | 3300049459 | Bacteria | 2826 |
| 523 | Ga0495682_0000234 | 3300049460 | Bacteria | 43711 |
| 524 | Ga0501033_0140251 | 3300049570 | Bacteria | 1748 |
| 525 | Ga0501036_0113813 | 3300049572 | Bacteria | 2286 |
| 526 | Ga0501038_0071930 | 3300049574 | Bacteria | 2932 |
| 527 | Ga0501042_0022237 | 3300049578 | Bacteria | 4430 |
| 528 | Ga0501046_0048746 | 3300049580 | Bacteria | 3353 |
| 529 | Ga0501048_0117177 | 3300049582 | Bacteria | 1881 |
| 530 | Ga0501068_0125863 | 3300049584 | Bacteria | 1600 |
| 531 | Ga0501070_0087678 | 3300049586 | Bacteria | 2576 |
| 532 | Ga0501071_0006469 | 3300049587 | Bacteria | 7603 |
| 533 | Ga0501072_0009204 | 3300049588 | Bacteria | 7502 |
| 534 | Ga0501073_0242638 | 3300049589 | Bacteria | 1244 |
| 535 | Ga0501074_0081114 | 3300049590 | Bacteria | 2326 |
| 536 | Ga0501076_0007362 | 3300049592 | Bacteria | 8008 |
| 537 | Ga0501077_0024467 | 3300049593 | Bacteria | 3835 |
| 538 | Ga0501079_0020373 | 3300049741 | Bacteria | 5068 |
| 539 | Ga0501080_0187434 | 3300049742 | Bacteria | 1902 |
| 540 | Ga0501081_0046870 | 3300049743 | Bacteria | 2972 |
| 541 | Ga0501269_000526 | 3300049766 | Bacteria | 7696 |
| 542 | Ga0501045_0013719 | 3300049824 | Bacteria | 5728 |
| 543 | nmdc:mga00v17_103677_c1 | 3300050491 | Bacteria | 1798 |
| 544 | nmdc:mga0yw44_18038_c1 | 3300050492 | Bacteria | 3857 |
| 545 | nmdc:mga0k408_26218_c1 | 3300050493 | Bacteria | 3303 |
| 546 | nmdc:mga0k408_68597_c1 | 3300050493 | Bacteria | 2069 |
| 547 | nmdc:mga07m45_73054_c1 | 3300050496 | Bacteria | 1953 |
| 548 | nmdc:mga05p37_863_c1 | 3300050507 | Bacteria | 34108 |
| 549 | nmdc:mga09592_15927_c1 | 3300050508 | Bacteria | 6143 |
| 550 | nmdc:mga09592_436_c1 | 3300050508 | Bacteria | 30720 |
| 551 | nmdc:mga0qj67_1189_c1 | 3300050509 | Bacteria | 18042 |
| 552 | nmdc:mga0qj67_3156_c1 | 3300050509 | Bacteria | 11863 |
| 553 | nmdc:mga06r32_7419_c1 | 3300050510 | Bacteria | 9864 |
| 554 | nmdc:mga08y16_132262_c1 | 3300050511 | Bacteria | 2594 |
| 555 | nmdc:mga08y16_15204_c1 | 3300050511 | Bacteria | 8095 |
| 556 | nmdc:mga08y16_156910_c1 | 3300050511 | Bacteria | 2365 |
| 557 | nmdc:mga08y16_83618_c1 | 3300050511 | Bacteria | 3327 |
| 558 | nmdc:mga0n895_427_c1 | 3300050512 | Bacteria | 28261 |
| 559 | nmdc:mga0rr50_2839_c1 | 3300050513 | Bacteria | 9853 |
| 560 | nmdc:mga0a205_1001_c1 | 3300050515 | Bacteria | 23411 |
| 561 | Ga0500635_0000449 | 3300053080 | Bacteria | 11894 |
| 562 | Ga0500643_000169 | 3300053087 | Bacteria | 64699 |
| 563 | Ga0500608_000123 | 3300053122 | Bacteria | 32276 |
| 564 | Ga0500618_000601 | 3300053125 | Bacteria | 22092 |
| 565 | Ga0500618_013509 | 3300053125 | Bacteria | 2106 |
| 566 | Ga0500559_0000954 | 3300053136 | Bacteria | 18188 |
| 567 | Ga0500577_0000079 | 3300053142 | Bacteria | 22454 |
| 568 | Ga0500604_0020364 | 3300053151 | Bacteria | 1867 |
| 569 | Ga0500622_0003490 | 3300053156 | Bacteria | 10437 |
| 570 | Ga0500645_010478 | 3300053730 | Bacteria | 3064 |
| 571 | Ga0501082_0010412 | 3300060353 | Bacteria | 8005 |
| 572 | Ga0501082_0023373 | 3300060353 | Bacteria | 5332 |
| 573 | Ga0501082_0257624 | 3300060353 | Bacteria | 1518 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009092 | Ga0105250_10009888 | Ga0105250_100098885 | 329 |
| 2 | 3300014326 | Ga0157380_10018593 | Ga0157380_100185932 | 366 |
| 3 | 3300013104 | Ga0157370_10065730 | Ga0157370_100657302 | 369 |
| 4 | 3300048926 | Ga0496123_0001590 | Ga0496123_0001590_8741_10048 | 369 |
| 5 | 3300046474 | Ga0495605_0017853 | Ga0495605_0017853_728_1987 | 379 |
| 6 | 3300049589 | Ga0501073_0242638 | Ga0501073_0242638_24_1166 | 380 |
| 7 | iso_pu_bacteria | 2876808645 | 2876812346 | 380 |
| 8 | 3300031852 | Ga0307410_10028059 | Ga0307410_100280593 | 382 |
| 9 | 3300046558 | Ga0495633_0000587 | Ga0495633_0000587_177_1484 | 383 |
| 10 | 3300048928 | Ga0496125_0019156 | Ga0496125_0019156_3486_4793 | 383 |
| 11 | 3300013102 | Ga0157371_10045904 | Ga0157371_100459044 | 384 |
| 12 | 3300013105 | Ga0157369_10028384 | Ga0157369_100283845 | 384 |
| 13 | 3300005290 | Ga0065712_10067802 | Ga0065712_1006780216 | 385 |
| 14 | 3300009036 | Ga0105244_10041777 | Ga0105244_100417773 | 385 |
| 15 | 3300015262 | Ga0182007_10000771 | Ga0182007_100007718 | 385 |
| 16 | 3300009036 | Ga0105244_10000181 | Ga0105244_100001817 | 386 |
| 17 | 3300011119 | Ga0105246_10024242 | Ga0105246_100242423 | 386 |
| 18 | 3300025728 | Ga0207655_1027492 | Ga0207655_10274922 | 386 |
| 19 | 3300005353 | Ga0070669_100001083 | Ga0070669_10000108315 | 387 |
| 20 | 3300005834 | Ga0068851_10000197 | Ga0068851_1000019721 | 387 |
| 21 | 3300009011 | Ga0105251_10001791 | Ga0105251_100017913 | 387 |
| 22 | 3300009036 | Ga0105244_10002479 | Ga0105244_1000247912 | 387 |
| 23 | 3300013100 | Ga0157373_10036326 | Ga0157373_100363262 | 387 |
| 24 | 3300013102 | Ga0157371_10031143 | Ga0157371_100311434 | 387 |
| 25 | 3300013104 | Ga0157370_10023529 | Ga0157370_100235295 | 387 |
| 26 | 3300013105 | Ga0157369_10004166 | Ga0157369_1000416613 | 387 |
| 27 | 3300013308 | Ga0157375_10000050 | Ga0157375_1000005092 | 387 |
| 28 | 3300025321 | Ga0207656_10061085 | Ga0207656_100610852 | 387 |
| 29 | 3300025728 | Ga0207655_1018389 | Ga0207655_10183892 | 387 |
| 30 | 3300025735 | Ga0207713_1001595 | Ga0207713_100159511 | 387 |
| 31 | 3300025923 | Ga0207681_10000690 | Ga0207681_1000069015 | 387 |
| 32 | 3300025933 | Ga0207706_10000935 | Ga0207706_100009355 | 387 |
| 33 | 3300048927 | Ga0496124_0015231 | Ga0496124_0015231_5984_7270 | 387 |
| 34 | 3300005331 | Ga0070670_100000155 | Ga0070670_10000015531 | 388 |
| 35 | 3300009011 | Ga0105251_10014963 | Ga0105251_100149633 | 388 |
| 36 | 3300009036 | Ga0105244_10058508 | Ga0105244_100585082 | 388 |
| 37 | 3300025925 | Ga0207650_10000373 | Ga0207650_1000037314 | 388 |
| 38 | 3300046538 | Ga0495609_0002721 | Ga0495609_0002721_7739_9040 | 390 |
| 39 | 3300047469 | Ga0495673_0004969 | Ga0495673_0004969_458_1759 | 390 |
| 40 | 3300003751 | Ga0055538_1000886 | Ga0055538_10008867 | 391 |
| 41 | 3300003752 | Ga0055539_1000794 | Ga0055539_10007947 | 391 |
