F468014

General Info

Members Datasets Scaffolds Average Seq Length
600 241 595 471

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0044440|Ga0495672_0044440_1063_2469
Length 468
Sequence MDSNFNPDKQHTLQSSINISGTGLHTGVKVDMTLKPANAGFGYQFQRIDLAGRPLIKADCDLVTDTSRGTTLEENGVKVSTVEHILAALVGMGVDNCLIEINGPEIPIIDGSSEPFVEIIEEAGVIEQDAAKAWYTIDTNISYYDEKKRVEMVAMPAMEYKVTTLIDFNSPVLGTQHAGLKRMMDFKTEIAPCRTFCFLHELEMLLDNDLIKGGDINNAIVVVDRPVTKEEMTRLAKVFGREKMEIKSEGYLNNLELRFPNEPARHKLLDVIGDLALTGYSVKGHIIANRPGHSTNVAFAKKIKQYIKKNKHLKNIPVYDPSQQPIFNIQQIEKTLPHRYPFLLIDKIIELTDKYIVGVKNVTFNEPFFVGHFPGNPIMPGVLQIEAMAQTGGILCINAMPAGDYDTYFLKIDNCKFKQMVKPGDTMLMKLELLTPIRRGICEMRGTVYVGNKIVTEADLMAQLVKRS