| 42 | 3300003756 | Ga0055533_1001148 | Ga0055533_10011487 | 391 |
| 43 | 3300003758 | Ga0055532_1001240 | Ga0055532_10012402 | 391 |
| 44 | 3300003759 | Ga0055525_1001003 | Ga0055525_10010037 | 391 |
| 45 | 3300003841 | Ga0055541_1000846 | Ga0055541_10008467 | 391 |
| 46 | 3300005288 | Ga0065714_10004818 | Ga0065714_100048186 | 391 |
| 47 | 3300009011 | Ga0105251_10003271 | Ga0105251_100032716 | 391 |
| 48 | 3300009092 | Ga0105250_10000088 | Ga0105250_1000008828 | 391 |
| 49 | 3300009148 | Ga0105243_10176723 | Ga0105243_101767232 | 391 |
| 50 | 3300011119 | Ga0105246_10000174 | Ga0105246_100001745 | 391 |
| 51 | 3300013100 | Ga0157373_10002145 | Ga0157373_1000214511 | 391 |
| 52 | 3300017792 | Ga0163161_10002851 | Ga0163161_100028519 | 391 |
| 53 | 3300017792 | Ga0163161_10003420 | Ga0163161_1000342012 | 391 |
| 54 | 3300025206 | Ga0209435_103668 | Ga0209435_1036682 | 391 |
| 55 | 3300025224 | Ga0209784_100414 | Ga0209784_1004147 | 391 |
| 56 | 3300025225 | Ga0209566_100716 | Ga0209566_1007167 | 391 |
| 57 | 3300025226 | Ga0209674_100446 | Ga0209674_1004467 | 391 |
| 58 | 3300025229 | Ga0209147_100742 | Ga0209147_1007422 | 391 |
| 59 | 3300025230 | Ga0209563_100319 | Ga0209563_1003197 | 391 |
| 60 | 3300025242 | Ga0209258_100860 | Ga0209258_1008602 | 391 |
| 61 | 3300025246 | Ga0209646_1000543 | Ga0209646_10005432 | 391 |
| 62 | 3300025253 | Ga0209677_100627 | Ga0209677_1006277 | 391 |
| 63 | 3300025711 | Ga0207696_1000091 | Ga0207696_1000091130 | 391 |
| 64 | 3300025735 | Ga0207713_1000432 | Ga0207713_10004325 | 391 |
| 65 | 3300025735 | Ga0207713_1026716 | Ga0207713_10267162 | 391 |
| 66 | 3300031731 | Ga0307405_10000054 | Ga0307405_1000005415 | 391 |
| 67 | 3300046453 | Ga0495627_000530 | Ga0495627_000530_8028_9320 | 391 |
| 68 | 3300046458 | Ga0495591_000529 | Ga0495591_000529_20663_21955 | 391 |
| 69 | 3300046501 | Ga0495607_0008751 | Ga0495607_0008751_3408_4700 | 391 |
| 70 | 3300046507 | Ga0495606_0000725 | Ga0495606_0000725_25963_27255 | 391 |
| 71 | 3300046512 | Ga0495610_0001114 | Ga0495610_0001114_10322_11614 | 391 |
| 72 | 3300046512 | Ga0495610_0030819 | Ga0495610_0030819_402_1694 | 391 |
| 73 | 3300046515 | Ga0495620_0000224 | Ga0495620_0000224_32616_33908 | 391 |
| 74 | 3300046519 | Ga0495632_0000275 | Ga0495632_0000275_20677_21969 | 391 |
| 75 | 3300046665 | Ga0495661_0000698 | Ga0495661_0000698_9665_10957 | 391 |
| 76 | 3300046665 | Ga0495661_0000780 | Ga0495661_0000780_21123_22415 | 391 |
| 77 | 3300046794 | Ga0495589_0000490 | Ga0495589_0000490_19364_20656 | 391 |
| 78 | 3300047446 | Ga0495679_000226 | Ga0495679_000226_11675_12970 | 391 |
| 79 | 3300047446 | Ga0495679_010966 | Ga0495679_010966_850_2142 | 391 |
| 80 | 3300047470 | Ga0495681_0004774 | Ga0495681_0004774_276_1568 | 391 |
| 81 | 3300048920 | Ga0496117_0000597 | Ga0496117_0000597_4260_5552 | 391 |
| 82 | 3300048920 | Ga0496117_0073991 | Ga0496117_0073991_223_1515 | 391 |
| 83 | 3300048921 | Ga0496118_0014825 | Ga0496118_0014825_2154_3446 | 391 |
| 84 | 3300048921 | Ga0496118_0016520 | Ga0496118_0016520_2331_3623 | 391 |
| 85 | 3300048923 | Ga0496120_0007305 | Ga0496120_0007305_6769_8061 | 391 |
| 86 | 3300048925 | Ga0496122_0040668 | Ga0496122_0040668_1864_3156 | 391 |
| 87 | 3300048926 | Ga0496123_0037309 | Ga0496123_0037309_818_2110 | 391 |
| 88 | 3300048927 | Ga0496124_0001080 | Ga0496124_0001080_6330_7622 | 391 |
| 89 | 3300048927 | Ga0496124_0044863 | Ga0496124_0044863_1523_2815 | 391 |
| 90 | 3300048928 | Ga0496125_0000465 | Ga0496125_0000465_20954_22246 | 391 |
| 91 | 3300048928 | Ga0496125_0010799 | Ga0496125_0010799_6621_7913 | 391 |
| 92 | 3300048928 | Ga0496125_0023871 | Ga0496125_0023871_1267_2559 | 391 |
| 93 | 3300048928 | Ga0496125_0036515 | Ga0496125_0036515_1688_2980 | 391 |
| 94 | 3300048929 | Ga0496126_0005612 | Ga0496126_0005612_9113_10405 | 391 |
| 95 | 3300035170 | Ga0373943_0037106 | Ga0373943_0037106_28_1206 | 392 |
| 96 | 3300035725 | Ga0373947_0007862 | Ga0373947_0007862_18_1196 | 392 |
| 97 | 3300046517 | Ga0495630_0087358 | Ga0495630_0087358_45_1229 | 392 |
| 98 | 3300046474 | Ga0495605_0025507 | Ga0495605_0025507_469_1761 | 393 |
| 99 | 3300046616 | Ga0495668_0061189 | Ga0495668_0061189_511_1803 | 393 |
| 100 | 3300046810 | Ga0495660_0000072 | Ga0495660_0000072_93120_94412 | 393 |
| 101 | 3300060353 | Ga0501082_0010412 | Ga0501082_0010412_2389_3702 | 394 |
| 102 | iso_pu_bacteria | 2886848708 | 2886854934 | 394 |
| 103 | 3300005327 | Ga0070658_10016477 | Ga0070658_100164774 | 395 |
| 104 | 3300025909 | Ga0207705_10057204 | Ga0207705_100572042 | 395 |
| 105 | 3300035090 | Ga0373949_0020485 | Ga0373949_0020485_208_1410 | 395 |
| 106 | 3300035725 | Ga0373947_0164796 | Ga0373947_0164796_232_1425 | 397 |
| 107 | 3300046539 | Ga0495621_0012488 | Ga0495621_0012488_861_2054 | 397 |
| 108 | 3300048905 | Ga0496102_0089208 | Ga0496102_0089208_363_1556 | 397 |
| 109 | 3300046694 | Ga0495649_0007309 | Ga0495649_0007309_5348_6559 | 400 |
| 110 | 3300049742 | Ga0501080_0187434 | Ga0501080_0187434_256_1791 | 400 |
| 111 | 3300046681 | Ga0495647_0003356 | Ga0495647_0003356_3415_4620 | 401 |
| 112 | 3300046683 | Ga0495658_0035972 | Ga0495658_0035972_535_1740 | 401 |
| 113 | 3300053087 | Ga0500643_000169 | Ga0500643_000169_43554_44765 | 401 |
| 114 | 3300025292 | Ga0209676_1007332 | Ga0209676_10073325 | 403 |
| 115 | 3300006353 | Ga0075370_10139923 | Ga0075370_101399231 | 406 |
| 116 | 3300032005 | Ga0307411_10001564 | Ga0307411_100015645 | 406 |
| 117 | 3300050496 | nmdc:mga07m45_73054_c1 | nmdc:mga07m45_73054_c1_412_1728 | 406 |
| 118 | 3300042876 | Ga0451577_0181761 | Ga0451577_0181761_610_1836 | 408 |
| 119 | 3300047323 | Ga0495683_0001223 | Ga0495683_0001223_16065_17357 | 408 |
| 120 | 3300005341 | Ga0070691_10007419 | Ga0070691_100074195 | 409 |
| 121 | 3300005347 | Ga0070668_100026469 | Ga0070668_1000264692 | 409 |
| 122 | 3300025918 | Ga0207662_10033083 | Ga0207662_100330832 | 409 |
| 123 | 3300025923 | Ga0207681_10000883 | Ga0207681_1000088314 | 409 |