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
4 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
8 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
105 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
170 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
194 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
214 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
215 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
216 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
228 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
229 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
230 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
233 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
234 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
236 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
237 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
241 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.17
Metatranscriptomes 0
Isolates 0.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6
Nodule 0
Rhizoplane 0.67
Rhizosphere 87.67
Stem 0
Stem Tuber 0
Unclassified 5.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012939 3300001979 Bacteria 3132
2 JGI24740J21852_10015804 3300001979 Bacteria 2744
3 JGI24739J22299_10000573 3300001989 Bacteria 13281
4 JGI25154J39366_1000021 3300002738 Bacteria 221559
5 JGI25157J39369_1004453 3300002741 Bacteria 2535
6 JGI25153J46596_10000222 3300003215 Bacteria 49028
7 rootH1_10116196 3300003316 Bacteria 2445
8 rootH2_10001918 3300003320 Bacteria 9017
9 rootH2_10049592 3300003320 Bacteria 3811
10 rootH2_10053498 3300003320 Bacteria 5848
11 rootL2_10076268 3300003322 Bacteria 3374
12 rootL2_10076278 3300003322 Bacteria 1507
13 rootL2_10121572 3300003322 Bacteria 4663
14 rootH1_10017025 3300003323 Bacteria 16245
15 rootH1_10064497 3300003323 Bacteria 5424
16 rootH1_10225010 3300003323 Bacteria 7388
17 rootH1_10317284 3300003323 Bacteria 2356
18 JGI25160J50197_1002216 3300003354 Bacteria 9123
19 JGI25160J50197_1003616 3300003354 Bacteria 6867
20 JGI25160J50197_1005724 3300003354 Bacteria 5132
21 Ga0055526_1023073 3300003771 Bacteria 2088
22 Ga0055530_10001651 3300003791 Bacteria 15904
23 Ga0055531_10032144 3300003794 Bacteria 1720
24 Ga0065165_1000579 3300005262 Bacteria 54043
25 Ga0065712_10001191 3300005290 Bacteria 6519
26 Ga0065712_10011864 3300005290 Bacteria 2141
27 Ga0065715_10004363 3300005293 Bacteria 4116
28 Ga0070658_10003542 3300005327 Bacteria 12813
29 Ga0070676_10002024 3300005328 Bacteria 10294
30 Ga0070676_10002966 3300005328 Bacteria 8767
31 Ga0070676_10046563 3300005328 Bacteria 2530
32 Ga0070683_100000292 3300005329 Bacteria 34475
33 Ga0070683_100001205 3300005329 Bacteria 19694
34 Ga0070683_100015503 3300005329 Bacteria 6697
35 Ga0070683_100064799 3300005329 Bacteria 3402
36 Ga0070690_100102296 3300005330 Unclassified 1901
37 Ga0070670_100052551 3300005331 Bacteria 3499
38 Ga0070670_100061388 3300005331 Bacteria 3227
39 Ga0070670_100089593 3300005331 Bacteria 2644
40 Ga0070670_100098525 3300005331 Bacteria 2515
41 Ga0068869_100008280 3300005334 Bacteria 6698
42 Ga0068869_100013836 3300005334 Bacteria 5377
43 Ga0068869_100015938 3300005334 Bacteria 5057
44 Ga0068869_100037187 3300005334 Bacteria 3460
45 Ga0070666_10000019 3300005335 Bacteria 185877
46 Ga0070666_10008494 3300005335 Bacteria 6379
47 Ga0070666_10010165 3300005335 Bacteria 5878
48 Ga0070666_10013027 3300005335 Bacteria 5265
49 Ga0070680_100023459 3300005336 Bacteria 4920
50 Ga0068868_100002206 3300005338 Bacteria 13455
51 Ga0068868_100004920 3300005338 Bacteria 9381
52 Ga0068868_100007563 3300005338 Bacteria 7740
53 Ga0068868_100007993 3300005338 Bacteria 7559
54 Ga0068868_100061477 3300005338 Bacteria 2976
55 Ga0070689_100006975 3300005340 Bacteria 7868
56 Ga0070689_100019780 3300005340 Bacteria 4982
57 Ga0070661_100000350 3300005344 Bacteria 36459
58 Ga0070661_100003767 3300005344 Bacteria 10453
59 Ga0070668_100002414 3300005347 Bacteria 13757
60 Ga0070668_100028325 3300005347 Bacteria 4253
61 Ga0070669_100059939 3300005353 Bacteria 2794
62 Ga0070675_100019801 3300005354 Bacteria 5367
63 Ga0070675_100129861 3300005354 Bacteria 2146
64 Ga0070671_100001143 3300005355 Bacteria 19757
65 Ga0070671_100175367 3300005355 Unclassified 1814
66 Ga0070674_100101141 3300005356 Unclassified 2100
67 Ga0070674_100182389 3300005356 Unclassified 1609
68 Ga0070673_100014307 3300005364 Bacteria 5519
69 Ga0070673_100019702 3300005364 Bacteria 4848
70 Ga0070673_100035061 3300005364 Bacteria 3803
71 Ga0070688_100006810 3300005365 Bacteria 6133
72 Ga0070688_100044021 3300005365 Bacteria 2753
73 Ga0070688_100082919 3300005365 Bacteria 2079
74 Ga0070659_100005305 3300005366 Bacteria 9246
75 Ga0070667_100000031 3300005367 Bacteria 177447
76 Ga0070667_100010344 3300005367 Bacteria 7704
77 Ga0070667_100037238 3300005367 Bacteria 4078
78 Ga0070667_100052349 3300005367 Bacteria 3445
79 Ga0070667_100071933 3300005367 Bacteria 2946
80 Ga0070663_100058925 3300005455 Bacteria 2759
81 Ga0070662_100001190 3300005457 Bacteria 15972
82 Ga0070662_100001909 3300005457 Bacteria 12799
83 Ga0070662_100089821 3300005457 Bacteria 2305
84 Ga0068867_100009415 3300005459 Bacteria 6891
85 Ga0068867_100009690 3300005459 Bacteria 6790
86 Ga0068867_100012634 3300005459 Bacteria 5972
87 Ga0068867_100053480 3300005459 Bacteria 2983
88 Ga0070685_10013706 3300005466 Bacteria 4282
89 Ga0070698_100005311 3300005471 Bacteria 14097
90 Ga0070698_100011645 3300005471 Bacteria 9330
91 Ga0070698_100031376 3300005471 Bacteria 5510
92 Ga0070679_100237158 3300005530 Bacteria 1782
93 Ga0070684_100000508 3300005535 Bacteria 26690
94 Ga0070684_100025502 3300005535 Bacteria 4971
95 Ga0070684_100031486 3300005535 Bacteria 4516
96 Ga0068853_100001666 3300005539 Bacteria 16252
97 Ga0068853_100011866 3300005539 Bacteria 7086
98 Ga0068853_100019053 3300005539 Bacteria 5686
99 Ga0068853_100019166 3300005539 Bacteria 5671
100 Ga0068853_100036255 3300005539 Bacteria 4193
101 Ga0068853_100049879 3300005539 Bacteria 3599
102 Ga0070672_100005602 3300005543 Bacteria 8350
103 Ga0070672_100120217 3300005543 Bacteria 2149
104 Ga0070693_100009128 3300005547 Bacteria 4923
105 Ga0070665_100000018 3300005548 Bacteria 434118
106 Ga0070665_100002650 3300005548 Bacteria 19467
107 Ga0070665_100021714 3300005548 Bacteria 6455
108 Ga0070665_100123688 3300005548 Unclassified 2589
109 Ga0068855_100001866 3300005563 Bacteria 26188
110 Ga0068855_100003963 3300005563 Bacteria 18072
111 Ga0068855_100032219 3300005563 Bacteria 6258
112 Ga0068855_100315211 3300005563 Bacteria 1730
113 Ga0070664_100000445 3300005564 Bacteria 31196
114 Ga0070664_100064059 3300005564 Bacteria 3135
115 Ga0068857_100010937 3300005577 Bacteria 7899
116 Ga0068857_100037620 3300005577 Bacteria 4288
117 Ga0068857_100038637 3300005577 Bacteria 4227
118 Ga0068857_100043089 3300005577 Bacteria 4004
119 Ga0068854_100014549 3300005578 Bacteria 5191
120 Ga0068856_100014734 3300005614 Bacteria 7546
121 Ga0068852_100000274 3300005616 Bacteria 34259
122 Ga0068852_100040671 3300005616 Bacteria 3924
123 Ga0068852_100048586 3300005616 Bacteria 3626
124 Ga0068852_100058866 3300005616 Bacteria 3330
125 Ga0068852_100126443 3300005616 Bacteria 2348
126 Ga0068859_100000013 3300005617 Bacteria 291126
127 Ga0068859_100000451 3300005617 Bacteria 40880
128 Ga0068859_100030431 3300005617 Bacteria 5417
129 Ga0068859_100135628 3300005617 Bacteria 2534
130 Ga0068859_100208896 3300005617 Bacteria 2038
131 Ga0068864_100006018 3300005618 Bacteria 9961
132 Ga0068864_100009714 3300005618 Bacteria 7938
133 Ga0068864_100031437 3300005618 Bacteria 4504
134 Ga0068864_100072565 3300005618 Bacteria 3000
135 Ga0068866_10054303 3300005718 Bacteria 2052
136 Ga0068861_100005961 3300005719 Bacteria 8278
137 Ga0068861_100049205 3300005719 Bacteria 3190
138 Ga0068861_100166549 3300005719 Bacteria 1823
139 Ga0068851_10001096 3300005834 Bacteria 11756
140 Ga0068851_10009552 3300005834 Bacteria 4514
141 Ga0068851_10033809 3300005834 Bacteria 2549
142 Ga0068851_10047500 3300005834 Bacteria 2174
143 Ga0068870_10033666 3300005840 Bacteria 2616
144 Ga0068870_10037944 3300005840 Unclassified 2486
145 Ga0068863_100005507 3300005841 Bacteria 12454
146 Ga0068863_100018879 3300005841 Bacteria 6598
147 Ga0068863_100023592 3300005841 Bacteria 5872
148 Ga0068863_100025539 3300005841 Bacteria 5632
149 Ga0068863_100087680 3300005841 Bacteria 2949
150 Ga0068858_100004954 3300005842 Bacteria 13046
151 Ga0068858_100021942 3300005842 Bacteria 5963
152 Ga0068858_100049792 3300005842 Bacteria 3879
153 Ga0068858_100086984 3300005842 Bacteria 2907
154 Ga0068860_100000040 3300005843 Bacteria 231652
155 Ga0068860_100000948 3300005843 Bacteria 32094
156 Ga0068860_100005457 3300005843 Bacteria 12891
157 Ga0068860_100016192 3300005843 Bacteria 7272
158 Ga0068860_100029845 3300005843 Bacteria 5246
159 Ga0068860_100051471 3300005843 Bacteria 3919
160 Ga0068860_100139082 3300005843 Unclassified 2333
161 Ga0068860_100240183 3300005843 Bacteria 1762
162 Ga0068860_100299886 3300005843 Bacteria 1574
163 Ga0068862_100158146 3300005844 Bacteria 2021
164 Ga0070715_10008824 3300006163 Bacteria 3529
165 Ga0075366_10002314 3300006195 Bacteria 9745
166 Ga0075366_10015119 3300006195 Bacteria 4417
167 Ga0097621_100001789 3300006237 Bacteria 14756
168 Ga0097621_100003766 3300006237 Bacteria 10512
169 Ga0097621_100006952 3300006237 Bacteria 8056
170 Ga0097621_100008416 3300006237 Bacteria 7428
171 Ga0097621_100009337 3300006237 Bacteria 7121
172 Ga0097621_100184397 3300006237 Bacteria 1804
173 Ga0097621_100216916 3300006237 Unclassified 1666
174 Ga0068871_100000075 3300006358 Bacteria 55346
175 Ga0068871_100001976 3300006358 Bacteria 13888
176 Ga0068871_100004482 3300006358 Bacteria 9721
177 Ga0068871_100007909 3300006358 Bacteria 7623
178 Ga0068871_100016350 3300006358 Bacteria 5586
179 Ga0068871_100197741 3300006358 Bacteria 1734
180 Ga0068871_100209620 3300006358 Bacteria 1685
181 Ga0075428_100005318 3300006844 Bacteria 14309