| 124 | 3300025972 | Ga0207668_10015582 | Ga0207668_100155822 | 409 |
| 125 | 3300026075 | Ga0207708_10004301 | Ga0207708_100043015 | 409 |
| 126 | 3300005328 | Ga0070676_10013640 | Ga0070676_100136402 | 410 |
| 127 | 3300005345 | Ga0070692_10025118 | Ga0070692_100251182 | 410 |
| 128 | 3300005353 | Ga0070669_100010755 | Ga0070669_1000107553 | 410 |
| 129 | 3300005356 | Ga0070674_100034832 | Ga0070674_1000348323 | 410 |
| 130 | 3300005364 | Ga0070673_100074412 | Ga0070673_1000744122 | 410 |
| 131 | 3300005367 | Ga0070667_100121522 | Ga0070667_1001215222 | 410 |
| 132 | 3300005457 | Ga0070662_100086660 | Ga0070662_1000866602 | 410 |
| 133 | 3300005544 | Ga0070686_100005320 | Ga0070686_1000053205 | 410 |
| 134 | 3300005719 | Ga0068861_100024260 | Ga0068861_1000242602 | 410 |
| 135 | 3300005843 | Ga0068860_100069151 | Ga0068860_1000691512 | 410 |
| 136 | 3300005844 | Ga0068862_100040741 | Ga0068862_1000407415 | 410 |
| 137 | 3300006881 | Ga0068865_100001035 | Ga0068865_1000010355 | 410 |
| 138 | 3300009148 | Ga0105243_10070754 | Ga0105243_100707543 | 410 |
| 139 | 3300025907 | Ga0207645_10003294 | Ga0207645_100032946 | 410 |
| 140 | 3300025933 | Ga0207706_10088459 | Ga0207706_100884593 | 410 |
| 141 | 3300025937 | Ga0207669_10005612 | Ga0207669_100056122 | 410 |
| 142 | 3300025938 | Ga0207704_10001205 | Ga0207704_100012054 | 410 |
| 143 | 3300026089 | Ga0207648_10026748 | Ga0207648_100267483 | 410 |
| 144 | 3300026118 | Ga0207675_100003701 | Ga0207675_1000037016 | 410 |
| 145 | 3300026121 | Ga0207683_10011402 | Ga0207683_100114028 | 410 |
| 146 | 3300032004 | Ga0307414_10011556 | Ga0307414_100115563 | 411 |
| 147 | 3300048923 | Ga0496120_0111207 | Ga0496120_0111207_18_1253 | 411 |
| 148 | 3300053730 | Ga0500645_010478 | Ga0500645_010478_1672_2994 | 411 |
| 149 | 3300009093 | Ga0105240_10009287 | Ga0105240_100092876 | 412 |
| 150 | 3300025913 | Ga0207695_10061489 | Ga0207695_100614892 | 412 |
| 151 | 3300046492 | Ga0495585_0001381 | Ga0495585_0001381_12178_13491 | 412 |
| 152 | 3300046616 | Ga0495668_0000008 | Ga0495668_0000008_277549_278865 | 412 |
| 153 | 3300046665 | Ga0495661_0000150 | Ga0495661_0000150_37434_38747 | 412 |
| 154 | 3300049584 | Ga0501068_0125863 | Ga0501068_0125863_311_1549 | 412 |
| 155 | iso_pu_bacteria | 2879110137 | 2879118308 | 412 |
| 156 | 3300005456 | Ga0070678_100013489 | Ga0070678_1000134892 | 413 |
| 157 | 3300041411 | Ga0439466_0053396 | Ga0439466_0053396_36_1277 | 413 |
| 158 | 3300031911 | Ga0307412_10060034 | Ga0307412_100600342 | 414 |
| 159 | 3300031995 | Ga0307409_100129374 | Ga0307409_1001293742 | 414 |
| 160 | 3300046471 | Ga0495650_0003122 | Ga0495650_0003122_5183_6433 | 414 |
| 161 | 3300046472 | Ga0495580_0001063 | Ga0495580_0001063_16735_17979 | 414 |
| 162 | 3300046506 | Ga0495583_0001527 | Ga0495583_0001527_10897_12147 | 414 |
| 163 | 3300046512 | Ga0495610_0008547 | Ga0495610_0008547_2699_3949 | 414 |
| 164 | 3300046519 | Ga0495632_0003902 | Ga0495632_0003902_6082_7332 | 414 |
| 165 | 3300046520 | Ga0495637_0005703 | Ga0495637_0005703_4414_5664 | 414 |
| 166 | 3300046665 | Ga0495661_0000193 | Ga0495661_0000193_26394_27644 | 414 |
| 167 | 3300004625 | Ga0055543_1005977 | Ga0055543_10059772 | 415 |
| 168 | 3300005262 | Ga0065165_1000059 | Ga0065165_100005915 | 415 |
| 169 | 3300005842 | Ga0068858_100002537 | Ga0068858_10000253712 | 415 |
| 170 | 3300026035 | Ga0207703_10026738 | Ga0207703_100267383 | 415 |
| 171 | 3300048915 | Ga0496112_0093879 | Ga0496112_0093879_1158_2468 | 415 |
| 172 | 3300028666 | Ga0265336_10000039 | Ga0265336_1000003969 | 417 |
| 173 | 3300029957 | Ga0265324_10000223 | Ga0265324_1000022330 | 417 |
| 174 | 3300031239 | Ga0265328_10002757 | Ga0265328_100027573 | 417 |
| 175 | 3300042015 | Ga0439462_0020776 | Ga0439462_0020776_370_1689 | 417 |
| 176 | 3300060353 | Ga0501082_0257624 | Ga0501082_0257624_30_1325 | 417 |
| 177 | iso_pu_bacteria | 2928972540 | 2928975396 | 417 |
| 178 | 3300005343 | Ga0070687_100039170 | Ga0070687_1000391702 | 418 |
| 179 | 3300005367 | Ga0070667_100040210 | Ga0070667_1000402101 | 418 |
| 180 | 3300005616 | Ga0068852_100029633 | Ga0068852_1000296332 | 418 |
| 181 | 3300005842 | Ga0068858_100014317 | Ga0068858_1000143172 | 418 |
| 182 | 3300013308 | Ga0157375_10056502 | Ga0157375_100565023 | 418 |
| 183 | 3300014326 | Ga0157380_10013364 | Ga0157380_100133645 | 418 |
| 184 | 3300014968 | Ga0157379_10002335 | Ga0157379_100023353 | 418 |
| 185 | 3300025918 | Ga0207662_10027596 | Ga0207662_100275962 | 418 |
| 186 | 3300025940 | Ga0207691_10040837 | Ga0207691_100408373 | 418 |
| 187 | 3300025941 | Ga0207711_10036064 | Ga0207711_100360643 | 418 |
| 188 | 3300026035 | Ga0207703_10047521 | Ga0207703_100475213 | 418 |
| 189 | 3300026142 | Ga0207698_10192873 | Ga0207698_101928732 | 418 |
| 190 | 3300028381 | Ga0268264_10097899 | Ga0268264_100978992 | 418 |
| 191 | 3300042139 | Ga0450904_000412 | Ga0450904_000412_3578_4900 | 418 |
| 192 | 3300046512 | Ga0495610_0000021 | Ga0495610_0000021_215680_217020 | 418 |
| 193 | 3300046660 | Ga0495625_0035111 | Ga0495625_0035111_464_1804 | 418 |
| 194 | 3300046500 | Ga0495596_0002737 | Ga0495596_0002737_4291_5589 | 419 |
| 195 | 3300046519 | Ga0495632_0062559 | Ga0495632_0062559_240_1583 | 419 |
| 196 | 3300048091 | Ga0495626_0000796 | Ga0495626_0000796_17772_19070 | 419 |
| 197 | 3300031824 | Ga0307413_10054238 | Ga0307413_100542383 | 420 |
| 198 | 3300031852 | Ga0307410_10152065 | Ga0307410_101520652 | 420 |
| 199 | 3300039447 | Ga0436361_0303811 | Ga0436361_0303811_688_2022 | 420 |
| 200 | 3300046460 | Ga0495638_0001443 | Ga0495638_0001443_10383_11711 | 420 |
| 201 | 3300048913 | Ga0496110_0197765 | Ga0496110_0197765_274_1542 | 420 |
| 202 | 3300048927 | Ga0496124_0158316 | Ga0496124_0158316_409_1677 | 420 |
| 203 | 3300050493 | nmdc:mga0k408_26218_c1 | nmdc:mga0k408_26218_c1_1105_2448 | 420 |
| 204 | iso_pu_bacteria | 2643221614 | 2644085854 | 420 |
| 205 | iso_pu_bacteria | 2643221661 | 2644344970 | 420 |
| 206 | iso_pu_bacteria | 2643221666 | 2644369244 | 420 |
| 207 | 3300013104 | Ga0157370_10009550 | Ga0157370_1000955011 | 421 |
| 208 | 3300025925 | Ga0207650_10009278 | Ga0207650_100092787 | 421 |
| 209 | iso_pu_bacteria | 2842805378 | 2842807655 | 421 |
| 210 | 3300005355 | Ga0070671_100110412 | Ga0070671_1001104121 | 422 |
| 211 | 3300005618 | Ga0068864_100027732 | Ga0068864_1000277322 | 422 |
| 212 | 3300005841 | Ga0068863_100007312 | Ga0068863_10000731210 | 422 |
| 213 | 3300005843 | Ga0068860_100026094 | Ga0068860_1000260944 | 422 |
| 214 | 3300006880 | Ga0075429_100000296 | Ga0075429_10000029618 | 422 |
| 215 | 3300010375 | Ga0105239_10008186 | Ga0105239_100081866 | 422 |
| 216 | 3300013308 | Ga0157375_10267250 | Ga0157375_102672502 | 422 |
| 217 | 3300014968 | Ga0157379_10034552 | Ga0157379_100345526 | 422 |
| 218 | 3300015261 | Ga0182006_1000116 | Ga0182006_100011653 | 422 |
| 219 | 3300015265 | Ga0182005_1000003 | Ga0182005_1000003178 | 422 |
| 220 | 3300025931 | Ga0207644_10177020 | Ga0207644_101770201 | 422 |
| 221 | 3300026035 | Ga0207703_10229393 | Ga0207703_102293932 | 422 |
| 222 | 3300026088 | Ga0207641_10032348 | Ga0207641_100323482 | 422 |
| 223 | 3300026095 | Ga0207676_10025509 | Ga0207676_100255093 | 422 |
| 224 | 3300037471 | Ga0395905_0081841 | Ga0395905_0081841_1427_2734 | 422 |
| 225 | 3300050508 | nmdc:mga09592_436_c1 | nmdc:mga09592_436_c1_12168_13493 | 422 |
| 226 | 3300050509 | nmdc:mga0qj67_3156_c1 | nmdc:mga0qj67_3156_c1_3716_5041 | 422 |
| 227 | 3300005336 | Ga0070680_100007963 | Ga0070680_1000079632 | 423 |
| 228 | 3300005337 | Ga0070682_100046482 | Ga0070682_1000464821 | 423 |
| 229 | 3300005340 | Ga0070689_100035468 | Ga0070689_1000354682 | 423 |
| 230 | 3300005341 | Ga0070691_10002047 | Ga0070691_100020474 | 423 |
| 231 | 3300005343 | Ga0070687_100000955 | Ga0070687_10000095510 | 423 |
| 232 | 3300005438 | Ga0070701_10002657 | Ga0070701_100026577 | 423 |
| 233 | 3300005444 | Ga0070694_100007042 | Ga0070694_1000070428 | 423 |
| 234 | 3300005458 | Ga0070681_10105664 | Ga0070681_101056643 | 423 |
| 235 | 3300005546 | Ga0070696_100000013 | Ga0070696_1000000139 | 423 |
| 236 | 3300005844 | Ga0068862_100043353 | Ga0068862_1000433532 | 423 |
| 237 | 3300006237 | Ga0097621_100003933 | Ga0097621_1000039332 | 423 |
| 238 | 3300009176 | Ga0105242_10003223 | Ga0105242_100032238 | 423 |
| 239 | 3300025909 | Ga0207705_10022392 | Ga0207705_100223921 | 423 |
| 240 | 3300025918 | Ga0207662_10002300 | Ga0207662_100023005 | 423 |
| 241 | 3300025934 | Ga0207686_10003655 | Ga0207686_100036553 | 423 |
| 242 | 3300025935 | Ga0207709_10006905 | Ga0207709_100069057 | 423 |
| 243 | 3300025936 | Ga0207670_10007157 | Ga0207670_100071573 | 423 |
| 244 | 3300025940 | Ga0207691_10152739 | Ga0207691_101527391 | 423 |
| 245 | 3300025942 | Ga0207689_10001368 | Ga0207689_1000136827 | 423 |
| 246 | 3300026075 | Ga0207708_10000114 | Ga0207708_1000011416 | 423 |
| 247 | 3300026088 | Ga0207641_10220374 | Ga0207641_102203741 | 423 |
| 248 | 3300026118 | Ga0207675_100009061 | Ga0207675_1000090612 | 423 |
| 249 | 3300035115 | Ga0373941_0019456 | Ga0373941_0019456_10_1293 | 423 |
| 250 | 3300045051 | Ga0451576_0000220 | Ga0451576_0000220_53965_55248 | 423 |
| 251 | 3300045051 | Ga0451576_0011312 | Ga0451576_0011312_2462_3745 | 423 |
| 252 | 3300047472 | Ga0495686_0001396 | Ga0495686_0001396_6475_7767 | 423 |
| 253 | 3300050491 | nmdc:mga00v17_103677_c1 | nmdc:mga00v17_103677_c1_72_1355 | 423 |
| 254 | 3300050492 | nmdc:mga0yw44_18038_c1 | nmdc:mga0yw44_18038_c1_91_1374 | 423 |
| 255 | 3300005262 | Ga0065165_1000598 | Ga0065165_100059816 | 424 |
| 256 | 3300005844 | Ga0068862_100031145 | Ga0068862_1000311456 | 424 |
| 257 | 3300006038 | Ga0075365_10199719 | Ga0075365_101997191 | 424 |
| 258 | 3300006051 | Ga0075364_10016895 | Ga0075364_100168953 | 424 |
| 259 | 3300006946 | Ga0079104_1017736 | Ga0079104_10177361 | 424 |
| 260 | 3300014326 | Ga0157380_10002683 | Ga0157380_100026836 | 424 |
| 261 | 3300026067 | Ga0207678_10132975 | Ga0207678_101329753 | 424 |
| 262 | 3300026089 | Ga0207648_10073941 | Ga0207648_100739412 | 424 |
| 263 | 3300027111 | Ga0209281_1007615 | Ga0209281_10076152 | 424 |
| 264 | 3300028380 | Ga0268265_10128985 | Ga0268265_101289852 | 424 |
| 265 | 3300032004 | Ga0307414_10061929 | Ga0307414_100619292 | 424 |
| 266 | 3300046460 | Ga0495638_0003221 | Ga0495638_0003221_7102_8448 | 424 |
| 267 | 3300005329 | Ga0070683_100042465 | Ga0070683_1000424653 | 425 |
| 268 | 3300005339 | Ga0070660_100006633 | Ga0070660_1000066332 | 425 |
| 269 | 3300005435 | Ga0070714_100005978 | Ga0070714_1000059782 | 425 |
| 270 | 3300025919 | Ga0207657_10010663 | Ga0207657_100106639 | 425 |
| 271 | 3300025929 | Ga0207664_10015167 | Ga0207664_100151672 | 425 |
| 272 | 3300025932 | Ga0207690_10003250 | Ga0207690_100032508 | 425 |
| 273 | 3300048924 | Ga0496121_0028522 | Ga0496121_0028522_2283_3563 | 425 |
| 274 | iso_pu_bacteria | 639633007 | 639787302 | 425 |
| 275 | 3300046460 | Ga0495638_0091408 | Ga0495638_0091408_281_1639 | 426 |
| 276 | 3300009092 | Ga0105250_10000261 | Ga0105250_100002617 | 427 |
| 277 | 3300009147 | Ga0114129_10189357 | Ga0114129_101893572 | 427 |
| 278 | 3300013100 | Ga0157373_10006136 | Ga0157373_100061368 | 427 |
| 279 | 3300013105 | Ga0157369_10207891 | Ga0157369_102078911 | 427 |
| 280 | 3300014745 | Ga0157377_10025602 | Ga0157377_100256022 | 427 |
| 281 | 3300025908 | Ga0207643_10046800 | Ga0207643_100468002 | 427 |
| 282 | 3300039447 | Ga0436361_1035230 | Ga0436361_1035230_2339_3694 | 427 |
| 283 | 3300046810 | Ga0495660_0044433 | Ga0495660_0044433_466_1749 | 427 |
| 284 | 3300047470 | Ga0495681_0059744 | Ga0495681_0059744_467_1750 | 427 |
| 285 | 3300003215 | JGI25153J46596_10028772 | JGI25153J46596_100287722 | 428 |
| 286 | 3300003771 | Ga0055526_1000052 | Ga0055526_1000052109 | 428 |
| 287 | 3300009036 | Ga0105244_10002140 | Ga0105244_1000214012 | 428 |
| 288 | 3300025245 | Ga0207425_1000346 | Ga0207425_100034610 | 428 |
| 289 | 3300025295 | Ga0209564_1000026 | Ga0209564_1000026258 | 428 |
| 290 | 3300025297 | Ga0209758_1000314 | Ga0209758_100031410 | 428 |