182 Ga0075428_100052566 3300006844 Bacteria 4464
183 Ga0075430_100010757 3300006846 Bacteria 7754
184 Ga0075430_100025027 3300006846 Bacteria 5078
185 Ga0075429_100000991 3300006880 Bacteria 22562
186 Ga0068865_100004346 3300006881 Bacteria 8550
187 Ga0097620_100000013 3300006931 Bacteria 291126
188 Ga0097620_100000451 3300006931 Bacteria 40880
189 Ga0097620_100030429 3300006931 Bacteria 5417
190 Ga0097620_100135626 3300006931 Bacteria 2534
191 Ga0097620_100208892 3300006931 Bacteria 2038
192 Ga0105240_10000138 3300009093 Bacteria 149330
193 Ga0105240_10000785 3300009093 Bacteria 57570
194 Ga0105240_10003502 3300009093 Bacteria 24345
195 Ga0105240_10005325 3300009093 Bacteria 19195
196 Ga0105240_10009847 3300009093 Bacteria 13490
197 Ga0105240_10025643 3300009093 Bacteria 7743
198 Ga0105240_10025938 3300009093 Bacteria 7697
199 Ga0105240_10027963 3300009093 Bacteria 7376
200 Ga0105240_10038013 3300009093 Bacteria 6179
201 Ga0105240_10039588 3300009093 Bacteria 6035
202 Ga0105240_10051730 3300009093 Bacteria 5167
203 Ga0105240_10203335 3300009093 Bacteria 2320
204 Ga0111539_10080351 3300009094 Bacteria 3835
205 Ga0105247_10010798 3300009101 Bacteria 5515
206 Ga0114129_10055684 3300009147 Bacteria 5542
207 Ga0114129_10101951 3300009147 Bacteria 3970
208 Ga0114129_10136259 3300009147 Bacteria 3368
209 Ga0105241_10000297 3300009174 Bacteria 37174
210 Ga0105241_10016359 3300009174 Bacteria 5440
211 Ga0105241_10031694 3300009174 Bacteria 3958
212 Ga0105241_10042983 3300009174 Bacteria 3421
213 Ga0105242_10005909 3300009176 Bacteria 9438
214 Ga0105242_10022521 3300009176 Bacteria 4957
215 Ga0105242_10035688 3300009176 Bacteria 3987
216 Ga0105242_10109560 3300009176 Bacteria 2351
217 Ga0105242_10184785 3300009176 Bacteria 1841
218 Ga0105248_10046424 3300009177 Bacteria 4868
219 Ga0105237_10000473 3300009545 Bacteria 57014
220 Ga0105237_10003067 3300009545 Bacteria 20140
221 Ga0105237_10006182 3300009545 Bacteria 13376
222 Ga0105237_10012903 3300009545 Bacteria 8779
223 Ga0105237_10013588 3300009545 Bacteria 8530
224 Ga0105237_10028722 3300009545 Bacteria 5661
225 Ga0105237_10114937 3300009545 Bacteria 2684
226 Ga0105238_10001633 3300009551 Bacteria 22466
227 Ga0105249_10003772 3300009553 Bacteria 13079
228 Ga0105249_10007096 3300009553 Bacteria 9780
229 Ga0105249_10009750 3300009553 Bacteria 8413
230 Ga0105249_10151484 3300009553 Bacteria 2233
231 Ga0105249_10236286 3300009553 Unclassified 1805
232 Ga0105249_10252241 3300009553 Bacteria 1750
233 Ga0105239_10000204 3300010375 Bacteria 87242
234 Ga0105239_10000998 3300010375 Bacteria 39651
235 Ga0105239_10001030 3300010375 Bacteria 38874
236 Ga0105239_10001781 3300010375 Bacteria 28334
237 Ga0105239_10006070 3300010375 Bacteria 14067
238 Ga0105239_10006812 3300010375 Bacteria 13182
239 Ga0105239_10085257 3300010375 Bacteria 3481
240 Ga0105239_10086949 3300010375 Bacteria 3446
241 Ga0105239_10319936 3300010375 Bacteria 1749
242 Ga0105246_10042223 3300011119 Bacteria 3088
243 Ga0105246_10059210 3300011119 Bacteria 2656
244 Ga0105246_10098892 3300011119 Bacteria 2120
245 Ga0157373_10064655 3300013100 Bacteria 2589
246 Ga0157373_10100357 3300013100 Bacteria 2037
247 Ga0157370_10006139 3300013104 Bacteria 13332
248 Ga0157370_10021907 3300013104 Bacteria 6364
249 Ga0157370_10095570 3300013104 Bacteria 2788
250 Ga0157369_10043109 3300013105 Bacteria 4919
251 Ga0157369_10077048 3300013105 Bacteria 3574
252 Ga0157374_10000025 3300013296 Bacteria 245131
253 Ga0157374_10005476 3300013296 Bacteria 10655
254 Ga0157374_10015781 3300013296 Bacteria 6634
255 Ga0157374_10065006 3300013296 Bacteria 3425
256 Ga0157374_10082951 3300013296 Bacteria 3044
257 Ga0157374_10135369 3300013296 Bacteria 2388
258 Ga0157378_10014751 3300013297 Bacteria 6847
259 Ga0157378_10016084 3300013297 Bacteria 6552
260 Ga0157378_10043173 3300013297 Bacteria 4003
261 Ga0157378_10141774 3300013297 Bacteria 2232
262 Ga0157378_10152001 3300013297 Bacteria 2158
263 Ga0157378_10158110 3300013297 Bacteria 2117
264 Ga0163162_10001619 3300013306 Bacteria 21066
265 Ga0163162_10003073 3300013306 Bacteria 15950
266 Ga0163162_10008228 3300013306 Bacteria 10180
267 Ga0163162_10008308 3300013306 Bacteria 10129
268 Ga0163162_10015172 3300013306 Bacteria 7525
269 Ga0163162_10018688 3300013306 Bacteria 6791
270 Ga0163162_10022781 3300013306 Bacteria 6175
271 Ga0163162_10030938 3300013306 Bacteria 5306
272 Ga0163162_10038660 3300013306 Unclassified 4762
273 Ga0163162_10067468 3300013306 Bacteria 3627
274 Ga0163162_10113996 3300013306 Bacteria 2802
275 Ga0163162_10155053 3300013306 Bacteria 2410
276 Ga0157372_10000080 3300013307 Bacteria 100216
277 Ga0157372_10022220 3300013307 Bacteria 6863
278 Ga0157372_10024003 3300013307 Bacteria 6615
279 Ga0157372_10037811 3300013307 Bacteria 5324
280 Ga0157372_10054934 3300013307 Bacteria 4446
281 Ga0157372_10094716 3300013307 Bacteria 3401
282 Ga0157372_10149567 3300013307 Bacteria 2694
283 Ga0157372_10274791 3300013307 Bacteria 1958
284 Ga0157375_10000186 3300013308 Bacteria 58217
285 Ga0157375_10005180 3300013308 Bacteria 11311
286 Ga0157375_10023788 3300013308 Bacteria 5660
287 Ga0157375_10063424 3300013308 Bacteria 3676
288 Ga0157375_10147016 3300013308 Bacteria 2488
289 Ga0157375_10248717 3300013308 Unclassified 1938
290 Ga0163163_10000174 3300014325 Bacteria 67568
291 Ga0163163_10000895 3300014325 Bacteria 25277
292 Ga0163163_10001739 3300014325 Bacteria 18346
293 Ga0163163_10022398 3300014325 Bacteria 5982
294 Ga0163163_10049198 3300014325 Bacteria 4148
295 Ga0163163_10124258 3300014325 Bacteria 2617
296 Ga0157380_10016160 3300014326 Bacteria 5499
297 Ga0157380_10139568 3300014326 Bacteria 2080
298 Ga0157380_10187972 3300014326 Bacteria 1821
299 Ga0157377_10002702 3300014745 Bacteria 7882
300 Ga0157377_10085132 3300014745 Bacteria 1855
301 Ga0157379_10008261 3300014968 Bacteria 9044
302 Ga0157379_10015024 3300014968 Bacteria 6792
303 Ga0157379_10017290 3300014968 Bacteria 6354
304 Ga0157379_10037623 3300014968 Bacteria 4316
305 Ga0157379_10066128 3300014968 Bacteria 3232
306 Ga0157376_10000101 3300014969 Bacteria 62612
307 Ga0157376_10004595 3300014969 Bacteria 9614
308 Ga0157376_10005019 3300014969 Bacteria 9234
309 Ga0157376_10020628 3300014969 Bacteria 5103
310 Ga0157376_10029662 3300014969 Bacteria 4359
311 Ga0163161_10003928 3300017792 Bacteria 10427
312 Ga0163161_10009734 3300017792 Bacteria 6659
313 Ga0163161_10017422 3300017792 Bacteria 5027
314 Ga0213876_10001264 3300021384 Bacteria 15967
315 Ga0213876_10014783 3300021384 Bacteria 4137
316 Ga0209646_1000050 3300025246 Bacteria 296599
317 Ga0209646_1003802 3300025246 Bacteria 2885
318 Ga0209026_1000195 3300025250 Bacteria 84589
319 Ga0209673_1000339 3300025273 Bacteria 85906
320 Ga0209564_1004514 3300025295 Bacteria 8472
321 Ga0209758_1000653 3300025297 Bacteria 52393
322 Ga0209758_1010093 3300025297 Bacteria 5720
323 Ga0209050_1000256 3300025298 Bacteria 114192
324 Ga0207426_1000026 3300025302 Bacteria 515228
325 Ga0207426_1001367 3300025302 Bacteria 20677
326 Ga0207426_1002135 3300025302 Bacteria 13503
327 Ga0209257_1000659 3300025304 Bacteria 54234
328 Ga0207656_10012024 3300025321 Bacteria 3284
329 Ga0207656_10036795 3300025321 Bacteria 2056
330 Ga0207682_10027770 3300025893 Bacteria 2255
331 Ga0207680_10000222 3300025903 Bacteria 27423
332 Ga0207680_10005574 3300025903 Bacteria 6019
333 Ga0207680_10008802 3300025903 Bacteria 4975
334 Ga0207680_10024020 3300025903 Bacteria 3338
335 Ga0207647_10034338 3300025904 Bacteria 3239
336 Ga0207645_10000606 3300025907 Bacteria 29699
337 Ga0207643_10015070 3300025908 Bacteria 4203
338 Ga0207643_10036643 3300025908 Bacteria 2751
339 Ga0207705_10027777 3300025909 Bacteria 4035
340 Ga0207707_10016419 3300025912 Bacteria 6458
341 Ga0207695_10000064 3300025913 Bacteria 346010
342 Ga0207695_10000146 3300025913 Bacteria 209416
343 Ga0207695_10000248 3300025913 Bacteria 140288
344 Ga0207695_10000260 3300025913 Bacteria 133317
345 Ga0207695_10003406 3300025913 Bacteria 22456
346 Ga0207695_10013801 3300025913 Bacteria 9611
347 Ga0207695_10030928 3300025913 Bacteria 5886
348 Ga0207695_10034967 3300025913 Bacteria 5455
349 Ga0207695_10035312 3300025913 Bacteria 5424
350 Ga0207695_10046334 3300025913 Bacteria 4609
351 Ga0207671_10000103 3300025914 Bacteria 129408
352 Ga0207671_10001260 3300025914 Bacteria 29830
353 Ga0207671_10002573 3300025914 Bacteria 19198
354 Ga0207671_10002891 3300025914 Bacteria 17784
355 Ga0207671_10003161 3300025914 Bacteria 16663
356 Ga0207671_10014091 3300025914 Bacteria 6336
357 Ga0207671_10035278 3300025914 Bacteria 3713
358 Ga0207660_10007186 3300025917 Bacteria 7208
359 Ga0207649_10004662 3300025920 Bacteria 7417
360 Ga0207649_10056852 3300025920 Bacteria 2444
361 Ga0207652_10015549 3300025921 Bacteria 6190
362 Ga0207681_10015509 3300025923 Bacteria 4753
363 Ga0207681_10186669 3300025923 Unclassified 1583
364 Ga0207681_10187537 3300025923 Bacteria 1580
365 Ga0207694_10007106 3300025924 Bacteria 8506
366 Ga0207650_10018642 3300025925 Bacteria 4872
367 Ga0207650_10078981 3300025925 Bacteria 2491
368 Ga0207659_10029643 3300025926 Bacteria 3732
369 Ga0207659_10071502 3300025926 Bacteria 2533
370 Ga0207644_10001876 3300025931 Bacteria 13686
371 Ga0207690_10004641 3300025932 Bacteria 8127
372 Ga0207706_10001359 3300025933 Bacteria 24443
373 Ga0207706_10004896 3300025933 Bacteria 12524
374 Ga0207706_10099997 3300025933 Bacteria 2552
375 Ga0207686_10001833 3300025934 Bacteria 11830
376 Ga0207686_10028230 3300025934 Bacteria 3296
377 Ga0207686_10071227 3300025934 Bacteria 2236
378 Ga0207686_10115395 3300025934 Bacteria 1819
379 Ga0207670_10005523 3300025936 Bacteria 6949
380 Ga0207670_10057843 3300025936 Bacteria 2631
381 Ga0207704_10019869 3300025938 Bacteria 3540
382 Ga0207691_10017060 3300025940 Bacteria 6889
383 Ga0207691_10027168 3300025940 Bacteria 5369
384 Ga0207691_10037249 3300025940 Bacteria 4506
385 Ga0207691_10050919 3300025940 Bacteria 3789
386 Ga0207691_10168485 3300025940 Bacteria 1919
387 Ga0207691_10264375 3300025940 Unclassified 1482