| 291 | 3300025728 | Ga0207655_1003222 | Ga0207655_100322212 | 428 |
| 292 | 3300046501 | Ga0495607_0010963 | Ga0495607_0010963_2396_3706 | 428 |
| 293 | 3300046507 | Ga0495606_0004441 | Ga0495606_0004441_2625_3941 | 428 |
| 294 | 3300053125 | Ga0500618_000601 | Ga0500618_000601_18635_19972 | 428 |
| 295 | 3300002987 | JGI25159J45721_1003747 | JGI25159J45721_10037476 | 429 |
| 296 | 3300005262 | Ga0065165_1000099 | Ga0065165_100009949 | 429 |
| 297 | 3300005615 | Ga0070702_100090282 | Ga0070702_1000902822 | 429 |
| 298 | 3300046460 | Ga0495638_0011834 | Ga0495638_0011834_614_1912 | 429 |
| 299 | 3300046491 | Ga0495584_0000875 | Ga0495584_0000875_6291_7589 | 429 |
| 300 | 3300046506 | Ga0495583_0005777 | Ga0495583_0005777_4803_6101 | 429 |
| 301 | 3300046616 | Ga0495668_0012451 | Ga0495668_0012451_105_1403 | 429 |
| 302 | 3300046660 | Ga0495625_0002093 | Ga0495625_0002093_767_2065 | 429 |
| 303 | 3300046664 | Ga0495659_0003719 | Ga0495659_0003719_566_1864 | 429 |
| 304 | 3300046665 | Ga0495661_0003350 | Ga0495661_0003350_6697_7995 | 429 |
| 305 | 3300046684 | Ga0495669_0002301 | Ga0495669_0002301_5129_6427 | 429 |
| 306 | 3300046694 | Ga0495649_0003451 | Ga0495649_0003451_9151_10449 | 429 |
| 307 | 3300046810 | Ga0495660_0047438 | Ga0495660_0047438_429_1727 | 429 |
| 308 | 3300047318 | Ga0495636_0006614 | Ga0495636_0006614_665_1963 | 429 |
| 309 | 3300047443 | Ga0495687_014395 | Ga0495687_014395_312_1610 | 429 |
| 310 | 3300047447 | Ga0495685_007440 | Ga0495685_007440_1803_3101 | 429 |
| 311 | 3300053080 | Ga0500635_0000449 | Ga0500635_0000449_1551_2861 | 429 |
| 312 | 3300005336 | Ga0070680_100183242 | Ga0070680_1001832421 | 430 |
| 313 | 3300005345 | Ga0070692_10001360 | Ga0070692_100013608 | 430 |
| 314 | 3300005347 | Ga0070668_100024477 | Ga0070668_1000244773 | 430 |
| 315 | 3300005353 | Ga0070669_100026167 | Ga0070669_1000261672 | 430 |
| 316 | 3300005441 | Ga0070700_100001557 | Ga0070700_10000155712 | 430 |
| 317 | 3300005459 | Ga0068867_100131378 | Ga0068867_1001313782 | 430 |
| 318 | 3300005466 | Ga0070685_10004412 | Ga0070685_100044124 | 430 |
| 319 | 3300005719 | Ga0068861_100002744 | Ga0068861_1000027449 | 430 |
| 320 | 3300005844 | Ga0068862_100001151 | Ga0068862_10000115117 | 430 |
| 321 | 3300006846 | Ga0075430_100003367 | Ga0075430_10000336715 | 430 |
| 322 | 3300009094 | Ga0111539_10172607 | Ga0111539_101726072 | 430 |
| 323 | 3300009148 | Ga0105243_10020789 | Ga0105243_100207894 | 430 |
| 324 | 3300009551 | Ga0105238_10142860 | Ga0105238_101428602 | 430 |
| 325 | 3300013296 | Ga0157374_10004803 | Ga0157374_100048035 | 430 |
| 326 | 3300025899 | Ga0207642_10030927 | Ga0207642_100309272 | 430 |
| 327 | 3300025917 | Ga0207660_10013510 | Ga0207660_100135105 | 430 |
| 328 | 3300025923 | Ga0207681_10045876 | Ga0207681_100458762 | 430 |
| 329 | 3300025933 | Ga0207706_10119314 | Ga0207706_101193142 | 430 |
| 330 | 3300025935 | Ga0207709_10013101 | Ga0207709_100131014 | 430 |
| 331 | 3300025937 | Ga0207669_10013934 | Ga0207669_100139343 | 430 |
| 332 | 3300025972 | Ga0207668_10018685 | Ga0207668_100186853 | 430 |
| 333 | 3300026075 | Ga0207708_10003529 | Ga0207708_100035293 | 430 |
| 334 | 3300026089 | Ga0207648_10001471 | Ga0207648_1000147119 | 430 |
| 335 | 3300026118 | Ga0207675_100003064 | Ga0207675_1000030643 | 430 |
| 336 | 3300027907 | Ga0207428_10119781 | Ga0207428_101197812 | 430 |
| 337 | 3300028380 | Ga0268265_10000621 | Ga0268265_1000062141 | 430 |
| 338 | 3300031852 | Ga0307410_10187076 | Ga0307410_101870762 | 430 |
| 339 | 3300031901 | Ga0307406_10083892 | Ga0307406_100838921 | 430 |
| 340 | 3300031995 | Ga0307409_100011300 | Ga0307409_1000113004 | 430 |
| 341 | 3300031995 | Ga0307409_100238299 | Ga0307409_1002382991 | 430 |
| 342 | 3300042117 | Ga0450913_000144 | Ga0450913_000144_387_1700 | 430 |
| 343 | 3300047320 | Ga0495672_0000014 | Ga0495672_0000014_204517_205911 | 430 |
| 344 | 3300050511 | nmdc:mga08y16_132262_c1 | nmdc:mga08y16_132262_c1_784_2091 | 430 |
| 345 | 3300053151 | Ga0500604_0020364 | Ga0500604_0020364_189_1481 | 430 |
| 346 | iso_pu_bacteria | 2643221577 | 2643894702 | 430 |
| 347 | iso_pu_bacteria | 2643221685 | 2644476851 | 430 |
| 348 | iso_pu_bacteria | 2857564685 | 2857566204 | 430 |
| 349 | 3300021361 | Ga0213872_10001285 | Ga0213872_100012853 | 431 |
| 350 | 3300032002 | Ga0307416_100110227 | Ga0307416_1001102272 | 431 |
| 351 | 3300039447 | Ga0436361_0165235 | Ga0436361_0165235_3532_4869 | 431 |
| 352 | 3300046471 | Ga0495650_0002849 | Ga0495650_0002849_6922_8256 | 431 |
| 353 | 3300046520 | Ga0495637_0000057 | Ga0495637_0000057_7207_8541 | 431 |
| 354 | 3300046530 | Ga0495654_0000005 | Ga0495654_0000005_184992_186326 | 431 |
| 355 | 3300047469 | Ga0495673_0000033 | Ga0495673_0000033_199344_200669 | 431 |
| 356 | 3300048929 | Ga0496126_0005176 | Ga0496126_0005176_3301_4626 | 431 |
| 357 | 3300003775 | Ga0055524_1012896 | Ga0055524_10128963 | 432 |
| 358 | 3300003794 | Ga0055531_10004923 | Ga0055531_100049237 | 432 |
| 359 | 3300005614 | Ga0068856_100120658 | Ga0068856_1001206582 | 432 |
| 360 | 3300013296 | Ga0157374_10000958 | Ga0157374_1000095811 | 432 |
| 361 | 3300025298 | Ga0209050_1002726 | Ga0209050_10027263 | 432 |
| 362 | 3300025299 | Ga0209256_1001776 | Ga0209256_10017763 | 432 |
| 363 | 3300025303 | Ga0209051_1001190 | Ga0209051_100119016 | 432 |
| 364 | 3300025304 | Ga0209257_1002005 | Ga0209257_100200514 | 432 |
| 365 | 3300031456 | Ga0307513_10000066 | Ga0307513_1000006690 | 432 |
| 366 | 3300044694 | Ga0466963_0113030 | Ga0466963_0113030_140_1585 | 432 |
| 367 | 3300048929 | Ga0496126_0092616 | Ga0496126_0092616_1259_2581 | 432 |
| 368 | 3300049460 | Ga0495682_0000234 | Ga0495682_0000234_9621_10925 | 432 |
| 369 | 3300053122 | Ga0500608_000123 | Ga0500608_000123_328_1650 | 432 |
| 370 | iso_pu_bacteria | 2838074704 | 2838077047 | 432 |
| 371 | iso_pu_bacteria | 2896384573 | 2896385849 | 432 |
| 372 | iso_pu_bacteria | 2920760137 | 2920761782 | 432 |
| 373 | 3300005262 | Ga0065165_1000378 | Ga0065165_10003787 | 433 |
| 374 | 3300009093 | Ga0105240_10191888 | Ga0105240_101918882 | 433 |
| 375 | 3300025256 | Ga0209759_1004314 | Ga0209759_10043146 | 433 |
| 376 | 3300025909 | Ga0207705_10023899 | Ga0207705_100238995 | 433 |
| 377 | 3300025913 | Ga0207695_10135915 | Ga0207695_101359152 | 433 |
| 378 | 3300025986 | Ga0207658_10023813 | Ga0207658_100238134 | 433 |
| 379 | 3300037471 | Ga0395905_0019451 | Ga0395905_0019451_4149_5477 | 433 |
| 380 | 3300039453 | Ga0436362_0866046 | Ga0436362_0866046_882_2210 | 433 |
| 381 | 3300046615 | Ga0495656_0000940 | Ga0495656_0000940_2572_3909 | 433 |
| 382 | 3300047472 | Ga0495686_0032698 | Ga0495686_0032698_2010_3350 | 433 |
| 383 | 3300049766 | Ga0501269_000526 | Ga0501269_000526_4556_5980 | 433 |
| 384 | 3300005343 | Ga0070687_100034798 | Ga0070687_1000347981 | 434 |
| 385 | 3300005343 | Ga0070687_100053725 | Ga0070687_1000537252 | 434 |
| 386 | 3300005366 | Ga0070659_100010688 | Ga0070659_1000106883 | 434 |
| 387 | 3300005563 | Ga0068855_100155441 | Ga0068855_1001554412 | 434 |
| 388 | 3300009011 | Ga0105251_10002666 | Ga0105251_100026668 | 434 |
| 389 | 3300009011 | Ga0105251_10013975 | Ga0105251_100139753 | 434 |
| 390 | 3300009036 | Ga0105244_10029049 | Ga0105244_100290492 | 434 |
| 391 | 3300009148 | Ga0105243_10019654 | Ga0105243_100196544 | 434 |
| 392 | 3300014968 | Ga0157379_10082432 | Ga0157379_100824322 | 434 |
| 393 | 3300025728 | Ga0207655_1000113 | Ga0207655_1000113131 | 434 |
| 394 | 3300025728 | Ga0207655_1021767 | Ga0207655_10217673 | 434 |
| 395 | 3300025919 | Ga0207657_10008770 | Ga0207657_100087705 | 434 |
| 396 | 3300025935 | Ga0207709_10034258 | Ga0207709_100342582 | 434 |
| 397 | 3300046453 | Ga0495627_000888 | Ga0495627_000888_8202_9518 | 434 |
| 398 | 3300046463 | Ga0495653_0009457 | Ga0495653_0009457_5661_6974 | 434 |
| 399 | 3300046507 | Ga0495606_0009506 | Ga0495606_0009506_822_2135 | 434 |
| 400 | 3300046518 | Ga0495631_0006268 | Ga0495631_0006268_710_2026 | 434 |
| 401 | 3300046519 | Ga0495632_0006116 | Ga0495632_0006116_5914_7230 | 434 |
| 402 | 3300046519 | Ga0495632_0008775 | Ga0495632_0008775_10_1326 | 434 |
| 403 | 3300046520 | Ga0495637_0038642 | Ga0495637_0038642_597_1910 | 434 |
| 404 | 3300046530 | Ga0495654_0001418 | Ga0495654_0001418_5763_7079 | 434 |
| 405 | 3300046692 | Ga0495671_0002178 | Ga0495671_0002178_3192_4508 | 434 |
| 406 | 3300047320 | Ga0495672_0003595 | Ga0495672_0003595_1581_2897 | 434 |
| 407 | 3300049459 | Ga0495678_021657 | Ga0495678_021657_793_2106 | 434 |
| 408 | iso_pu_bacteria | 2513237144 | 2513912122 | 434 |
| 409 | iso_pu_bacteria | 2513237146 | 2513924029 | 434 |
| 410 | iso_pu_bacteria | 2599185170 | 2599416073 | 434 |
| 411 | iso_pu_bacteria | 2838035591 | 2838036195 | 434 |
| 412 | iso_pu_bacteria | 2838661181 | 2838666466 | 434 |
| 413 | iso_pu_bacteria | 3005409236 | 3005413418 | 434 |
| 414 | iso_pu_bacteria | 3007419365 | 3007424613 | 434 |
| 415 | 3300005328 | Ga0070676_10067197 | Ga0070676_100671973 | 435 |
| 416 | 3300005337 | Ga0070682_100027876 | Ga0070682_1000278762 | 435 |
| 417 | 3300009148 | Ga0105243_10057254 | Ga0105243_100572543 | 435 |
| 418 | 3300009148 | Ga0105243_10123536 | Ga0105243_101235363 | 435 |
| 419 | 3300017792 | Ga0163161_10082863 | Ga0163161_100828633 | 435 |
| 420 | 3300025907 | Ga0207645_10076298 | Ga0207645_100762981 | 435 |
| 421 | 3300025935 | Ga0207709_10022219 | Ga0207709_100222193 | 435 |
| 422 | 3300026041 | Ga0207639_10022982 | Ga0207639_100229823 | 435 |
| 423 | 3300031456 | Ga0307513_10019665 | Ga0307513_100196656 | 435 |
| 424 | 3300031730 | Ga0307516_10029384 | Ga0307516_100293846 | 435 |
| 425 | 3300042125 | Ga0450923_003832 | Ga0450923_003832_514_1857 | 435 |
| 426 | 3300042156 | Ga0439446_0008790 | Ga0439446_0008790_689_2032 | 435 |
| 427 | 3300042156 | Ga0439446_0018222 | Ga0439446_0018222_449_1774 | 435 |
| 428 | 3300042435 | Ga0439434_0004984 | Ga0439434_0004984_2236_3579 | 435 |
| 429 | 3300042531 | Ga0450918_003841 | Ga0450918_003841_676_2001 | 435 |
| 430 | 3300046460 | Ga0495638_0005791 | Ga0495638_0005791_196_1521 | 435 |
| 431 | 3300046501 | Ga0495607_0002057 | Ga0495607_0002057_1014_2330 | 435 |
| 432 | 3300046539 | Ga0495621_0003116 | Ga0495621_0003116_2998_4482 | 435 |
| 433 | 3300046660 | Ga0495625_0006426 | Ga0495625_0006426_1651_2976 | 435 |
| 434 | 3300046694 | Ga0495649_0001376 | Ga0495649_0001376_16156_17472 | 435 |
| 435 | 3300047321 | Ga0495676_0001551 | Ga0495676_0001551_16780_18096 | 435 |
| 436 | 3300050493 | nmdc:mga0k408_68597_c1 | nmdc:mga0k408_68597_c1_90_1418 | 435 |
| 437 | 3300053125 | Ga0500618_013509 | Ga0500618_013509_592_2040 | 435 |
| 438 | iso_pu_bacteria | 2597489887 | 2597859534 | 435 |
| 439 | 3300005336 | Ga0070680_100162156 | Ga0070680_1001621562 | 436 |
| 440 | 3300005530 | Ga0070679_100109683 | Ga0070679_1001096832 | 436 |
| 441 | 3300013100 | Ga0157373_10014390 | Ga0157373_100143902 | 436 |
| 442 | 3300013306 | Ga0163162_10117349 | Ga0163162_101173492 | 436 |
| 443 | 3300031616 | Ga0307508_10117654 | Ga0307508_101176541 | 436 |
| 444 | 3300047472 | Ga0495686_0000075 | Ga0495686_0000075_34978_36348 | 436 |
| 445 | 3300049570 | Ga0501033_0140251 | Ga0501033_0140251_84_1412 | 436 |
| 446 | 3300049572 | Ga0501036_0113813 | Ga0501036_0113813_739_2067 | 436 |
| 447 | 3300049574 | Ga0501038_0071930 | Ga0501038_0071930_1525_2853 | 436 |
| 448 | 3300049578 | Ga0501042_0022237 | Ga0501042_0022237_2851_4179 | 436 |
| 449 | 3300049580 | Ga0501046_0048746 | Ga0501046_0048746_1509_2837 | 436 |
| 450 | 3300049582 | Ga0501048_0117177 | Ga0501048_0117177_371_1699 | 436 |
| 451 | 3300049586 | Ga0501070_0087678 | Ga0501070_0087678_60_1388 | 436 |
| 452 | 3300049587 | Ga0501071_0006469 | Ga0501071_0006469_3361_4689 | 436 |
| 453 | 3300049588 | Ga0501072_0009204 | Ga0501072_0009204_861_2189 | 436 |
| 454 | 3300049590 | Ga0501074_0081114 | Ga0501074_0081114_433_1761 | 436 |
| 455 | 3300049592 | Ga0501076_0007362 | Ga0501076_0007362_4313_5641 | 436 |
| 456 | 3300049593 | Ga0501077_0024467 | Ga0501077_0024467_1542_2870 | 436 |