388 Ga0207689_10000585 3300025942 Bacteria 34768
389 Ga0207689_10005429 3300025942 Bacteria 11407
390 Ga0207689_10006595 3300025942 Bacteria 10236
391 Ga0207689_10024938 3300025942 Bacteria 5012
392 Ga0207689_10049619 3300025942 Bacteria 3462
393 Ga0207661_10000454 3300025944 Bacteria 26362
394 Ga0207661_10006868 3300025944 Bacteria 8071
395 Ga0207661_10010307 3300025944 Bacteria 6723
396 Ga0207679_10003277 3300025945 Bacteria 9993
397 Ga0207679_10010888 3300025945 Bacteria 5865
398 Ga0207679_10037721 3300025945 Bacteria 3438
399 Ga0207679_10066081 3300025945 Bacteria 2709
400 Ga0207667_10000270 3300025949 Bacteria 71998
401 Ga0207667_10000520 3300025949 Bacteria 50760
402 Ga0207667_10004340 3300025949 Bacteria 17365
403 Ga0207667_10153766 3300025949 Bacteria 2367
404 Ga0207651_10008410 3300025960 Bacteria 5573
405 Ga0207651_10039834 3300025960 Bacteria 3102
406 Ga0207651_10149408 3300025960 Bacteria 1816
407 Ga0207712_10002290 3300025961 Bacteria 12423
408 Ga0207712_10005504 3300025961 Bacteria 7986
409 Ga0207712_10013848 3300025961 Bacteria 5171
410 Ga0207712_10057916 3300025961 Bacteria 2736
411 Ga0207712_10068352 3300025961 Bacteria 2545
412 Ga0207668_10000298 3300025972 Bacteria 32532
413 Ga0207640_10035640 3300025981 Bacteria 3115
414 Ga0207658_10013104 3300025986 Bacteria 5662
415 Ga0207658_10013509 3300025986 Bacteria 5581
416 Ga0207658_10085911 3300025986 Bacteria 2424
417 Ga0207658_10145385 3300025986 Unclassified 1925
418 Ga0207658_10190446 3300025986 Bacteria 1704
419 Ga0207677_10004006 3300026023 Bacteria 7860
420 Ga0207677_10005051 3300026023 Bacteria 7130
421 Ga0207677_10012669 3300026023 Bacteria 4858
422 Ga0207677_10021555 3300026023 Bacteria 3939
423 Ga0207677_10132079 3300026023 Bacteria 1898
424 Ga0207703_10006003 3300026035 Bacteria 9726
425 Ga0207703_10006892 3300026035 Bacteria 9047
426 Ga0207703_10018673 3300026035 Bacteria 5416
427 Ga0207703_10123612 3300026035 Bacteria 2225
428 Ga0207639_10006391 3300026041 Bacteria 8004
429 Ga0207639_10007545 3300026041 Bacteria 7418
430 Ga0207639_10015040 3300026041 Bacteria 5450
431 Ga0207678_10016784 3300026067 Bacteria 6430
432 Ga0207702_10020842 3300026078 Bacteria 5422
433 Ga0207702_10088939 3300026078 Bacteria 2700
434 Ga0207641_10000184 3300026088 Bacteria 86994
435 Ga0207641_10003682 3300026088 Bacteria 13499
436 Ga0207641_10009560 3300026088 Bacteria 7987
437 Ga0207641_10054205 3300026088 Bacteria 3402
438 Ga0207648_10003304 3300026089 Bacteria 16933
439 Ga0207648_10004110 3300026089 Bacteria 15064
440 Ga0207648_10018137 3300026089 Bacteria 6375
441 Ga0207648_10031381 3300026089 Bacteria 4698
442 Ga0207648_10053441 3300026089 Bacteria 3531
443 Ga0207648_10055852 3300026089 Bacteria 3446
444 Ga0207648_10064789 3300026089 Bacteria 3185
445 Ga0207648_10154650 3300026089 Bacteria 2024
446 Ga0207648_10179126 3300026089 Unclassified 1876
447 Ga0207676_10003554 3300026095 Bacteria 11027
448 Ga0207676_10009360 3300026095 Bacteria 6972
449 Ga0207676_10024928 3300026095 Bacteria 4433
450 Ga0207676_10095738 3300026095 Bacteria 2449
451 Ga0207674_10004795 3300026116 Bacteria 16200
452 Ga0207674_10026414 3300026116 Bacteria 6168
453 Ga0207674_10026681 3300026116 Bacteria 6129
454 Ga0207674_10032102 3300026116 Bacteria 5509
455 Ga0207674_10103142 3300026116 Bacteria 2832
456 Ga0207674_10119036 3300026116 Bacteria 2610
457 Ga0207675_100073885 3300026118 Bacteria 3190
458 Ga0207675_100092134 3300026118 Bacteria 2850
459 Ga0207675_100096251 3300026118 Bacteria 2786
460 Ga0207683_10011496 3300026121 Bacteria 7557
461 Ga0207683_10030580 3300026121 Bacteria 4666
462 Ga0207683_10048435 3300026121 Bacteria 3721
463 Ga0207683_10090404 3300026121 Unclassified 2726
464 Ga0207683_10219796 3300026121 Bacteria 1731
465 Ga0207698_10000963 3300026142 Bacteria 16738
466 Ga0207698_10021199 3300026142 Bacteria 4489
467 Ga0207698_10021249 3300026142 Bacteria 4484
468 Ga0207698_10057494 3300026142 Bacteria 3010
469 Ga0268266_10000026 3300028379 Bacteria 434485
470 Ga0268266_10013819 3300028379 Bacteria 6949
471 Ga0268266_10020935 3300028379 Bacteria 5575
472 Ga0268265_10125281 3300028380 Bacteria 2125
473 Ga0268264_10000019 3300028381 Bacteria 488112
474 Ga0268264_10003219 3300028381 Bacteria 14141
475 Ga0268264_10003983 3300028381 Bacteria 12642
476 Ga0268264_10039181 3300028381 Bacteria 3916
477 Ga0268264_10049286 3300028381 Bacteria 3504
478 Ga0268264_10100328 3300028381 Bacteria 2514
479 Ga0268264_10246372 3300028381 Bacteria 1658
480 Ga0307517_10004138 3300028786 Bacteria 22383
481 Ga0307517_10048080 3300028786 Bacteria 4401
482 Ga0307515_10000001 3300028794 Bacteria 4259510
483 Ga0307515_10000455 3300028794 Bacteria 97670
484 Ga0307511_10000182 3300030521 Bacteria 62310
485 Ga0265327_10000034 3300031251 Bacteria 316018
486 Ga0265327_10000048 3300031251 Bacteria 269173
487 Ga0265327_10000390 3300031251 Bacteria 82772
488 Ga0265327_10014097 3300031251 Bacteria 5254
489 Ga0265327_10018948 3300031251 Bacteria 4248
490 Ga0307509_10147116 3300031507 Bacteria 2279
491 Ga0307508_10016080 3300031616 Bacteria 6815
492 Ga0307414_10057150 3300032004 Bacteria 2741
493 Ga0307510_10000068 3300033180 Bacteria 78208
494 Ga0373937_0009187 3300036401 Bacteria 8581
495 Ga0373937_0186322 3300036401 Bacteria 1949
496 Ga0436365_1560297 3300039437 Bacteria 11044
497 Ga0436365_1874674 3300039437 Bacteria 58580
498 Ga0451851_0645281 3300041507 Bacteria 2321
499 Ga0439449_0019064 3300042007 Bacteria 2573
500 Ga0439457_000035 3300042014 Bacteria 28526
501 Ga0439462_0001746 3300042015 Bacteria 4914
502 Ga0451577_0004359 3300042876 Bacteria 14984
503 Ga0466969_0000543 3300044656 Bacteria 20665
504 Ga0466972_0000016 3300044658 Bacteria 208802
505 Ga0466972_0000105 3300044658 Bacteria 73294
506 Ga0453683_0085704 3300044673 Bacteria 1974
507 Ga0466965_0020578 3300044683 Bacteria 3173
508 Ga0466966_0036553 3300044684 Bacteria 3170
509 Ga0453684_0050707 3300044712 Bacteria 5455
510 Ga0453684_0053754 3300044712 Bacteria 5254
511 Ga0466968_0018640 3300044735 Bacteria 2786
512 Ga0466970_0001127 3300044765 Bacteria 12952
513 Ga0466970_0038168 3300044765 Bacteria 2547
514 Ga0466957_0129716 3300044842 Bacteria 1614
515 Ga0466959_0000076 3300045049 Bacteria 62314
516 Ga0466959_0032034 3300045049 Bacteria 3890
517 Ga0495629_0028475 3300046459 Bacteria 3967
518 Ga0495580_0032932 3300046472 Bacteria 3735
519 Ga0495582_0015665 3300046473 Bacteria 4161
520 Ga0495662_0038799 3300046476 Bacteria 2302
521 Ga0495606_0004028 3300046507 Bacteria 14985
522 Ga0495630_0018405 3300046517 Bacteria 5132
523 Ga0495648_0003503 3300046524 Bacteria 13761
524 Ga0495652_0058503 3300046529 Bacteria 3263
525 Ga0495668_0000078 3300046616 Bacteria 157809
526 Ga0495668_0033726 3300046616 Bacteria 2875
527 Ga0495611_0000072 3300046648 Bacteria 70916
528 Ga0495623_0076584 3300046679 Bacteria 2076
529 Ga0495658_0029575 3300046683 Bacteria 2968
530 Ga0495670_0030682 3300046691 Bacteria 2670
531 Ga0495636_0000002 3300047318 Bacteria 145900
532 Ga0495674_0050697 3300047319 Bacteria 3662
533 Ga0495672_0015121 3300047320 Bacteria 5253
534 Ga0495672_0044440 3300047320 Bacteria 2665
535 Ga0495687_000031 3300047443 Bacteria 274659
536 Ga0495686_0000005 3300047472 Bacteria 827143
537 Ga0495686_0000480 3300047472 Bacteria 59448
538 Ga0495686_0021042 3300047472 Bacteria 4341
539 Ga0496108_0140010 3300048911 Unclassified 2084
540 Ga0496114_0000297 3300048917 Bacteria 36559
541 Ga0496114_0019221 3300048917 Bacteria 5536
542 Ga0496115_0013024 3300048918 Bacteria 6278
543 Ga0501031_0010242 3300049568 Bacteria 6104
544 Ga0501034_0070521 3300049571 Bacteria 3505
545 Ga0501034_0266141 3300049571 Bacteria 1656
546 Ga0501036_0005958 3300049572 Bacteria 9882
547 Ga0501036_0056884 3300049572 Bacteria 3313
548 Ga0501038_0004158 3300049574 Bacteria 13460
549 Ga0501047_0010114 3300049581 Bacteria 8918
550 Ga0501047_0029344 3300049581 Bacteria 5306
551 Ga0501047_0111831 3300049581 Bacteria 2613
552 Ga0501047_0222613 3300049581 Bacteria 1743
553 Ga0501048_0040331 3300049582 Bacteria 3347
554 Ga0501067_0031370 3300049583 Bacteria 2949
555 Ga0501069_0041351 3300049585 Bacteria 2547
556 Ga0501073_0020388 3300049589 Bacteria 4782
557 Ga0501074_0017551 3300049590 Bacteria 5195
558 Ga0501074_0039174 3300049590 Bacteria 3432
559 Ga0501219_000076 3300049703 Bacteria 17037
560 Ga0501080_0064178 3300049742 Bacteria 3416
561 Ga0501080_0088114 3300049742 Bacteria 2883
562 Ga0501083_0010722 3300049744 Bacteria 6447
563 Ga0501083_0042760 3300049744 Bacteria 3070
564 Ga0501035_0040581 3300049822 Bacteria 4204
565 Ga0501035_0070308 3300049822 Bacteria 3101
566 Ga0501035_0128140 3300049822 Bacteria 2214
567 Ga0501044_0003735 3300049823 Bacteria 17103
568 Ga0501044_0014396 3300049823 Bacteria 8542
569 Ga0501044_0052083 3300049823 Bacteria 4220
570 Ga0501044_0127040 3300049823 Bacteria 2546
571 Ga0501044_0193782 3300049823 Bacteria 1993
572 Ga0501284_00006 3300050005 Bacteria 153628
573 nmdc:mga0k408_62121_c2 3300050493 Bacteria 1287
574 nmdc:mga0k408_64004_c1 3300050493 Bacteria 2140
575 nmdc:mga09592_139547_c1 3300050508 Bacteria 2089
576 nmdc:mga0qj67_116810_c1 3300050509 Bacteria 2156
577 nmdc:mga0qj67_24930_c1 3300050509 Bacteria 4616
578 nmdc:mga06r32_193811_c1 3300050510 Bacteria 2019
579 Ga0500578_0000100 3300053086 Bacteria 99827
580 Ga0500646_0011854 3300053090 Bacteria 2246
581 Ga0500583_0000009 3300053092 Bacteria 160749
582 Ga0500562_000219 3300053108 Bacteria 15356
583 Ga0500559_0010601 3300053136 Bacteria 3953
584 Ga0500568_0001667 3300053139 Bacteria 13916
585 Ga0500588_0006799 3300053146 Bacteria 2612
586 Ga0500589_004823 3300053147 Bacteria 5152
587 Ga0500603_022152 3300053150 Bacteria 1571
588 Ga0500616_0001244 3300053153 Bacteria 25549
589 Ga0500622_0000615 3300053156 Bacteria 32225
590 Ga0500622_0003672 3300053156 Bacteria 10078
591 Ga0500636_0042243 3300053177 Bacteria 2695
592 Ga0500645_003248 3300053730 Bacteria 6721
593 Ga0500645_009136 3300053730 Bacteria 3344
594 Ga0501082_0019650 3300060353 Bacteria 5824
595 Ga0466962_0018397 3300061719 Bacteria 3360

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026121 Ga0207683_10219796 Ga0207683_102197962 393
2 3300026121 Ga0207683_10030580 Ga0207683_100305804 395
3 3300050493 nmdc:mga0k408_62121_c2 nmdc:mga0k408_62121_c2_36_1277 413
4 3300013297 Ga0157378_10158110 Ga0157378_101581101 431
5 3300049571 Ga0501034_0266141 Ga0501034_0266141_309_1613 432
6 3300003791 Ga0055530_10001651 Ga0055530_100016519 436
7 3300025302 Ga0207426_1002135 Ga0207426_10021352 436
8 3300049823 Ga0501044_0014396 Ga0501044_0014396_519_1829 436
9 3300005367 Ga0070667_100010344 Ga0070667_1000103447 437
10 3300025913 Ga0207695_10003406 Ga0207695_1000340610 437
11 3300025913 Ga0207695_10035312 Ga0207695_100353124 437
12 3300025914 Ga0207671_10002573 Ga0207671_100025739 437
13 3300025949 Ga0207667_10000270 Ga0207667_1000027040 437
14 3300009093 Ga0105240_10038013 Ga0105240_100380133 446
15 3300010375 Ga0105239_10319936 Ga0105239_103199362 446
16 3300025913 Ga0207695_10034967 Ga0207695_100349674 446
17 3300005548 Ga0070665_100021714 Ga0070665_1000217145 449
18 3300028379 Ga0268266_10020935 Ga0268266_100209355 449
19 3300013307 Ga0157372_10094716 Ga0157372_100947163 457
20 3300009093 Ga0105240_10000138 Ga0105240_10000138126 459
21 3300010375 Ga0105239_10000204 Ga0105239_1000020475 459
22 3300025913 Ga0207695_10000064 Ga0207695_10000064326 459
23 3300048917 Ga0496114_0000297 Ga0496114_0000297_27548_29005 461
24 3300031251 Ga0265327_10000034 Ga0265327_1000003454 462
25 iso_pu_bacteria 2738541278 2738725975 463
26 iso_pu_bacteria 2929921140 2929922449 463
27 iso_pu_bacteria 8003151029 8003153873 463
28 3300031251 Ga0265327_10000390 Ga0265327_1000039076 464
29 3300053136 Ga0500559_0010601 Ga0500559_0010601_598_2061 464
30 iso_pu_bacteria 2818991444 2819590478 464
31 iso_pu_bacteria 2929154850 2929158643 464
32 3300005328 Ga0070676_10002024 Ga0070676_100020241 465
33 3300005329 Ga0070683_100000292 Ga0070683_10000029226 465
34 3300005330 Ga0070690_100102296 Ga0070690_1001022961 465
35 3300005331 Ga0070670_100052551 Ga0070670_1000525512 465
36 3300005335 Ga0070666_10008494 Ga0070666_100084943 465
37 3300005338 Ga0068868_100007563 Ga0068868_1000075632 465
38 3300005344 Ga0070661_100000350 Ga0070661_10000035027 465
39 3300005355 Ga0070671_100175367 Ga0070671_1001753671 465
40 3300005365 Ga0070688_100006810 Ga0070688_1000068105 465
41 3300005366 Ga0070659_100005305 Ga0070659_1000053054 465
42 3300005367 Ga0070667_100037238 Ga0070667_1000372382 465
43 3300005367 Ga0070667_100071933 Ga0070667_1000719332 465
44 3300005457 Ga0070662_100001190 Ga0070662_10000119016 465
45 3300005535 Ga0070684_100000508 Ga0070684_10000050815 465
46 3300005539 Ga0068853_100011866 Ga0068853_1000118664 465
47 3300005548 Ga0070665_100123688 Ga0070665_1001236882 465
48 3300005564 Ga0070664_100000445 Ga0070664_10000044530 465
49 3300005577 Ga0068857_100010937 Ga0068857_1000109378 465
50 3300005577 Ga0068857_100038637 Ga0068857_1000386372 465
51 3300005616 Ga0068852_100048586 Ga0068852_1000485863 465
52 3300005617 Ga0068859_100030431 Ga0068859_1000304313 465
53 3300005841 Ga0068863_100023592 Ga0068863_1000235921 465
54 3300005842 Ga0068858_100049792 Ga0068858_1000497923 465
55 3300005843 Ga0068860_100051471 Ga0068860_1000514712 465
56 3300005844 Ga0068862_100158146 Ga0068862_1001581461 465
57 3300006163 Ga0070715_10008824 Ga0070715_100088243 465
58 3300006237 Ga0097621_100184397 Ga0097621_1001843973 465
59 3300006931 Ga0097620_100030429 Ga0097620_1000304293 465
60 3300009553 Ga0105249_10007096 Ga0105249_100070962 465
61 3300009553 Ga0105249_10236286 Ga0105249_102362862 465
62 3300011119 Ga0105246_10098892 Ga0105246_100988922 465
63 3300013296 Ga0157374_10005476 Ga0157374_100054765 465
64 3300013297 Ga0157378_10043173 Ga0157378_100431732 465
65 3300013297 Ga0157378_10152001 Ga0157378_101520012 465
66 3300013306 Ga0163162_10008308 Ga0163162_100083084 465
67 3300013308 Ga0157375_10005180 Ga0157375_100051806 465
68 3300014325 Ga0163163_10124258 Ga0163163_101242582 465
69 3300014745 Ga0157377_10002702 Ga0157377_100027024 465
70 3300014968 Ga0157379_10037623 Ga0157379_100376232 465
71 3300014968 Ga0157379_10066128 Ga0157379_100661282 465
72 3300014969 Ga0157376_10005019 Ga0157376_100050196 465
73 3300017792 Ga0163161_10003928 Ga0163161_100039282 465
74 3300017792 Ga0163161_10017422 Ga0163161_100174223 465
75 3300025920 Ga0207649_10056852 Ga0207649_100568523 465
76 3300025923 Ga0207681_10187537 Ga0207681_101875372 465
77 3300025925 Ga0207650_10078981 Ga0207650_100789813 465
78 3300025932 Ga0207690_10004641 Ga0207690_100046413 465
79 3300025933 Ga0207706_10001359 Ga0207706_100013595 465
80 3300025934 Ga0207686_10071227 Ga0207686_100712273 465
81 3300025936 Ga0207670_10005523 Ga0207670_100055235 465
82 3300025940 Ga0207691_10264375 Ga0207691_102643751 465
83 3300025944 Ga0207661_10000454 Ga0207661_1000045425 465
84 3300025945 Ga0207679_10003277 Ga0207679_100032775 465
85 3300025945 Ga0207679_10066081 Ga0207679_100660811 465
86 3300025961 Ga0207712_10005504 Ga0207712_100055046 465
87 3300025961 Ga0207712_10057916 Ga0207712_100579162 465
88 3300025986 Ga0207658_10013509 Ga0207658_100135091 465
89 3300026023 Ga0207677_10012669 Ga0207677_100126692 465
90 3300026035 Ga0207703_10018673 Ga0207703_100186734 465
91 3300026088 Ga0207641_10054205 Ga0207641_100542053 465
92 3300026089 Ga0207648_10154650 Ga0207648_101546503 465
93 3300026116 Ga0207674_10004795 Ga0207674_100047953 465
94 3300026116 Ga0207674_10103142 Ga0207674_101031422 465
95 3300026116 Ga0207674_10119036 Ga0207674_101190362 465
96 3300026121 Ga0207683_10011496 Ga0207683_100114961 465
97 3300028380 Ga0268265_10125281 Ga0268265_101252812 465
98 3300032004 Ga0307414_10057150 Ga0307414_100571502 465
99 3300046616 Ga0495668_0033726 Ga0495668_0033726_808_2274 465
100 3300001979 JGI24740J21852_10015804 JGI24740J21852_100158042 466
101 3300001989 JGI24739J22299_10000573 JGI24739J22299_100005738 466
102 3300002738 JGI25154J39366_1000021 JGI25154J39366_1000021126 466
103 3300002741 JGI25157J39369_1004453 JGI25157J39369_10044532 466
104 3300003215 JGI25153J46596_10000222 JGI25153J46596_1000022229 466
105 3300003322 rootL2_10076268 rootL2_100762681 466
106 3300003322 rootL2_10076278 rootL2_100762781 466
107 3300003323 rootH1_10017025 rootH1_100170253 466
108 3300003323 rootH1_10064497 rootH1_100644973 466
109 3300003323 rootH1_10225010 rootH1_102250102 466
110 3300003354 JGI25160J50197_1003616 JGI25160J50197_10036165 466
111 3300003354 JGI25160J50197_1005724 JGI25160J50197_10057244 466
112 3300003771 Ga0055526_1023073 Ga0055526_10230732 466
113 3300003794 Ga0055531_10032144 Ga0055531_100321442 466
114 3300005262 Ga0065165_1000579 Ga0065165_100057916 466
115 3300005329 Ga0070683_100015503 Ga0070683_1000155034 466
116 3300005331 Ga0070670_100061388 Ga0070670_1000613882 466
117 3300005331 Ga0070670_100089593 Ga0070670_1000895931 466
118 3300005334 Ga0068869_100013836 Ga0068869_1000138364 466
119 3300005334 Ga0068869_100015938 Ga0068869_1000159383 466
120 3300005334 Ga0068869_100037187 Ga0068869_1000371872 466
121 3300005338 Ga0068868_100004920 Ga0068868_1000049206 466
122 3300005344 Ga0070661_100003767 Ga0070661_1000037672 466
123 3300005353 Ga0070669_100059939 Ga0070669_1000599392 466
124 3300005356 Ga0070674_100101141 Ga0070674_1001011412 466
125 3300005364 Ga0070673_100035061 Ga0070673_1000350611 466
126 3300005471 Ga0070698_100031376 Ga0070698_1000313761 466
127 3300005535 Ga0070684_100031486 Ga0070684_1000314862 466
128 3300005539 Ga0068853_100036255 Ga0068853_1000362552 466
129 3300005563 Ga0068855_100003963 Ga0068855_10000396316 466
130 3300005577 Ga0068857_100037620 Ga0068857_1000376202 466
131 3300005614 Ga0068856_100014734 Ga0068856_1000147344 466
132 3300005618 Ga0068864_100031437 Ga0068864_1000314372 466
133 3300005718 Ga0068866_10054303 Ga0068866_100543032 466
134 3300005840 Ga0068870_10037944 Ga0068870_100379441 466
135 3300005843 Ga0068860_100139082 Ga0068860_1001390821 466
136 3300006195 Ga0075366_10002314 Ga0075366_100023142 466
137 3300006195 Ga0075366_10015119 Ga0075366_100151192 466
138 3300006237 Ga0097621_100216916 Ga0097621_1002169162 466
139 3300009147 Ga0114129_10055684 Ga0114129_100556843 466
140 3300009174 Ga0105241_10031694 Ga0105241_100316942 466
141 3300009545 Ga0105237_10012903 Ga0105237_100129034 466
142 3300010375 Ga0105239_10001030 Ga0105239_1000103038 466
143 3300011119 Ga0105246_10042223 Ga0105246_100422232 466
144 3300013104 Ga0157370_10095570 Ga0157370_100955702 466
145 3300013296 Ga0157374_10065006 Ga0157374_100650063 466
146 3300013306 Ga0163162_10038660 Ga0163162_100386601 466
147 3300013306 Ga0163162_10067468 Ga0163162_100674682 466
148 3300013307 Ga0157372_10022220 Ga0157372_100222204 466
149 3300013308 Ga0157375_10063424 Ga0157375_100634243 466
150 3300013308 Ga0157375_10248717 Ga0157375_102487171 466
151 3300014325 Ga0163163_10001739 Ga0163163_100017396 466
152 3300025246 Ga0209646_1000050 Ga0209646_1000050128 466
153 3300025246 Ga0209646_1003802 Ga0209646_10038023 466
154 3300025250 Ga0209026_1000195 Ga0209026_100019555 466
155 3300025273 Ga0209673_1000339 Ga0209673_100033959 466
156 3300025295 Ga0209564_1004514 Ga0209564_10045148 466
157 3300025297 Ga0209758_1000653 Ga0209758_100065325 466
158 3300025297 Ga0209758_1010093 Ga0209758_10100932 466
159 3300025298 Ga0209050_1000256 Ga0209050_100025626 466
160 3300025302 Ga0207426_1001367 Ga0207426_10013679 466
161 3300025304 Ga0209257_1000659 Ga0209257_100065939 466
162 3300025903 Ga0207680_10024020 Ga0207680_100240202 466
163 3300025904 Ga0207647_10034338 Ga0207647_100343382 466
164 3300025907 Ga0207645_10000606 Ga0207645_1000060612 466
165 3300025908 Ga0207643_10015070 Ga0207643_100150703 466
166 3300025914 Ga0207671_10000103 Ga0207671_1000010358 466
167 3300025920 Ga0207649_10004662 Ga0207649_100046622 466
168 3300025923 Ga0207681_10186669 Ga0207681_101866691 466
169 3300025940 Ga0207691_10037249 Ga0207691_100372493 466
170 3300025942 Ga0207689_10000585 Ga0207689_100005852 466
171 3300025942 Ga0207689_10005429 Ga0207689_100054292 466
172 3300025942 Ga0207689_10024938 Ga0207689_100249382 466
173 3300025942 Ga0207689_10049619 Ga0207689_100496192 466
174 3300025944 Ga0207661_10006868 Ga0207661_100068684 466
175 3300025945 Ga0207679_10010888 Ga0207679_100108884 466
176 3300025949 Ga0207667_10004340 Ga0207667_100043402 466
177 3300025986 Ga0207658_10145385 Ga0207658_101453852 466
178 3300026023 Ga0207677_10021555 Ga0207677_100215552 466
179 3300026035 Ga0207703_10123612 Ga0207703_101236122 466
180 3300026041 Ga0207639_10007545 Ga0207639_100075454 466
181 3300026067 Ga0207678_10016784 Ga0207678_100167845 466
182 3300026078 Ga0207702_10020842 Ga0207702_100208423 466
183 3300026089 Ga0207648_10004110 Ga0207648_100041109 466
184 3300026089 Ga0207648_10055852 Ga0207648_100558522 466
185 3300026089 Ga0207648_10179126 Ga0207648_101791262 466
186 3300026095 Ga0207676_10009360 Ga0207676_100093605 466
187 3300026116 Ga0207674_10026414 Ga0207674_100264143 466
188 3300026116 Ga0207674_10026681 Ga0207674_100266812 466
189 3300026118 Ga0207675_100096251 Ga0207675_1000962512 466
190 3300028381 Ga0268264_10049286 Ga0268264_100492862 466
191 3300028381 Ga0268264_10100328 Ga0268264_101003282 466
192 3300041507 Ga0451851_0645281 Ga0451851_0645281_27_1430 466
193 3300042007 Ga0439449_0019064 Ga0439449_0019064_758_2161 466
194 3300042014 Ga0439457_000035 Ga0439457_000035_11489_12892 466
195 3300042015 Ga0439462_0001746 Ga0439462_0001746_206_1609 466
196 3300044656 Ga0466969_0000543 Ga0466969_0000543_5661_7064 466
197 3300044658 Ga0466972_0000105 Ga0466972_0000105_3962_5365 466
198 3300044684 Ga0466966_0036553 Ga0466966_0036553_577_1980 466
199 3300045049 Ga0466959_0000076 Ga0466959_0000076_7749_9152 466
200 3300046616 Ga0495668_0000078 Ga0495668_0000078_96229_97683 466
201 3300047318 Ga0495636_0000002 Ga0495636_0000002_137540_139009 466
202 3300047472 Ga0495686_0000480 Ga0495686_0000480_38728_40182 466
203 3300047472 Ga0495686_0021042 Ga0495686_0021042_2780_4225 466
204 3300048918 Ga0496115_0013024 Ga0496115_0013024_3147_4610 466
205 3300049568 Ga0501031_0010242 Ga0501031_0010242_2053_3456 466
206 3300049571 Ga0501034_0070521 Ga0501034_0070521_1482_2885 466
207 3300049572 Ga0501036_0005958 Ga0501036_0005958_6238_7641 466
208 3300049572 Ga0501036_0056884 Ga0501036_0056884_264_1667 466
209 3300049574 Ga0501038_0004158 Ga0501038_0004158_8304_9707 466
210 3300049581 Ga0501047_0010114 Ga0501047_0010114_2942_4360 466
211 3300049581 Ga0501047_0029344 Ga0501047_0029344_626_2029 466
212 3300049581 Ga0501047_0111831 Ga0501047_0111831_371_1774 466
213 3300049582 Ga0501048_0040331 Ga0501048_0040331_986_2389 466
214 3300049583 Ga0501067_0031370 Ga0501067_0031370_836_2239 466
215 3300049590 Ga0501074_0039174 Ga0501074_0039174_1766_3169 466
216 3300049742 Ga0501080_0064178 Ga0501080_0064178_1890_3293 466
217 3300049744 Ga0501083_0010722 Ga0501083_0010722_2549_3952 466
218 3300049822 Ga0501035_0040581 Ga0501035_0040581_1107_2510 466
219 3300049822 Ga0501035_0070308 Ga0501035_0070308_50_1516 466
220 3300049822 Ga0501035_0128140 Ga0501035_0128140_96_1499 466
221 3300049823 Ga0501044_0003735 Ga0501044_0003735_12699_14102 466
222 3300049823 Ga0501044_0052083 Ga0501044_0052083_2628_4046 466
223 3300049823 Ga0501044_0127040 Ga0501044_0127040_77_1480 466
224 3300050493 nmdc:mga0k408_64004_c1 nmdc:mga0k408_64004_c1_634_2037 466
225 3300053086 Ga0500578_0000100 Ga0500578_0000100_61339_62748 466
226 3300053092 Ga0500583_0000009 Ga0500583_0000009_80046_81449 466
227 3300053147 Ga0500589_004823 Ga0500589_004823_3160_4563 466
228 3300053150 Ga0500603_022152 Ga0500603_022152_36_1439 466
229 3300053153 Ga0500616_0001244 Ga0500616_0001244_14790_16244 466
230 3300053177 Ga0500636_0042243 Ga0500636_0042243_652_2055 466
231 3300003316 rootH1_10116196 rootH1_101161963 467
232 3300003320 rootH2_10001918 rootH2_100019182 467
233 3300003320 rootH2_10049592 rootH2_100495924 467
234 3300003320 rootH2_10053498 rootH2_100534983 467
235 3300003322 rootL2_10121572 rootL2_101215721 467
236 3300003323 rootH1_10317284 rootH1_103172842 467
237 3300005290 Ga0065712_10001191 Ga0065712_100011913 467
238 3300005290 Ga0065712_10011864 Ga0065712_100118642 467
239 3300005293 Ga0065715_10004363 Ga0065715_100043632 467
240 3300005327 Ga0070658_10003542 Ga0070658_100035422 467
241 3300005328 Ga0070676_10002966 Ga0070676_100029663 467
242 3300005328 Ga0070676_10046563 Ga0070676_100465631 467
243 3300005329 Ga0070683_100001205 Ga0070683_10000120515 467
244 3300005329 Ga0070683_100064799 Ga0070683_1000647994 467
245 3300005331 Ga0070670_100098525 Ga0070670_1000985251 467
246 3300005334 Ga0068869_100008280 Ga0068869_1000082804 467
247 3300005335 Ga0070666_10000019 Ga0070666_10000019105 467
248 3300005335 Ga0070666_10010165 Ga0070666_100101654 467
249 3300005335 Ga0070666_10013027 Ga0070666_100130273 467
250 3300005336 Ga0070680_100023459 Ga0070680_1000234592 467
251 3300005338 Ga0068868_100002206 Ga0068868_1000022062 467
252 3300005338 Ga0068868_100007993 Ga0068868_1000079936 467
253 3300005338 Ga0068868_100061477 Ga0068868_1000614773 467
254 3300005340 Ga0070689_100006975 Ga0070689_1000069755 467
255 3300005340 Ga0070689_100019780 Ga0070689_1000197802 467
256 3300005347 Ga0070668_100002414 Ga0070668_1000024143 467
257 3300005347 Ga0070668_100028325 Ga0070668_1000283253 467
258 3300005354 Ga0070675_100019801 Ga0070675_1000198014 467
259 3300005354 Ga0070675_100129861 Ga0070675_1001298611 467
260 3300005355 Ga0070671_100001143 Ga0070671_10000114314 467
261 3300005356 Ga0070674_100182389 Ga0070674_1001823891 467
262 3300005364 Ga0070673_100014307 Ga0070673_1000143074 467
263 3300005364 Ga0070673_100019702 Ga0070673_1000197022 467
264 3300005365 Ga0070688_100044021 Ga0070688_1000440212 467
265 3300005365 Ga0070688_100082919 Ga0070688_1000829192 467
266 3300005367 Ga0070667_100000031 Ga0070667_1000000316 467
267 3300005367 Ga0070667_100052349 Ga0070667_1000523491 467
268 3300005455 Ga0070663_100058925 Ga0070663_1000589252 467
269 3300005457 Ga0070662_100001909 Ga0070662_1000019093 467
270 3300005457 Ga0070662_100089821 Ga0070662_1000898212 467
271 3300005459 Ga0068867_100009415 Ga0068867_1000094154 467
272 3300005459 Ga0068867_100009690 Ga0068867_1000096903 467
273 3300005459 Ga0068867_100012634 Ga0068867_1000126344 467
274 3300005459 Ga0068867_100053480 Ga0068867_1000534802 467
275 3300005466 Ga0070685_10013706 Ga0070685_100137062 467
276 3300005471 Ga0070698_100005311 Ga0070698_10000531110 467
277 3300005471 Ga0070698_100011645 Ga0070698_1000116456 467
278 3300005530 Ga0070679_100237158 Ga0070679_1002371582 467
279 3300005535 Ga0070684_100025502 Ga0070684_1000255024 467
280 3300005539 Ga0068853_100001666 Ga0068853_1000016668 467
281 3300005539 Ga0068853_100019053 Ga0068853_1000190534 467
282 3300005539 Ga0068853_100019166 Ga0068853_1000191663 467
283 3300005539 Ga0068853_100049879 Ga0068853_1000498793 467
284 3300005543 Ga0070672_100005602 Ga0070672_1000056026 467
285 3300005543 Ga0070672_100120217 Ga0070672_1001202172 467
286 3300005547 Ga0070693_100009128 Ga0070693_1000091284 467
287 3300005548 Ga0070665_100000018 Ga0070665_100000018249 467
288 3300005548 Ga0070665_100002650 Ga0070665_1000026503 467
289 3300005563 Ga0068855_100001866 Ga0068855_1000018666 467
290 3300005563 Ga0068855_100032219 Ga0068855_1000322196 467
291 3300005563 Ga0068855_100315211 Ga0068855_1003152112 467
292 3300005564 Ga0070664_100064059 Ga0070664_1000640592 467
293 3300005577 Ga0068857_100043089 Ga0068857_1000430894 467
294 3300005578 Ga0068854_100014549 Ga0068854_1000145493 467
295 3300005616 Ga0068852_100000274 Ga0068852_10000027417 467
296 3300005616 Ga0068852_100040671 Ga0068852_1000406715 467
297 3300005616 Ga0068852_100058866 Ga0068852_1000588663 467
298 3300005616 Ga0068852_100126443 Ga0068852_1001264432 467
299 3300005617 Ga0068859_100000013 Ga0068859_100000013142 467
300 3300005617 Ga0068859_100000451 Ga0068859_1000004512 467
301 3300005617 Ga0068859_100135628 Ga0068859_1001356282 467
302 3300005617 Ga0068859_100208896 Ga0068859_1002088962 467
303 3300005618 Ga0068864_100006018 Ga0068864_1000060186 467
304 3300005618 Ga0068864_100009714 Ga0068864_1000097142 467
305 3300005618 Ga0068864_100072565 Ga0068864_1000725652 467
306 3300005719 Ga0068861_100005961 Ga0068861_1000059617 467
307 3300005719 Ga0068861_100049205 Ga0068861_1000492053 467
308 3300005719 Ga0068861_100166549 Ga0068861_1001665491 467
309 3300005834 Ga0068851_10001096 Ga0068851_1000109611 467
310 3300005834 Ga0068851_10009552 Ga0068851_100095525 467
311 3300005834 Ga0068851_10033809 Ga0068851_100338092 467
312 3300005834 Ga0068851_10047500 Ga0068851_100475002 467
313 3300005840 Ga0068870_10033666 Ga0068870_100336662 467
314 3300005841 Ga0068863_100005507 Ga0068863_1000055073 467
315 3300005841 Ga0068863_100018879 Ga0068863_1000188793 467
316 3300005841 Ga0068863_100025539 Ga0068863_1000255392 467
317 3300005841 Ga0068863_100087680 Ga0068863_1000876802 467
318 3300005842 Ga0068858_100004954 Ga0068858_10000495410 467
319 3300005842 Ga0068858_100021942 Ga0068858_1000219424 467
320 3300005842 Ga0068858_100086984 Ga0068858_1000869842 467
321 3300005843 Ga0068860_100000040 Ga0068860_10000004059 467
322 3300005843 Ga0068860_100000948 Ga0068860_10000094819 467
323 3300005843 Ga0068860_100005457 Ga0068860_1000054576 467
324 3300005843 Ga0068860_100016192 Ga0068860_1000161926 467
325 3300005843 Ga0068860_100029845 Ga0068860_1000298453 467
326 3300005843 Ga0068860_100240183 Ga0068860_1002401832 467
327 3300005843 Ga0068860_100299886 Ga0068860_1002998861 467
328 3300006237 Ga0097621_100001789 Ga0097621_1000017897 467
329 3300006237 Ga0097621_100003766 Ga0097621_1000037666 467
330 3300006237 Ga0097621_100006952 Ga0097621_1000069524 467
331 3300006237 Ga0097621_100008416 Ga0097621_1000084164 467
332 3300006237 Ga0097621_100009337 Ga0097621_1000093373 467
333 3300006358 Ga0068871_100000075 Ga0068871_10000007550 467
334 3300006358 Ga0068871_100001976 Ga0068871_10000197611 467
335 3300006358 Ga0068871_100004482 Ga0068871_1000044822 467
336 3300006358 Ga0068871_100007909 Ga0068871_1000079096 467
337 3300006358 Ga0068871_100016350 Ga0068871_1000163502 467
338 3300006358 Ga0068871_100197741 Ga0068871_1001977412 467
339 3300006358 Ga0068871_100209620 Ga0068871_1002096201 467
340 3300006844 Ga0075428_100005318 Ga0075428_1000053182 467
341 3300006844 Ga0075428_100052566 Ga0075428_1000525663 467
342 3300006846 Ga0075430_100010757 Ga0075430_1000107572 467
343 3300006846 Ga0075430_100025027 Ga0075430_1000250274 467
344 3300006880 Ga0075429_100000991 Ga0075429_1000009914 467
345 3300006881 Ga0068865_100004346 Ga0068865_1000043464 467
346 3300006931 Ga0097620_100000013 Ga0097620_100000013142 467
347 3300006931 Ga0097620_100000451 Ga0097620_10000045138 467
348 3300006931 Ga0097620_100135626 Ga0097620_1001356262 467
349 3300006931 Ga0097620_100208892 Ga0097620_1002088921 467
350 3300009093 Ga0105240_10000785 Ga0105240_1000078523 467
351 3300009093 Ga0105240_10003502 Ga0105240_1000350212 467
352 3300009093 Ga0105240_10005325 Ga0105240_1000532516 467
353 3300009093 Ga0105240_10009847 Ga0105240_1000984711 467
354 3300009093 Ga0105240_10025643 Ga0105240_100256434 467
355 3300009093 Ga0105240_10025938 Ga0105240_100259384 467
356 3300009093 Ga0105240_10027963 Ga0105240_100279636 467
357 3300009093 Ga0105240_10039588 Ga0105240_100395885 467
358 3300009093 Ga0105240_10051730 Ga0105240_100517302 467
359 3300009093 Ga0105240_10203335 Ga0105240_102033352 467
360 3300009094 Ga0111539_10080351 Ga0111539_100803511 467
361 3300009101 Ga0105247_10010798 Ga0105247_100107984 467
362 3300009147 Ga0114129_10101951 Ga0114129_101019513 467
363 3300009147 Ga0114129_10136259 Ga0114129_101362593 467
364 3300009174 Ga0105241_10000297 Ga0105241_100002976 467
365 3300009174 Ga0105241_10016359 Ga0105241_100163591 467
366 3300009174 Ga0105241_10042983 Ga0105241_100429833 467
367 3300009176 Ga0105242_10005909 Ga0105242_100059094 467
368 3300009176 Ga0105242_10022521 Ga0105242_100225214 467
369 3300009176 Ga0105242_10035688 Ga0105242_100356884 467
370 3300009176 Ga0105242_10109560 Ga0105242_101095602 467
371 3300009176 Ga0105242_10184785 Ga0105242_101847852 467
372 3300009177 Ga0105248_10046424 Ga0105248_100464243 467
373 3300009545 Ga0105237_10000473 Ga0105237_100004738 467
374 3300009545 Ga0105237_10003067 Ga0105237_100030675 467
375 3300009545 Ga0105237_10006182 Ga0105237_100061823 467
376 3300009545 Ga0105237_10013588 Ga0105237_100135884 467
377 3300009545 Ga0105237_10114937 Ga0105237_101149372 467
378 3300009551 Ga0105238_10001633 Ga0105238_1000163313 467
379 3300009553 Ga0105249_10003772 Ga0105249_100037722 467
380 3300009553 Ga0105249_10009750 Ga0105249_100097504 467
381 3300009553 Ga0105249_10151484 Ga0105249_101514842 467
382 3300009553 Ga0105249_10252241 Ga0105249_102522411 467
383 3300010375 Ga0105239_10000998 Ga0105239_100009982 467
384 3300010375 Ga0105239_10006070 Ga0105239_100060703 467
385 3300010375 Ga0105239_10006812 Ga0105239_100068127 467
386 3300010375 Ga0105239_10085257 Ga0105239_100852572 467
387 3300010375 Ga0105239_10086949 Ga0105239_100869493 467
388 3300011119 Ga0105246_10059210 Ga0105246_100592102 467
389 3300013100 Ga0157373_10064655 Ga0157373_100646551 467
390 3300013100 Ga0157373_10100357 Ga0157373_101003571 467
391 3300013104 Ga0157370_10006139 Ga0157370_100061399 467
392 3300013104 Ga0157370_10021907 Ga0157370_100219075 467
393 3300013105 Ga0157369_10043109 Ga0157369_100431093 467
394 3300013105 Ga0157369_10077048 Ga0157369_100770484 467
395 3300013296 Ga0157374_10000025 Ga0157374_10000025184 467
396 3300013296 Ga0157374_10015781 Ga0157374_100157814 467
397 3300013296 Ga0157374_10082951 Ga0157374_100829512 467
398 3300013296 Ga0157374_10135369 Ga0157374_101353692 467
399 3300013297 Ga0157378_10014751 Ga0157378_100147514 467
400 3300013297 Ga0157378_10016084 Ga0157378_100160842 467
401 3300013297 Ga0157378_10141774 Ga0157378_101417741 467
402 3300013306 Ga0163162_10001619 Ga0163162_100016197 467
403 3300013306 Ga0163162_10003073 Ga0163162_1000307314 467
404 3300013306 Ga0163162_10008228 Ga0163162_100082283 467
405 3300013306 Ga0163162_10015172 Ga0163162_100151729 467
406 3300013306 Ga0163162_10018688 Ga0163162_100186886 467
407 3300013306 Ga0163162_10022781 Ga0163162_100227815 467
408 3300013306 Ga0163162_10030938 Ga0163162_100309383 467
409 3300013306 Ga0163162_10113996 Ga0163162_101139962 467
410 3300013306 Ga0163162_10155053 Ga0163162_101550531 467
411 3300013307 Ga0157372_10000080 Ga0157372_1000008016 467
412 3300013307 Ga0157372_10024003 Ga0157372_100240033 467
413 3300013307 Ga0157372_10037811 Ga0157372_100378114 467
414 3300013307 Ga0157372_10149567 Ga0157372_101495672 467
415 3300013307 Ga0157372_10274791 Ga0157372_102747912 467
416 3300013308 Ga0157375_10000186 Ga0157375_1000018643 467
417 3300013308 Ga0157375_10023788 Ga0157375_100237885 467
418 3300013308 Ga0157375_10147016 Ga0157375_101470162 467
419 3300014325 Ga0163163_10000174 Ga0163163_100001746 467
420 3300014325 Ga0163163_10000895 Ga0163163_100008955 467
421 3300014325 Ga0163163_10022398 Ga0163163_100223984 467
422 3300014325 Ga0163163_10049198 Ga0163163_100491983 467
423 3300014326 Ga0157380_10016160 Ga0157380_100161602 467
424 3300014326 Ga0157380_10139568 Ga0157380_101395682 467
425 3300014326 Ga0157380_10187972 Ga0157380_101879721 467
426 3300014745 Ga0157377_10085132 Ga0157377_100851321 467
427 3300014968 Ga0157379_10008261 Ga0157379_100082612 467
428 3300014968 Ga0157379_10015024 Ga0157379_100150244 467
429 3300014968 Ga0157379_10017290 Ga0157379_100172903 467
430 3300014969 Ga0157376_10000101 Ga0157376_1000010128 467
431 3300014969 Ga0157376_10004595 Ga0157376_100045955 467
432 3300014969 Ga0157376_10020628 Ga0157376_100206283 467
433 3300014969 Ga0157376_10029662 Ga0157376_100296622 467
434 3300017792 Ga0163161_10009734 Ga0163161_100097344 467
435 3300021384 Ga0213876_10001264 Ga0213876_1000126416 467
436 3300021384 Ga0213876_10014783 Ga0213876_100147832 467
437 3300025321 Ga0207656_10012024 Ga0207656_100120242 467
438 3300025321 Ga0207656_10036795 Ga0207656_100367952 467
439 3300025893 Ga0207682_10027770 Ga0207682_100277702 467
440 3300025903 Ga0207680_10000222 Ga0207680_1000022216 467
441 3300025903 Ga0207680_10005574 Ga0207680_100055744 467
442 3300025903 Ga0207680_10008802 Ga0207680_100088023 467
443 3300025908 Ga0207643_10036643 Ga0207643_100366432 467
444 3300025909 Ga0207705_10027777 Ga0207705_100277773 467
445 3300025912 Ga0207707_10016419 Ga0207707_100164194 467
446 3300025913 Ga0207695_10000146 Ga0207695_10000146159 467
447 3300025913 Ga0207695_10000248 Ga0207695_1000024894 467
448 3300025913 Ga0207695_10000260 Ga0207695_1000026062 467
449 3300025913 Ga0207695_10013801 Ga0207695_100138017 467
450 3300025913 Ga0207695_10030928 Ga0207695_100309284 467
451 3300025913 Ga0207695_10046334 Ga0207695_100463342 467
452 3300025914 Ga0207671_10001260 Ga0207671_100012606 467
453 3300025914 Ga0207671_10002891 Ga0207671_100028915 467
454 3300025914 Ga0207671_10003161 Ga0207671_100031617 467
455 3300025914 Ga0207671_10014091 Ga0207671_100140915 467
456 3300025914 Ga0207671_10035278 Ga0207671_100352783 467
457 3300025917 Ga0207660_10007186 Ga0207660_100071866 467
458 3300025921 Ga0207652_10015549 Ga0207652_100155496 467
459 3300025923 Ga0207681_10015509 Ga0207681_100155093 467
460 3300025924 Ga0207694_10007106 Ga0207694_100071064 467
461 3300025925 Ga0207650_10018642 Ga0207650_100186423 467
462 3300025926 Ga0207659_10029643 Ga0207659_100296433 467
463 3300025926 Ga0207659_10071502 Ga0207659_100715022 467
464 3300025931 Ga0207644_10001876 Ga0207644_100018768 467
465 3300025933 Ga0207706_10004896 Ga0207706_1000489612 467
466 3300025933 Ga0207706_10099997 Ga0207706_100999973 467
467 3300025934 Ga0207686_10001833 Ga0207686_100018332 467
468 3300025934 Ga0207686_10028230 Ga0207686_100282302 467
469 3300025934 Ga0207686_10115395 Ga0207686_101153952 467
470 3300025936 Ga0207670_10057843 Ga0207670_100578431 467
471 3300025938 Ga0207704_10019869 Ga0207704_100198691 467
472 3300025940 Ga0207691_10017060 Ga0207691_100170605 467
473 3300025940 Ga0207691_10027168 Ga0207691_100271684 467
474 3300025940 Ga0207691_10050919 Ga0207691_100509192 467
475 3300025940 Ga0207691_10168485 Ga0207691_101684852 467
476 3300025942 Ga0207689_10006595 Ga0207689_100065956 467
477 3300025944 Ga0207661_10010307 Ga0207661_100103076 467
478 3300025945 Ga0207679_10037721 Ga0207679_100377213 467
479 3300025949 Ga0207667_10000520 Ga0207667_100005202 467
480 3300025949 Ga0207667_10153766 Ga0207667_101537662 467
481 3300025960 Ga0207651_10008410 Ga0207651_100084104 467
482 3300025960 Ga0207651_10039834 Ga0207651_100398342 467
483 3300025960 Ga0207651_10149408 Ga0207651_101494082 467
484 3300025961 Ga0207712_10002290 Ga0207712_100022906 467
485 3300025961 Ga0207712_10013848 Ga0207712_100138482 467
486 3300025961 Ga0207712_10068352 Ga0207712_100683522 467
487 3300025972 Ga0207668_10000298 Ga0207668_100002986 467
488 3300025981 Ga0207640_10035640 Ga0207640_100356403 467
489 3300025986 Ga0207658_10013104 Ga0207658_100131043 467
490 3300025986 Ga0207658_10085911 Ga0207658_100859112 467
491 3300025986 Ga0207658_10190446 Ga0207658_101904461 467
492 3300026023 Ga0207677_10004006 Ga0207677_100040066 467
493 3300026023 Ga0207677_10005051 Ga0207677_100050517 467
494 3300026023 Ga0207677_10132079 Ga0207677_101320792 467
495 3300026035 Ga0207703_10006003 Ga0207703_100060033 467
496 3300026035 Ga0207703_10006892 Ga0207703_100068926 467
497 3300026041 Ga0207639_10006391 Ga0207639_100063916 467
498 3300026041 Ga0207639_10015040 Ga0207639_100150404 467
499 3300026078 Ga0207702_10088939 Ga0207702_100889392 467
500 3300026088 Ga0207641_10000184 Ga0207641_1000018438 467
501 3300026088 Ga0207641_10003682 Ga0207641_1000368213 467
502 3300026088 Ga0207641_10009560 Ga0207641_100095606 467
503 3300026089 Ga0207648_10003304 Ga0207648_100033047 467
504 3300026089 Ga0207648_10018137 Ga0207648_100181374 467
505 3300026089 Ga0207648_10031381 Ga0207648_100313814 467
506 3300026089 Ga0207648_10053441 Ga0207648_100534412 467
507 3300026089 Ga0207648_10064789 Ga0207648_100647893 467
508 3300026095 Ga0207676_10003554 Ga0207676_1000355410 467
509 3300026095 Ga0207676_10024928 Ga0207676_100249283 467
510 3300026095 Ga0207676_10095738 Ga0207676_100957382 467
511 3300026116 Ga0207674_10032102 Ga0207674_100321022 467
512 3300026118 Ga0207675_100073885 Ga0207675_1000738852 467
513 3300026118 Ga0207675_100092134 Ga0207675_1000921342 467
514 3300026121 Ga0207683_10048435 Ga0207683_100484352 467
515 3300026121 Ga0207683_10090404 Ga0207683_100904042 467
516 3300026142 Ga0207698_10000963 Ga0207698_100009635 467
517 3300026142 Ga0207698_10021199 Ga0207698_100211994 467
518 3300026142 Ga0207698_10021249 Ga0207698_100212495 467
519 3300026142 Ga0207698_10057494 Ga0207698_100574942 467
520 3300028379 Ga0268266_10000026 Ga0268266_10000026110 467
521 3300028379 Ga0268266_10013819 Ga0268266_100138195 467
522 3300028381 Ga0268264_10000019 Ga0268264_1000001980 467
523 3300028381 Ga0268264_10003219 Ga0268264_100032194 467
524 3300028381 Ga0268264_10003983 Ga0268264_100039833 467
525 3300028381 Ga0268264_10039181 Ga0268264_100391812 467
526 3300028381 Ga0268264_10246372 Ga0268264_102463721 467
527 3300028786 Ga0307517_10004138 Ga0307517_1000413817 467
528 3300028786 Ga0307517_10048080 Ga0307517_100480802 467
529 3300028794 Ga0307515_10000001 Ga0307515_100000012152 467
530 3300028794 Ga0307515_10000455 Ga0307515_1000045562 467
531 3300030521 Ga0307511_10000182 Ga0307511_1000018221 467
532 3300031251 Ga0265327_10000048 Ga0265327_1000004822 467
533 3300031251 Ga0265327_10014097 Ga0265327_100140973 467
534 3300031251 Ga0265327_10018948 Ga0265327_100189483 467
535 3300031507 Ga0307509_10147116 Ga0307509_101471162 467
536 3300031616 Ga0307508_10016080 Ga0307508_100160805 467
537 3300033180 Ga0307510_10000068 Ga0307510_100000686 467
538 3300036401 Ga0373937_0009187 Ga0373937_0009187_1643_3118 467
539 3300036401 Ga0373937_0186322 Ga0373937_0186322_78_1553 467
540 3300039437 Ga0436365_1560297 Ga0436365_1560297_1163_2575 467
541 3300039437 Ga0436365_1874674 Ga0436365_1874674_47430_48836 467
542 3300042876 Ga0451577_0004359 Ga0451577_0004359_2865_4283 467
543 3300044658 Ga0466972_0000016 Ga0466972_0000016_125090_126499 467
544 3300044673 Ga0453683_0085704 Ga0453683_0085704_372_1793 467
545 3300044683 Ga0466965_0020578 Ga0466965_0020578_169_1575 467
546 3300044712 Ga0453684_0050707 Ga0453684_0050707_744_2150 467
547 3300044712 Ga0453684_0053754 Ga0453684_0053754_3509_4930 467
548 3300044735 Ga0466968_0018640 Ga0466968_0018640_1281_2687 467
549 3300044765 Ga0466970_0001127 Ga0466970_0001127_421_1830 467
550 3300044765 Ga0466970_0038168 Ga0466970_0038168_55_1461 467
551 3300044842 Ga0466957_0129716 Ga0466957_0129716_167_1573 467
552 3300045049 Ga0466959_0032034 Ga0466959_0032034_679_2085 467
553 3300046459 Ga0495629_0028475 Ga0495629_0028475_21_1496 467
554 3300046472 Ga0495580_0032932 Ga0495580_0032932_1137_2546 467
555 3300046473 Ga0495582_0015665 Ga0495582_0015665_1762_3237 467
556 3300046476 Ga0495662_0038799 Ga0495662_0038799_278_1753 467
557 3300046507 Ga0495606_0004028 Ga0495606_0004028_6847_8253 467
558 3300046517 Ga0495630_0018405 Ga0495630_0018405_1552_3027 467
559 3300046524 Ga0495648_0003503 Ga0495648_0003503_2639_4045 467
560 3300046529 Ga0495652_0058503 Ga0495652_0058503_1153_2628 467
561 3300046648 Ga0495611_0000072 Ga0495611_0000072_52382_53788 467
562 3300046679 Ga0495623_0076584 Ga0495623_0076584_412_1821 467
563 3300046683 Ga0495658_0029575 Ga0495658_0029575_934_2409 467
564 3300046691 Ga0495670_0030682 Ga0495670_0030682_831_2306 467
565 3300047319 Ga0495674_0050697 Ga0495674_0050697_1758_3233 467
566 3300047320 Ga0495672_0015121 Ga0495672_0015121_779_2344 467
567 3300047320 Ga0495672_0044440 Ga0495672_0044440_1063_2469 467
568 3300047443 Ga0495687_000031 Ga0495687_000031_237814_239220 467
569 3300047472 Ga0495686_0000005 Ga0495686_0000005_122579_123985 467
570 3300048911 Ga0496108_0140010 Ga0496108_0140010_289_1698 467
571 3300048917 Ga0496114_0019221 Ga0496114_0019221_1762_3168 467
572 3300049581 Ga0501047_0222613 Ga0501047_0222613_12_1418 467
573 3300049585 Ga0501069_0041351 Ga0501069_0041351_549_1958 467
574 3300049589 Ga0501073_0020388 Ga0501073_0020388_1561_2970 467
575 3300049590 Ga0501074_0017551 Ga0501074_0017551_3282_4691 467
576 3300049703 Ga0501219_000076 Ga0501219_000076_8240_9646 467
577 3300049742 Ga0501080_0088114 Ga0501080_0088114_1375_2784 467
578 3300049744 Ga0501083_0042760 Ga0501083_0042760_1575_2984 467
579 3300049823 Ga0501044_0193782 Ga0501044_0193782_129_1538 467
580 3300050005 Ga0501284_00006 Ga0501284_00006_87962_89368 467
581 3300050508 nmdc:mga09592_139547_c1 nmdc:mga09592_139547_c1_36_1487 467
582 3300050509 nmdc:mga0qj67_116810_c1 nmdc:mga0qj67_116810_c1_437_1888 467
583 3300050509 nmdc:mga0qj67_24930_c1 nmdc:mga0qj67_24930_c1_1502_2953 467
584 3300050510 nmdc:mga06r32_193811_c1 nmdc:mga06r32_193811_c1_411_1862 467
585 3300053090 Ga0500646_0011854 Ga0500646_0011854_149_1555 467
586 3300053108 Ga0500562_000219 Ga0500562_000219_10433_11848 467
587 3300053139 Ga0500568_0001667 Ga0500568_0001667_8912_10357 467
588 3300053146 Ga0500588_0006799 Ga0500588_0006799_562_1971 467
589 3300053156 Ga0500622_0000615 Ga0500622_0000615_9623_11038 467
590 3300053156 Ga0500622_0003672 Ga0500622_0003672_2968_4374 467
591 3300053730 Ga0500645_003248 Ga0500645_003248_2284_3699 467
592 3300053730 Ga0500645_009136 Ga0500645_009136_659_2065 467
593 3300060353 Ga0501082_0019650 Ga0501082_0019650_3540_4949 467
594 3300061719 Ga0466962_0018397 Ga0466962_0018397_1631_3037 467
595 3300003354 JGI25160J50197_1002216 JGI25160J50197_10022163 470
596 3300010375 Ga0105239_10001781 Ga0105239_1000178115 470
597 3300013307 Ga0157372_10054934 Ga0157372_100549343 470
598 3300025302 Ga0207426_1000026 Ga0207426_1000026108 470
599 3300001979 JGI24740J21852_10012939 JGI24740J21852_100129392 471
600 3300009545 Ga0105237_10028722 Ga0105237_100287222 471

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03331

LpxC

UDP-3-O-acyl N-acetylglycosamine deacetylase

10

245

0.95

PF03331

LpxC

UDP-3-O-acyl N-acetylglycosamine deacetylase

242

305

0.95

PF07977

FabA

FabA-like domain

336

459

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ci8-assembly2.cif.gz_B crystal structure of p.aeruginosa lpxc in complex with inhibitor 0.9409 8 302
7k99-assembly2.cif.gz_C crystal structure of p. aeruginosa lpxc with n-hydroxyformamide inhibitor 19 0.9388 7 309
7k9a-assembly2.cif.gz_C crystal structure of p. aeruginosa lpxc with n-hydroxyformamide inhibitor 0.9341 8 302
5u3b-assembly1.cif.gz_A pseudomonas aeruginosa lpxc in complex with nvs-lpxc-01 0.932 7 309
5u3b-assembly2.cif.gz_B pseudomonas aeruginosa lpxc in complex with nvs-lpxc-01 0.9299 7 309
ID Description Score Start End Superfamily
3p3gA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.9599 7 132 3.30.230.20
af_Q10PS1_24_147_3.30.230.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.9471 8 125 3.30.230.20
3p3gA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.9382 7 132 3.30.230.20
af_Q10PS1_24_147_3.30.230.20 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;lpxc deacetylase, domain 1 0.8953 8 125 3.30.230.20
4h4gA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.891 326 466 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A7C6FFM7-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9935 7 107 GO:0009245
GO:0016020
GO:0103117
AF-A0A1I8AMA8-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9921 8 104 GO:0009245
GO:0016020
GO:0103117
AF-A0A6M0C3P3-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9895 7 127 GO:0009245
GO:0016020
GO:0103117
AF-A0A7C5EXZ8-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9895 7 127 GO:0009245
GO:0016020
GO:0103117
AF-A0A524Q925-F1-model_v4 UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase 0.9889 408 471 GO:0016829

Feature Viewer

pLDDT pTM Quality
89 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map