| 457 | 3300049741 | Ga0501079_0020373 | Ga0501079_0020373_3714_5042 | 436 |
| 458 | 3300049743 | Ga0501081_0046870 | Ga0501081_0046870_381_1709 | 436 |
| 459 | 3300049824 | Ga0501045_0013719 | Ga0501045_0013719_100_1428 | 436 |
| 460 | 3300060353 | Ga0501082_0023373 | Ga0501082_0023373_462_1790 | 436 |
| 461 | iso_pu_bacteria | 2643221570 | 2643865711 | 436 |
| 462 | iso_pu_bacteria | 2643221652 | 2644294411 | 436 |
| 463 | 3300003659 | JGI25404J52841_10006004 | JGI25404J52841_100060042 | 437 |
| 464 | 3300003775 | Ga0055524_1000117 | Ga0055524_100011723 | 437 |
| 465 | 3300003794 | Ga0055531_10005573 | Ga0055531_100055739 | 437 |
| 466 | 3300005548 | Ga0070665_100124454 | Ga0070665_1001244543 | 437 |
| 467 | 3300005983 | Ga0081540_1000663 | Ga0081540_100066353 | 437 |
| 468 | 3300009174 | Ga0105241_10000171 | Ga0105241_1000017129 | 437 |
| 469 | 3300012475 | Ga0157317_1000800 | Ga0157317_10008001 | 437 |
| 470 | 3300012497 | Ga0157319_1000024 | Ga0157319_100002437 | 437 |
| 471 | 3300025299 | Ga0209256_1000075 | Ga0209256_100007560 | 437 |
| 472 | 3300025304 | Ga0209257_1000244 | Ga0209257_100024451 | 437 |
| 473 | 3300025911 | Ga0207654_10000134 | Ga0207654_1000013430 | 437 |
| 474 | 3300031507 | Ga0307509_10002265 | Ga0307509_1000226524 | 437 |
| 475 | 3300033180 | Ga0307510_10008623 | Ga0307510_1000862312 | 437 |
| 476 | 3300042438 | Ga0439459_0007697 | Ga0439459_0007697_76_1497 | 437 |
| 477 | 3300046454 | Ga0495592_0053899 | Ga0495592_0053899_661_1983 | 437 |
| 478 | 3300053136 | Ga0500559_0000954 | Ga0500559_0000954_1076_2398 | 437 |
| 479 | 3300053156 | Ga0500622_0003490 | Ga0500622_0003490_1458_2780 | 437 |
| 480 | 3300005458 | Ga0070681_10021034 | Ga0070681_100210341 | 438 |
| 481 | 3300006058 | Ga0075432_10001028 | Ga0075432_100010286 | 438 |
| 482 | 3300006194 | Ga0075427_10000673 | Ga0075427_100006732 | 438 |
| 483 | 3300006846 | Ga0075430_100000332 | Ga0075430_10000033211 | 438 |
| 484 | 3300006847 | Ga0075431_100008089 | Ga0075431_1000080897 | 438 |
| 485 | 3300006871 | Ga0075434_100000647 | Ga0075434_10000064727 | 438 |
| 486 | 3300006880 | Ga0075429_100000451 | Ga0075429_10000045126 | 438 |
| 487 | 3300007076 | Ga0075435_100000630 | Ga0075435_1000006306 | 438 |
| 488 | 3300009094 | Ga0111539_10002056 | Ga0111539_100020563 | 438 |
| 489 | 3300009147 | Ga0114129_10016414 | Ga0114129_100164143 | 438 |
| 490 | 3300014497 | Ga0182008_10032776 | Ga0182008_100327762 | 438 |
| 491 | 3300025295 | Ga0209564_1000097 | Ga0209564_100009776 | 438 |
| 492 | 3300025912 | Ga0207707_10184056 | Ga0207707_101840561 | 438 |
| 493 | 3300025921 | Ga0207652_10212463 | Ga0207652_102124632 | 438 |
| 494 | 3300027907 | Ga0207428_10000180 | Ga0207428_1000018060 | 438 |
| 495 | 3300050507 | nmdc:mga05p37_863_c1 | nmdc:mga05p37_863_c1_9609_10940 | 438 |
| 496 | 3300050508 | nmdc:mga09592_15927_c1 | nmdc:mga09592_15927_c1_4569_5900 | 438 |
| 497 | 3300050509 | nmdc:mga0qj67_1189_c1 | nmdc:mga0qj67_1189_c1_11248_12579 | 438 |
| 498 | 3300050510 | nmdc:mga06r32_7419_c1 | nmdc:mga06r32_7419_c1_2558_3889 | 438 |
| 499 | 3300050511 | nmdc:mga08y16_83618_c1 | nmdc:mga08y16_83618_c1_714_2045 | 438 |
| 500 | 3300050512 | nmdc:mga0n895_427_c1 | nmdc:mga0n895_427_c1_2539_3870 | 438 |
| 501 | 3300050513 | nmdc:mga0rr50_2839_c1 | nmdc:mga0rr50_2839_c1_5477_6808 | 438 |
| 502 | 3300050515 | nmdc:mga0a205_1001_c1 | nmdc:mga0a205_1001_c1_2436_3767 | 438 |
| 503 | 3300053142 | Ga0500577_0000079 | Ga0500577_0000079_14908_16248 | 438 |
| 504 | iso_pu_bacteria | 640427133 | 640487051 | 438 |
| 505 | iso_pu_bacteria | 651053060 | 651174924 | 438 |
| 506 | 3300005983 | Ga0081540_1043087 | Ga0081540_10430872 | 439 |
| 507 | 3300003322 | rootL2_10000892 | rootL2_1000089239 | 440 |
| 508 | 3300003323 | rootH1_10019014 | rootH1_100190146 | 440 |
| 509 | 3300005548 | Ga0070665_100002087 | Ga0070665_10000208712 | 440 |
| 510 | 3300025931 | Ga0207644_10080072 | Ga0207644_100800722 | 440 |
| 511 | 3300005564 | Ga0070664_100000651 | Ga0070664_10000065121 | 441 |
| 512 | 3300009093 | Ga0105240_10142449 | Ga0105240_101424493 | 441 |
| 513 | 3300009551 | Ga0105238_10000865 | Ga0105238_1000086522 | 441 |
| 514 | 3300050511 | nmdc:mga08y16_15204_c1 | nmdc:mga08y16_15204_c1_4097_5446 | 441 |
| 515 | 3300005331 | Ga0070670_100008834 | Ga0070670_1000088344 | 443 |
| 516 | 3300005364 | Ga0070673_100025028 | Ga0070673_1000250286 | 443 |
| 517 | 3300005543 | Ga0070672_100096097 | Ga0070672_1000960974 | 443 |
| 518 | 3300025940 | Ga0207691_10063173 | Ga0207691_100631734 | 443 |
| 519 | 3300025960 | Ga0207651_10009135 | Ga0207651_100091354 | 443 |
| 520 | 3300001991 | JGI24743J22301_10011591 | JGI24743J22301_100115912 | 444 |
| 521 | 3300005293 | Ga0065715_10097283 | Ga0065715_100972833 | 444 |
| 522 | 3300005331 | Ga0070670_100030930 | Ga0070670_1000309306 | 444 |
| 523 | 3300005331 | Ga0070670_100127424 | Ga0070670_1001274242 | 444 |
| 524 | 3300005335 | Ga0070666_10010244 | Ga0070666_100102443 | 444 |
| 525 | 3300005338 | Ga0068868_100127726 | Ga0068868_1001277261 | 444 |
| 526 | 3300005340 | Ga0070689_100028511 | Ga0070689_1000285112 | 444 |
| 527 | 3300005344 | Ga0070661_100008546 | Ga0070661_1000085467 | 444 |
| 528 | 3300005353 | Ga0070669_100049063 | Ga0070669_1000490633 | 444 |
| 529 | 3300005356 | Ga0070674_100044169 | Ga0070674_1000441692 | 444 |
| 530 | 3300005364 | Ga0070673_100078360 | Ga0070673_1000783602 | 444 |
| 531 | 3300005365 | Ga0070688_100009644 | Ga0070688_1000096446 | 444 |
| 532 | 3300005456 | Ga0070678_100118045 | Ga0070678_1001180452 | 444 |
| 533 | 3300005457 | Ga0070662_100045607 | Ga0070662_1000456074 | 444 |
| 534 | 3300005466 | Ga0070685_10010094 | Ga0070685_100100944 | 444 |
| 535 | 3300005535 | Ga0070684_100012745 | Ga0070684_1000127452 | 444 |
| 536 | 3300005535 | Ga0070684_100102751 | Ga0070684_1001027512 | 444 |
| 537 | 3300005544 | Ga0070686_100046432 | Ga0070686_1000464322 | 444 |
| 538 | 3300005548 | Ga0070665_100041560 | Ga0070665_1000415604 | 444 |
| 539 | 3300005563 | Ga0068855_100139220 | Ga0068855_1001392203 | 444 |
| 540 | 3300005577 | Ga0068857_100013040 | Ga0068857_1000130408 | 444 |
| 541 | 3300005615 | Ga0070702_100068502 | Ga0070702_1000685021 | 444 |
| 542 | 3300005618 | Ga0068864_100011396 | Ga0068864_1000113966 | 444 |
| 543 | 3300005718 | Ga0068866_10009938 | Ga0068866_100099384 | 444 |
| 544 | 3300005834 | Ga0068851_10007001 | Ga0068851_100070014 | 444 |
| 545 | 3300005840 | Ga0068870_10013996 | Ga0068870_100139961 | 444 |
| 546 | 3300005841 | Ga0068863_100050649 | Ga0068863_1000506494 | 444 |
| 547 | 3300005842 | Ga0068858_100037191 | Ga0068858_1000371912 | 444 |
| 548 | 3300005843 | Ga0068860_100054358 | Ga0068860_1000543585 | 444 |
| 549 | 3300006881 | Ga0068865_100034470 | Ga0068865_1000344702 | 444 |
| 550 | 3300009094 | Ga0111539_10022347 | Ga0111539_100223475 | 444 |
| 551 | 3300009553 | Ga0105249_10037049 | Ga0105249_100370493 | 444 |
| 552 | 3300013102 | Ga0157371_10133262 | Ga0157371_101332621 | 444 |
| 553 | 3300013296 | Ga0157374_10051673 | Ga0157374_100516734 | 444 |
| 554 | 3300014325 | Ga0163163_10034762 | Ga0163163_100347623 | 444 |
| 555 | 3300014968 | Ga0157379_10010681 | Ga0157379_100106814 | 444 |
| 556 | 3300017792 | Ga0163161_10081985 | Ga0163161_100819852 | 444 |
| 557 | 3300025315 | Ga0207697_10003666 | Ga0207697_100036666 | 444 |
| 558 | 3300025321 | Ga0207656_10005798 | Ga0207656_100057982 | 444 |
| 559 | 3300025893 | Ga0207682_10000905 | Ga0207682_1000090515 | 444 |
| 560 | 3300025901 | Ga0207688_10000676 | Ga0207688_100006764 | 444 |
| 561 | 3300025903 | Ga0207680_10029668 | Ga0207680_100296682 | 444 |
| 562 | 3300025907 | Ga0207645_10000860 | Ga0207645_100008604 | 444 |
| 563 | 3300025908 | Ga0207643_10000205 | Ga0207643_1000020510 | 444 |
| 564 | 3300025909 | Ga0207705_10147410 | Ga0207705_101474101 | 444 |
| 565 | 3300025918 | Ga0207662_10002164 | Ga0207662_100021646 | 444 |
| 566 | 3300025919 | Ga0207657_10005467 | Ga0207657_100054676 | 444 |
| 567 | 3300025923 | Ga0207681_10076723 | Ga0207681_100767232 | 444 |
| 568 | 3300025925 | Ga0207650_10001078 | Ga0207650_1000107810 | 444 |
| 569 | 3300025926 | Ga0207659_10019339 | Ga0207659_100193394 | 444 |
| 570 | 3300025931 | Ga0207644_10054444 | Ga0207644_100544443 | 444 |
| 571 | 3300025933 | Ga0207706_10000618 | Ga0207706_1000061821 | 444 |
| 572 | 3300025936 | Ga0207670_10016919 | Ga0207670_100169194 | 444 |
| 573 | 3300025938 | Ga0207704_10046148 | Ga0207704_100461483 | 444 |
| 574 | 3300025940 | Ga0207691_10025775 | Ga0207691_100257755 | 444 |
| 575 | 3300025941 | Ga0207711_10105405 | Ga0207711_101054052 | 444 |
| 576 | 3300025942 | Ga0207689_10000451 | Ga0207689_1000045116 | 444 |
| 577 | 3300025944 | Ga0207661_10066704 | Ga0207661_100667042 | 444 |
| 578 | 3300025960 | Ga0207651_10073619 | Ga0207651_100736191 | 444 |
| 579 | 3300025961 | Ga0207712_10052028 | Ga0207712_100520283 | 444 |
| 580 | 3300026035 | Ga0207703_10062701 | Ga0207703_100627012 | 444 |
| 581 | 3300026041 | Ga0207639_10232614 | Ga0207639_102326141 | 444 |
| 582 | 3300026075 | Ga0207708_10000557 | Ga0207708_1000055714 | 444 |
| 583 | 3300026088 | Ga0207641_10112818 | Ga0207641_101128184 | 444 |
| 584 | 3300026089 | Ga0207648_10028967 | Ga0207648_100289674 | 444 |
| 585 | 3300026095 | Ga0207676_10025835 | Ga0207676_100258352 | 444 |
| 586 | 3300026116 | Ga0207674_10099881 | Ga0207674_100998813 | 444 |
| 587 | 3300026118 | Ga0207675_100001090 | Ga0207675_10000109025 | 444 |
| 588 | 3300026142 | Ga0207698_10035718 | Ga0207698_100357184 | 444 |
| 589 | 3300026142 | Ga0207698_10051297 | Ga0207698_100512974 | 444 |
| 590 | 3300027907 | Ga0207428_10063229 | Ga0207428_100632293 | 444 |
| 591 | 3300028379 | Ga0268266_10069528 | Ga0268266_100695282 | 444 |
| 592 | 3300035089 | Ga0373944_0019089 | Ga0373944_0019089_564_1913 | 444 |
| 593 | 3300035170 | Ga0373943_0023996 | Ga0373943_0023996_823_2172 | 444 |
| 594 | 3300048907 | Ga0496104_0015068 | Ga0496104_0015068_473_1822 | 444 |
| 595 | 3300048908 | Ga0496105_0007157 | Ga0496105_0007157_5200_6549 | 444 |
| 596 | 3300048909 | Ga0496106_0032321 | Ga0496106_0032321_732_2081 | 444 |
| 597 | 3300048911 | Ga0496108_0013198 | Ga0496108_0013198_4534_5883 | 444 |
| 598 | 3300048912 | Ga0496109_0012841 | Ga0496109_0012841_1756_3105 | 444 |
| 599 | 3300048913 | Ga0496110_0006943 | Ga0496110_0006943_793_2142 | 444 |
| 600 | 3300050511 | nmdc:mga08y16_156910_c1 | nmdc:mga08y16_156910_c1_745_2094 | 444 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3a9h-assembly1.cif.gz_A | crystal structure of pqq-dependent sugar dehydrogenase holo-form | 0.7694 | 66 | 435 |
| 3a9h-assembly1.cif.gz_A | crystal structure of pqq-dependent sugar dehydrogenase holo-form | 0.7608 | 66 | 435 |
| 5v36-assembly1.cif.gz_A | 1.88 angstrom resolution crystal structure of glutathione reductase from streptococcus mutans ua159 in complex with fad | 0.76 | 402 | 431 |
| 7cgz-assembly1.cif.gz_A | glucose dehydrogenase | 0.7573 | 68 | 430 |
| 6i1t-assembly1.cif.gz_A | calcium structure of trichoderma reesei carbohydrate-active enzymes family aa12 | 0.7555 | 47 | 434 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6n7fA02 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.767 | 402 | 431 | 3.50.50.60 |
| 3a9gA00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.7574 | 66 | 435 | 2.120.10.30 |
| 3a9gA00 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.749 | 66 | 435 | 2.120.10.30 |
| af_P98164_2374_2695_2.120.10.30 | Mainly Beta;6 Propeller;Neuraminidase;TolB, C-terminal domain | 0.7436 | 78 | 409 | 2.120.10.30 |
| af_Q8TED0_158_333_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.734 | 70 | 275 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A350CV99-F1-model_v4 | Sorbosone dehydrogenase | 0.9918 | 252 | 434 |
|
| AF-A0A257WQ46-F1-model_v4 | deleted | 0.991 | 325 | 432 |
|
| AF-A0A2R7L948-F1-model_v4 | deleted | 0.9908 | 40 | 434 |
|
| AF-A0A2A3CKE1-F1-model_v4 | deleted | 0.9898 | 339 | 434 |
|
| AF-A0A0J6S040-F1-model_v4 | L-sorbosone dehydrogenase | 0.9895 | 261 | 430 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar