F468010

General Info

Members Datasets Scaffolds Average Seq Length
600 369 522 335

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0016068|Ga0495580_0016068_3932_5029
Length 365
Sequence MELLPTVWFVAIAVLWTGYLFLEGFDLGVGMLMKLFARNNTDRRVLLNTVGPVWDGNEVWLLTAAGATFAAFPLWYASLFSALYLPLLIVLVALIFRAVAFEYRGKVDSARWRTVWDWAIALGSFTAAFGIGAALALTTTGLPIDSNGDRQGGPFAWFSGYAVLGGFAVVAFALVHALAFLALKTDGEVRHRARRWFVRLAPPALLPLLAWMVAVQLLSGKPLTWILVILGVLAAAGAWVLARKGAEGKAFGALGAFLVCATASIFGAAFPVVIPSTLNPAFNLTISNASSSAYTLGLMSIVAAVGLPLVIAYQAWTYWVFRRRVSAAHIPAAHGFLPAIAAKVLVGQSAPGGPAAKRAPRDAGE

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
3 2558860280 Kutzneria sp. 744 Isolate Unclassified
4 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
5 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
6 2643221546 Microbacterium sp. Root53 Isolate Unclassified
7 2643221553 Microbacterium sp. Root553 Isolate Unclassified
8 2643221630 Microbacterium sp. Root322 Isolate Unclassified
9 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
10 2643221649 Leifsonia sp. Root4 Isolate Unclassified
11 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
12 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
13 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
14 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
15 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
16 2773857759 Microbacterium sp. 1294 Isolate Unclassified
17 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
18 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
19 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
20 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
21 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
22 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
23 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
24 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
25 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
26 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
27 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
28 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
29 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
30 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
31 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
32 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
33 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
34 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
35 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
36 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
37 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
38 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
39 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
40 2891562705 Microbispora tritici MT50 Isolate Unclassified
41 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
42 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
43 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
44 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
45 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
46 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
47 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
48 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
49 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
50 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
51 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
52 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
53 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
54 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
55 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
56 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
57 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
58 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
59 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
60 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
61 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
62 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
63 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
64 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
65 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
66 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
67 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
68 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
69 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
70 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
71 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
72 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
73 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
75 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
76 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
79 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
80 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
84 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
85 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
86 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
87 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
88 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
89 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
90 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
91 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
92 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
93 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
94 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
95 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
96 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
97 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
98 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
99 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
100 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
101 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
102 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
103 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
104 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
107 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
111 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
112 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
113 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
114 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
122 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
123 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
128 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
129 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
130 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
131 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
132 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
133 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
134 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
135 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
138 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
139 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
144 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
145 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
146 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
147 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
148 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
149 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
152 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
153 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
154 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
155 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
156 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
157 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
158 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
159 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
161 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
215 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
216 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
217 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
218 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
219 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
220 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
223 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
224 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
225 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
226 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
229 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
230 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
231 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
233 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
240 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
241 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
242 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
243 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
244 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
245 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
246 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
249 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
250 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
251 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
252 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
253 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
254 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
255 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
256 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
257 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
258 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
261 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
262 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
263 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
267 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
268 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
269 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
272 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
273 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
279 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
282 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
283 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
284 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
285 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
286 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
287 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
288 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
289 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
290 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
295 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
296 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
297 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
315 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
316 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
317 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
318 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
319 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
320 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
321 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
340 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
341 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
342 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
343 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
347 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
348 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
349 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
350 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
351 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
352 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
358 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
359 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
360 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
363 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
364 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
365 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
366 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
367 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
368 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
369 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.17
Metatranscriptomes 0.83
Isolates 13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5
Nodule 0
Rhizoplane 6.83
Rhizosphere 75.17
Stem 0
Stem Tuber 0
Unclassified 13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1001850 3300001976 Bacteria 2825
2 JGI25154J39366_1002102 3300002738 Bacteria 5598
3 JGI25152J39213_1000330 3300002773 Bacteria 29988
4 JGI25406J46586_10000539 3300003203 Bacteria 17725
5 Ga0006562J51391_1008978 3300003578 Bacteria 4644
6 Ga0006562J51391_1016731 3300003578 Bacteria 16779
7 Ga0055542_1003624 3300003762 Bacteria 4080
8 Ga0070676_10049956 3300005328 Bacteria 2450
9 Ga0070690_100185041 3300005330 Bacteria 1441
10 Ga0070677_10017792 3300005333 Bacteria 2550
11 Ga0068869_100031519 3300005334 Bacteria 3729
12 Ga0070666_10057526 3300005335 Bacteria 2627
13 Ga0070666_10129362 3300005335 Bacteria 1754
14 Ga0070680_100008025 3300005336 Bacteria 8063
15 Ga0070660_100018825 3300005339 Bacteria 5053
16 Ga0070660_100020378 3300005339 Bacteria 4873
17 Ga0070691_10008519 3300005341 Bacteria 4695
18 Ga0070692_10043748 3300005345 Bacteria 2304
19 Ga0070668_100136729 3300005347 Bacteria 1972
20 Ga0070669_100004417 3300005353 Bacteria 10144
21 Ga0070669_100035663 3300005353 Bacteria 3604
22 Ga0070675_100140882 3300005354 Bacteria 2061
23 Ga0070671_100000270 3300005355 Bacteria 35025
24 Ga0070671_100034188 3300005355 Bacteria 4208
25 Ga0070674_100101092 3300005356 Bacteria 2101
26 Ga0070688_100179838 3300005365 Bacteria 1466
27 Ga0070659_100007511 3300005366 Bacteria 7919
28 Ga0070667_100000171 3300005367 Bacteria 80660
29 Ga0070667_100051906 3300005367 Bacteria 3458
30 Ga0070714_100188262 3300005435 Bacteria 1882
31 Ga0070713_100024840 3300005436 Bacteria 4676
32 Ga0070710_10143002 3300005437 Bacteria 1469
33 Ga0070701_10044545 3300005438 Bacteria 2273
34 Ga0070678_100013147 3300005456 Bacteria 5177
35 Ga0070678_100019103 3300005456 Bacteria 4458
36 Ga0070681_10134479 3300005458 Bacteria 2403
37 Ga0070685_10011134 3300005466 Bacteria 4700
38 Ga0068853_100006224 3300005539 Bacteria 9455
39 Ga0070672_100053330 3300005543 Bacteria 3161
40 Ga0070672_100139247 3300005543 Bacteria 2000
41 Ga0070686_100118879 3300005544 Bacteria 1812
42 Ga0070693_100000670 3300005547 Bacteria 15154
43 Ga0070665_100001599 3300005548 Bacteria 26065
44 Ga0070665_100012514 3300005548 Bacteria 8549
45 Ga0070665_100015519 3300005548 Bacteria 7653
46 Ga0070665_100285127 3300005548 Bacteria 1653
47 Ga0068857_100002565 3300005577 Bacteria 14875
48 Ga0068854_100141509 3300005578 Bacteria 1846
49 Ga0068856_100002376 3300005614 Bacteria 19360
50 Ga0068852_100002668 3300005616 Bacteria 12333
51 Ga0068852_100057605 3300005616 Bacteria 3362
52 Ga0068859_100058958 3300005617 Bacteria 3867
53 Ga0068864_100103970 3300005618 Bacteria 2522
54 Ga0068851_10000015 3300005834 Bacteria 145191
55 Ga0068870_10000042 3300005840 Bacteria 38938
56 Ga0068863_100002067 3300005841 Bacteria 19908
57 Ga0068863_100005765 3300005841 Bacteria 12150
58 Ga0068863_100006409 3300005841 Bacteria 11538
59 Ga0068858_100000123 3300005842 Bacteria 80124
60 Ga0068858_100023434 3300005842 Bacteria 5750
61 Ga0068860_100000112 3300005843 Bacteria 130953
62 Ga0068862_100000012 3300005844 Bacteria 267598
63 Ga0081539_10000023 3300005985 Bacteria 356082
64 Ga0075365_10000610 3300006038 Bacteria 14051
65 Ga0075365_10060028 3300006038 Bacteria 2536
66 Ga0075364_10016497 3300006051 Bacteria 4596
67 Ga0075364_10027145 3300006051 Bacteria 3656
68 Ga0075364_10087169 3300006051 Bacteria 2069
69 Ga0075364_10117831 3300006051 Bacteria 1776
70 Ga0075364_10118356 3300006051 Bacteria 1772
71 Ga0075432_10004853 3300006058 Bacteria 4578
72 Ga0075432_10005755 3300006058 Bacteria 4216
73 Ga0075432_10099178 3300006058 Bacteria 1075
74 Ga0070712_100051862 3300006175 Bacteria 2859
75 Ga0075369_10012953 3300006186 Bacteria 3300
76 Ga0097621_100057040 3300006237 Bacteria 3192
77 Ga0075428_100007778 3300006844 Bacteria 11877
78 Ga0075431_100129219 3300006847 Bacteria 2607
79 Ga0075433_10049803 3300006852 Bacteria 3644
80 Ga0097620_100058953 3300006931 Bacteria 3867
81 Ga0075435_100023304 3300007076 Bacteria 4785
82 Ga0105251_10005785 3300009011 Bacteria 8018
83 Ga0105244_10001314 3300009036 Bacteria 20318
84 Ga0105244_10005864 3300009036 Bacteria 8063
85 Ga0105244_10013919 3300009036 Bacteria 4674
86 Ga0105244_10018175 3300009036 Bacteria 3952
87 Ga0105240_10001410 3300009093 Bacteria 41216
88 Ga0105240_10094892 3300009093 Bacteria 3638
89 Ga0105240_10345484 3300009093 Bacteria 1689
90 Ga0111539_10080539 3300009094 Bacteria 3831
91 Ga0105245_10016291 3300009098 Bacteria 6482
92 Ga0105245_10107137 3300009098 Bacteria 2594
93 Ga0105245_10260496 3300009098 Bacteria 1688
94 Ga0105247_10000007 3300009101 Bacteria 409490
95 Ga0105247_10020123 3300009101 Bacteria 4011
96 Ga0114129_10011065 3300009147 Bacteria 12854
97 Ga0114129_10082833 3300009147 Bacteria 4457
98 Ga0114129_10269814 3300009147 Bacteria 2277
99 Ga0105243_10048520 3300009148 Bacteria 3347
100 Ga0105241_10001937 3300009174 Bacteria 15658
101 Ga0105241_10028375 3300009174 Bacteria 4171
102 Ga0105242_10339933 3300009176 Bacteria 1383
103 Ga0105248_10000254 3300009177 Bacteria 62178
104 Ga0105248_10013313 3300009177 Bacteria 9054
105 Ga0105237_10000308 3300009545 Bacteria 67971
106 Ga0105237_10166143 3300009545 Bacteria 2206
107 Ga0105238_10005665 3300009551 Bacteria 12346
108 Ga0105238_10130657 3300009551 Bacteria 2489
109 Ga0105238_10321801 3300009551 Bacteria 1533
110 Ga0105249_10000001 3300009553 Bacteria 504948
111 Ga0105249_10323081 3300009553 Bacteria 1555
112 Ga0105029_102556 3300009984 Bacteria 1186
113 Ga0105239_10127634 3300010375 Bacteria 2828
114 Ga0105239_10254192 3300010375 Bacteria 1974
115 Ga0105246_10001123 3300011119 Bacteria 15556
116 Ga0105246_10001461 3300011119 Bacteria 14021
117 Ga0105246_10011546 3300011119 Bacteria 5483
118 Ga0157371_10081061 3300013102 Bacteria 2298
119 Ga0157370_10008426 3300013104 Bacteria 11117
120 Ga0171462_1004 3300013250 Bacteria 678877
121 Ga0157374_10031073 3300013296 Bacteria 4850
122 Ga0163162_10090637 3300013306 Bacteria 3139
123 Ga0163162_10523489 3300013306 Bacteria 1315
124 Ga0163163_10002073 3300014325 Bacteria 16933
125 Ga0157380_10091931 3300014326 Bacteria 2506
126 Ga0157377_10001575 3300014745 Bacteria 9918
127 Ga0157379_10175685 3300014968 Bacteria 1934
128 Ga0157379_10372486 3300014968 Bacteria 1309
129 Ga0163161_10242682 3300017792 Bacteria 1402
130 Ga0206356_11422413 3300020070 Bacteria 3439
131 Ga0207425_1003685 3300025245 Bacteria 4819
132 Ga0209646_1000014 3300025246 Bacteria 550484
133 Ga0209148_1000902 3300025254 Bacteria 20196
134 Ga0209129_1000301 3300025258 Bacteria 45425
135 Ga0209051_1045631 3300025303 Bacteria 1515
136 Ga0207697_10008491 3300025315 Bacteria 4490
137 Ga0207656_10000001 3300025321 Bacteria 1323684
138 Ga0207656_10005038 3300025321 Bacteria 4643
139 Ga0207655_1003646 3300025728 Bacteria 11371
140 Ga0207655_1003750 3300025728 Bacteria 11143
141 Ga0207655_1016308 3300025728 Bacteria 4072
142 Ga0207713_1026361 3300025735 Bacteria 2665
143 Ga0207682_10018946 3300025893 Bacteria 2693
144 Ga0207710_10000013 3300025900 Bacteria 409402
145 Ga0207688_10029131 3300025901 Bacteria 3038
146 Ga0207680_10103779 3300025903 Bacteria 1831
147 Ga0207680_10129552 3300025903 Bacteria 1661
148 Ga0207647_10033044 3300025904 Bacteria 3317
149 Ga0207645_10036080 3300025907 Bacteria 3174
150 Ga0207645_10041558 3300025907 Bacteria 2942
151 Ga0207643_10000232 3300025908 Bacteria 38984
152 Ga0207705_10011820 3300025909 Bacteria 6308
153 Ga0207705_10015369 3300025909 Bacteria 5491
154 Ga0207654_10000001 3300025911 Bacteria 1816198
155 Ga0207707_10095155 3300025912 Bacteria 2603
156 Ga0207695_10003491 3300025913 Bacteria 22101
157 Ga0207695_10004401 3300025913 Bacteria 19260
158 Ga0207671_10000001 3300025914 Bacteria 1318881
159 Ga0207671_10019773 3300025914 Bacteria 5141
160 Ga0207663_10030531 3300025916 Bacteria 3180
161 Ga0207662_10053216 3300025918 Bacteria 2411
162 Ga0207657_10008363 3300025919 Bacteria 10507
163 Ga0207649_10066230 3300025920 Bacteria 2289
164 Ga0207681_10009151 3300025923 Bacteria 6049
165 Ga0207694_10000052 3300025924 Bacteria 157700
166 Ga0207694_10148740 3300025924 Bacteria 1886
167 Ga0207650_10004300 3300025925 Bacteria 9722
168 Ga0207659_10030587 3300025926 Bacteria 3680
169 Ga0207687_10008999 3300025927 Bacteria 6527
170 Ga0207700_10004672 3300025928 Bacteria 8111
171 Ga0207644_10013662 3300025931 Bacteria 5419
172 Ga0207644_10027589 3300025931 Bacteria 3924
173 Ga0207690_10002420 3300025932 Bacteria 11289
174 Ga0207686_10247751 3300025934 Bacteria 1300
175 Ga0207691_10000351 3300025940 Bacteria 46524
176 Ga0207691_10114867 3300025940 Bacteria 2391
177 Ga0207711_10000509 3300025941 Bacteria 40017
178 Ga0207711_10043235 3300025941 Bacteria 3842
179 Ga0207711_10132717 3300025941 Bacteria 2234
180 Ga0207711_10186820 3300025941 Bacteria 1887
181 Ga0207689_10001645 3300025942 Bacteria 21174
182 Ga0207679_10005712 3300025945 Bacteria 7805
183 Ga0207667_10128997 3300025949 Bacteria 2604
184 Ga0207712_10000006 3300025961 Bacteria 573204
185 Ga0207640_10011755 3300025981 Bacteria 4965
186 Ga0207658_10000249 3300025986 Bacteria 56248
187 Ga0207658_10051660 3300025986 Bacteria 3030
188 Ga0207658_10082184 3300025986 Bacteria 2473
189 Ga0207677_10018978 3300026023 Bacteria 4141
190 Ga0207703_10001488 3300026035 Bacteria 21381
191 Ga0207703_10055241 3300026035 Bacteria 3231
192 Ga0207703_10295505 3300026035 Bacteria 1475
193 Ga0207639_10003999 3300026041 Bacteria 9957
194 Ga0207639_10078419 3300026041 Bacteria 2607
195 Ga0207639_10159112 3300026041 Bacteria 1901
196 Ga0207678_10000474 3300026067 Bacteria 36371
197 Ga0207708_10013253 3300026075 Bacteria 6155
198 Ga0207702_10006935 3300026078 Bacteria 9703
199 Ga0207702_10012603 3300026078 Bacteria 7037
200 Ga0207641_10003056 3300026088 Bacteria 15083
201 Ga0207641_10082851 3300026088 Bacteria 2788
202 Ga0207676_10004942 3300026095 Bacteria 9448
203 Ga0207674_10008539 3300026116 Bacteria 11815
204 Ga0207674_10138128 3300026116 Bacteria 2398
205 Ga0207683_10037590 3300026121 Bacteria 4216
206 Ga0207683_10044700 3300026121 Bacteria 3872
207 Ga0207698_10033840 3300026142 Bacteria 3718
208 Ga0207698_10035213 3300026142 Bacteria 3660
209 Ga0207428_10002680 3300027907 Bacteria 17744
210 Ga0207428_10011068 3300027907 Bacteria 8015
211 Ga0268266_10198610 3300028379 Bacteria 1835
212 Ga0268266_10264309 3300028379 Bacteria 1595
213 Ga0268265_10000016 3300028380 Bacteria 299380
214 Ga0268264_10000026 3300028381 Bacteria 459088
215 Ga0307511_10000634 3300030521 Bacteria 37652
216 Ga0307511_10001437 3300030521 Bacteria 25148
217 Ga0307512_10009369 3300030522 Bacteria 9438
218 Ga0307513_10007035 3300031456 Bacteria 14635
219 Ga0307408_100004023 3300031548 Bacteria 10028
220 Ga0307408_100046033 3300031548 Bacteria 3119
221 Ga0307408_100068909 3300031548 Bacteria 2606
222 Ga0307408_100116354 3300031548 Bacteria 2063
223 Ga0307408_100194299 3300031548 Bacteria 1637
224 Ga0307408_100240134 3300031548 Bacteria 1488
225 Ga0307408_100289864 3300031548 Bacteria 1366
226 Ga0307514_10005422 3300031649 Bacteria 11397
227 Ga0316576_10012344 3300031727 Bacteria 5639
228 Ga0316576_10014452 3300031727 Bacteria 5275
229 Ga0316578_10021445 3300031728 Bacteria 3586
230 Ga0316578_10083712 3300031728 Bacteria 1900
231 Ga0307405_10021445 3300031731 Bacteria 3632
232 Ga0307405_10094216 3300031731 Bacteria 1991
233 Ga0307405_10112633 3300031731 Bacteria 1846
234 Ga0307405_10161040 3300031731 Bacteria 1589
235 Ga0307413_10028203 3300031824 Bacteria 3123
236 Ga0307413_10098340 3300031824 Bacteria 1926
237 Ga0307413_10148854 3300031824 Bacteria 1629
238 Ga0307413_10196574 3300031824 Bacteria 1452
239 Ga0307413_10290291 3300031824 Bacteria 1235
240 Ga0307413_10333433 3300031824 Bacteria 1164
241 Ga0307410_10005325 3300031852 Bacteria 6793
242 Ga0307410_10018983 3300031852 Bacteria 4171
243 Ga0307410_10026634 3300031852 Bacteria 3643
244 Ga0307410_10176092 3300031852 Bacteria 1616
245 Ga0307406_10000136 3300031901 Bacteria 43889
246 Ga0307406_10000222 3300031901 Bacteria 34546
247 Ga0307406_10030755 3300031901 Bacteria 3263
248 Ga0307406_10077982 3300031901 Bacteria 2193
249 Ga0307407_10005168 3300031903 Bacteria 5634
250 Ga0307407_10016558 3300031903 Bacteria 3673
251 Ga0307407_10052360 3300031903 Bacteria 2344
252 Ga0307412_10001498 3300031911 Bacteria 12970
253 Ga0307412_10015965 3300031911 Bacteria 4462
254 Ga0307412_10057668 3300031911 Bacteria 2593
255 Ga0307412_10065676 3300031911 Bacteria 2456
256 Ga0307412_10129379 3300031911 Bacteria 1831
257 Ga0307412_10179950 3300031911 Bacteria 1589
258 Ga0307412_10191545 3300031911 Bacteria 1546
259 Ga0307412_10237948 3300031911 Bacteria 1406
260 Ga0307409_100003955 3300031995 Bacteria 8212
261 Ga0307409_100006663 3300031995 Bacteria 6820
262 Ga0307409_100042115 3300031995 Bacteria 3417
263 Ga0307409_100162562 3300031995 Bacteria 1955
264 Ga0307409_100224685 3300031995 Bacteria 1697
265 Ga0307416_100011588 3300032002 Bacteria 5890
266 Ga0307416_100131275 3300032002 Bacteria 2255
267 Ga0307416_100205366 3300032002 Bacteria 1873
268 Ga0307414_10182003 3300032004 Bacteria 1691
269 Ga0307414_10203329 3300032004 Bacteria 1613
270 Ga0307414_10203678 3300032004 Bacteria 1612
271 Ga0307415_100008200 3300032126 Bacteria 5780
272 Ga0307415_100046662 3300032126 Bacteria 2911
273 Ga0316593_10043060 3300032168 Bacteria 1507
274 Ga0316574_0009490 3300035398 Bacteria 5452
275 Ga0316574_0050619 3300035398 Bacteria 2586
276 Ga0316584_0141092 3300036712 Bacteria 1797
277 Ga0373925_0151698 3300037068 Bacteria 1820
278 Ga0395899_0004426 3300037312 Bacteria 10958
279 Ga0395899_0046187 3300037312 Bacteria 3244
280 Ga0395900_0009801 3300037418 Bacteria 9817
281 Ga0395900_0056980 3300037418 Bacteria 4022
282 Ga0395900_0063338 3300037418 Bacteria 3801
283 Ga0395900_0085759 3300037418 Bacteria 3236
284 Ga0395900_0381546 3300037418 Bacteria 1377
285 Ga0395898_0013573 3300037466 Bacteria 8384
286 Ga0395898_0024868 3300037466 Bacteria 6037
287 Ga0395898_0033510 3300037466 Bacteria 5124
288 Ga0395898_0134822 3300037466 Bacteria 2364
289 Ga0395898_0328683 3300037466 Bacteria 1458
290 Ga0395905_0024297 3300037471 Bacteria 5720
291 Ga0395905_0069267 3300037471 Bacteria 3304
292 Ga0395905_0275678 3300037471 Bacteria 1568
293 Ga0395901_0008965 3300038443 Bacteria 10128
294 Ga0395901_0029621 3300038443 Bacteria 5637
295 Ga0395901_0034596 3300038443 Bacteria 5218
296 Ga0395901_0046535 3300038443 Bacteria 4507
297 Ga0395901_0118429 3300038443 Bacteria 2782
298 Ga0395901_0305936 3300038443 Bacteria 1647
299 Ga0395901_0343834 3300038443 Bacteria 1541
300 Ga0439436_0001513 3300041404 Bacteria 6760
301 Ga0439436_0009320 3300041404 Bacteria 3009
302 Ga0439436_0019313 3300041404 Bacteria 2035
303 Ga0439438_012500 3300041405 Bacteria 2602
304 Ga0439439_0015676 3300041406 Bacteria 1852
305 Ga0439439_0022988 3300041406 Bacteria 1560
306 Ga0439466_0001958 3300041411 Bacteria 8081
307 Ga0439466_0055118 3300041411 Bacteria 1293
308 Ga0451791_0114968 3300041451 Bacteria 980
309 Ga0451797_1153456 3300041453 Bacteria 1981
310 Ga0451837_0226511 3300041494 Bacteria 2603
311 Ga0451853_2071353 3300041512 Bacteria 2500
312 Ga0451853_3819697 3300041512 Bacteria 1459
313 Ga0439433_0000371 3300041999 Bacteria 7988
314 Ga0439442_000062 3300042002 Bacteria 25596
315 Ga0439442_000404 3300042002 Bacteria 10144
316 Ga0439442_001380 3300042002 Bacteria 4808
317 Ga0439442_004729 3300042002 Bacteria 2707
318 Ga0439448_0011579 3300042005 Bacteria 2630
319 Ga0439449_0000723 3300042007 Bacteria 12649
320 Ga0439449_0004612 3300042007 Bacteria 5325
321 Ga0439449_0014819 3300042007 Bacteria 2930
322 Ga0439449_0025924 3300042007 Bacteria 2189
323 Ga0439452_004807 3300042010 Bacteria 4447
324 Ga0439457_003890 3300042014 Bacteria 3996
325 Ga0439457_005563 3300042014 Bacteria 3156
326 Ga0450920_000019 3300042122 Bacteria 18359
327 Ga0450923_019257 3300042125 Bacteria 1314
328 Ga0450905_005650 3300042142 Bacteria 1678
329 Ga0450907_000193 3300042146 Bacteria 22282
330 Ga0439458_0022318 3300042157 Bacteria 1470
331 Ga0439434_0000287 3300042435 Bacteria 14415
332 Ga0439464_0026108 3300042439 Bacteria 1619
333 Ga0450918_000625 3300042531 Bacteria 7586
334 Ga0466972_0008191 3300044658 Bacteria 5242
335 Ga0466972_0052051 3300044658 Bacteria 1974
336 Ga0466972_0063211 3300044658 Bacteria 1773
337 Ga0466965_0000011 3300044683 Bacteria 107319
338 Ga0466965_0000329 3300044683 Bacteria 15867
339 Ga0466966_0057963 3300044684 Bacteria 2448
340 Ga0466966_0142334 3300044684 Bacteria 1465
341 Ga0466961_0014211 3300044693 Bacteria 5109
342 Ga0466968_0004574 3300044735 Bacteria 5176
343 Ga0466970_0009705 3300044765 Bacteria 4870
344 Ga0466970_0071612 3300044765 Bacteria 1865
345 Ga0466970_0104781 3300044765 Bacteria 1542
346 Ga0466957_0014479 3300044842 Bacteria 4593
347 Ga0466960_0009929 3300044901 Bacteria 3939
348 Ga0466959_0001223 3300045049 Bacteria 15502
349 Ga0466958_0084007 3300045836 Bacteria 1963
350 Ga0495627_000642 3300046453 Bacteria 27306
351 Ga0495629_0270951 3300046459 Bacteria 1166
352 Ga0495653_0060228 3300046463 Bacteria 2877
353 Ga0495650_0000555 3300046471 Bacteria 53150
354 Ga0495580_0016068 3300046472 Bacteria 5626
355 Ga0495582_0044712 3300046473 Bacteria 2439
356 Ga0495582_0178898 3300046473 Bacteria 1208
357 Ga0495639_0013473 3300046475 Bacteria 3532
358 Ga0495662_0007098 3300046476 Bacteria 5560
359 Ga0495664_0003644 3300046477 Bacteria 8394
360 Ga0495642_0033770 3300046528 Bacteria 2058
361 Ga0495665_0003196 3300046531 Bacteria 8871
362 Ga0495665_0043572 3300046531 Bacteria 2386
363 Ga0495586_0004820 3300046535 Bacteria 7210
364 Ga0495586_0029503 3300046535 Bacteria 2935
365 Ga0495587_0004288 3300046536 Bacteria 9417
366 Ga0495645_0005930 3300046543 Bacteria 8441
367 Ga0495633_0049256 3300046558 Bacteria 1989
368 Ga0495667_0002366 3300046559 Bacteria 12597
369 Ga0495656_0014477 3300046615 Bacteria 2958
370 Ga0495668_0108501 3300046616 Bacteria 1518
371 Ga0495635_0226374 3300046663 Bacteria 1264
372 Ga0495588_0000879 3300046674 Bacteria 13274
373 Ga0495588_0111639 3300046674 Bacteria 1440
374 Ga0495670_0003138 3300046691 Bacteria 8141
375 Ga0495670_0122761 3300046691 Bacteria 1350
376 Ga0495600_0002402 3300046809 Bacteria 10730
377 Ga0495604_0122374 3300047317 Bacteria 1882
378 Ga0495680_0065264 3300047322 Bacteria 2788
379 Ga0495686_0109092 3300047472 Bacteria 1662
380 Ga0495593_0057938 3300047673 Bacteria 2033
381 Ga0496100_0004281 3300048903 Bacteria 7552
382 Ga0496100_0243843 3300048903 Bacteria 1327
383 Ga0496101_0003626 3300048904 Bacteria 9639
384 Ga0496101_0018777 3300048904 Bacteria 4708
385 Ga0496102_0000124 3300048905 Bacteria 110030
386 Ga0496102_0011832 3300048905 Bacteria 7531
387 Ga0496102_0033364 3300048905 Bacteria 4625
388 Ga0496102_0194672 3300048905 Bacteria 1910
389 Ga0496103_0000560 3300048906 Bacteria 29543
390 Ga0496103_0034371 3300048906 Bacteria 3100
391 Ga0496103_0034406 3300048906 Bacteria 3098
392 Ga0496103_0052109 3300048906 Bacteria 2534
393 Ga0496103_0102796 3300048906 Bacteria 1810
394 Ga0496103_0247709 3300048906 Bacteria 1146
395 Ga0496104_0005550 3300048907 Bacteria 11048
396 Ga0496104_0071163 3300048907 Bacteria 3307
397 Ga0496105_0065665 3300048908 Bacteria 2994
398 Ga0496106_0007029 3300048909 Bacteria 8313
399 Ga0496106_0127431 3300048909 Bacteria 1994
400 Ga0496107_0035550 3300048910 Bacteria 3571
401 Ga0496107_0041565 3300048910 Bacteria 3301
402 Ga0496107_0107004 3300048910 Bacteria 2054
403 Ga0496108_0068817 3300048911 Bacteria 2987
404 Ga0496108_0080023 3300048911 Bacteria 2767
405 Ga0496108_0149580 3300048911 Bacteria 2014
406 Ga0496109_0001855 3300048912 Bacteria 17503
407 Ga0496109_0140679 3300048912 Bacteria 2256
408 Ga0496110_0005637 3300048913 Bacteria 9825
409 Ga0496110_0023571 3300048913 Bacteria 5237
410 Ga0496111_0001410 3300048914 Bacteria 13660
411 Ga0496111_0059797 3300048914 Bacteria 2761
412 Ga0496112_0004659 3300048915 Bacteria 11660
413 Ga0496112_0100994 3300048915 Bacteria 2854
414 Ga0496112_0113901 3300048915 Bacteria 2675
415 Ga0496113_0094358 3300048916 Bacteria 2311
416 Ga0496113_0311917 3300048916 Bacteria 1260
417 Ga0496114_0080325 3300048917 Bacteria 2754
418 Ga0496115_0011845 3300048918 Bacteria 6550
419 Ga0496115_0045709 3300048918 Bacteria 3496
420 Ga0496116_0001159 3300048919 Bacteria 31113
421 Ga0496117_0000496 3300048920 Bacteria 64935
422 Ga0496117_0015229 3300048920 Bacteria 6574
423 Ga0496117_0039719 3300048920 Bacteria 3469
424 Ga0496118_0001104 3300048921 Bacteria 41942
425 Ga0496118_0019129 3300048921 Bacteria 6135
426 Ga0496118_0039338 3300048921 Bacteria 3775
427 Ga0496119_0002666 3300048922 Bacteria 19308
428 Ga0496119_0027851 3300048922 Bacteria 3871
429 Ga0496120_0000251 3300048923 Bacteria 90074
430 Ga0496120_0003803 3300048923 Bacteria 13301
431 Ga0496120_0007793 3300048923 Bacteria 7908
432 Ga0496121_0011170 3300048924 Bacteria 10015
433 Ga0496122_0006826 3300048925 Bacteria 12943
434 Ga0496123_0000363 3300048926 Bacteria 85560
435 Ga0496124_0009186 3300048927 Bacteria 10205
436 Ga0496125_0011795 3300048928 Bacteria 8709
437 Ga0496125_0077443 3300048928 Bacteria 2563
438 Ga0496125_0158536 3300048928 Bacteria 1541
439 Ga0496126_0004072 3300048929 Bacteria 17736
440 Ga0496126_0005977 3300048929 Bacteria 13680
441 Ga0496126_0009535 3300048929 Bacteria 10298
442 Ga0496126_0034191 3300048929 Bacteria 4776
443 Ga0496126_0036340 3300048929 Bacteria 4606
444 Ga0501325_000271 3300049541 Bacteria 2226
445 Ga0501031_0025027 3300049568 Bacteria 3893
446 Ga0501031_0027643 3300049568 Bacteria 3697
447 Ga0501031_0158903 3300049568 Bacteria 1477
448 Ga0501032_0001293 3300049569 Bacteria 20070
449 Ga0501032_0062602 3300049569 Bacteria 2493
450 Ga0501032_0257573 3300049569 Bacteria 1132
451 Ga0501033_0010022 3300049570 Bacteria 7277
452 Ga0501033_0117495 3300049570 Bacteria 1932
453 Ga0501033_0253927 3300049570 Bacteria 1245
454 Ga0501034_0000080 3300049571 Bacteria 170742
455 Ga0501034_0000527 3300049571 Bacteria 61221
456 Ga0501034_0109064 3300049571 Bacteria 2759
457 Ga0501036_0012292 3300049572 Bacteria 7088
458 Ga0501037_0002373 3300049573 Bacteria 13597
459 Ga0501037_0006609 3300049573 Bacteria 8480
460 Ga0501037_0022906 3300049573 Bacteria 4620
461 Ga0501038_0002633 3300049574 Bacteria 16783
462 Ga0501038_0013882 3300049574 Bacteria 7341
463 Ga0501038_0018417 3300049574 Bacteria 6304
464 Ga0501038_0031943 3300049574 Bacteria 4650
465 Ga0501038_0078890 3300049574 Bacteria 2777
466 Ga0501039_0013723 3300049575 Bacteria 6197
467 Ga0501039_0014163 3300049575 Bacteria 6106
468 Ga0501042_0001396 3300049578 Bacteria 14173
469 Ga0501042_0153707 3300049578 Bacteria 1659
470 Ga0501043_0074250 3300049579 Bacteria 2671
471 Ga0501043_0145172 3300049579 Bacteria 1858
472 Ga0501043_0169928 3300049579 Bacteria 1701
473 Ga0501043_0233953 3300049579 Bacteria 1418
474 Ga0501046_0008013 3300049580 Bacteria 9234
475 Ga0501046_0008849 3300049580 Bacteria 8745
476 Ga0501046_0018440 3300049580 Bacteria 5808
477 Ga0501047_0027561 3300049581 Bacteria 5473
478 Ga0501047_0030136 3300049581 Bacteria 5231
479 Ga0501047_0051462 3300049581 Bacteria 3980
480 Ga0501047_0088730 3300049581 Bacteria 2969
481 Ga0501047_0099507 3300049581 Bacteria 2787
482 Ga0501047_0124689 3300049581 Bacteria 2456
483 Ga0501048_0006285 3300049582 Bacteria 9032
484 Ga0501070_0137147 3300049586 Bacteria 2020
485 Ga0501070_0217214 3300049586 Bacteria 1568
486 Ga0501073_0000050 3300049589 Bacteria 75004
487 Ga0501074_0052514 3300049590 Bacteria 2942
488 Ga0501080_0131705 3300049742 Bacteria 2315
489 Ga0501083_0000169 3300049744 Bacteria 42763
490 Ga0501083_0021463 3300049744 Bacteria 4488
491 Ga0501035_0038173 3300049822 Bacteria 4348
492 Ga0501035_0041624 3300049822 Bacteria 4148
493 Ga0501044_0001927 3300049823 Bacteria 24016
494 Ga0501044_0011059 3300049823 Bacteria 9788
495 Ga0501044_0035771 3300049823 Bacteria 5198
496 Ga0501044_0086055 3300049823 Bacteria 3176
497 Ga0501044_0246812 3300049823 Bacteria 1728
498 Ga0501045_0019511 3300049824 Bacteria 4835
499 nmdc:mga00v17_146268_c1 3300050491 Bacteria 1517
500 nmdc:mga00v17_52075_c1 3300050491 Bacteria 2490
501 nmdc:mga00v17_80920_c1 3300050491 Bacteria 2028
502 nmdc:mga00v17_98747_c1 3300050491 Bacteria 1841
503 nmdc:mga0yw44_47999_c1 3300050492 Bacteria 2573
504 nmdc:mga05p37_123326_c1 3300050507 Bacteria 3182
505 nmdc:mga05p37_442473_c1 3300050507 Bacteria 1507
506 nmdc:mga06r32_14178_c1 3300050510 Bacteria 7229
507 nmdc:mga06r32_70588_c1 3300050510 Bacteria 3378
508 nmdc:mga0rr50_3408_c1 3300050513 Bacteria 9144
509 nmdc:mga0a205_20264_c1 3300050515 Bacteria 6272
510 Ga0495655_0007293 3300053083 Bacteria 2048
511 Ga0500651_0000276 3300053093 Bacteria 30396
512 Ga0500559_0001167 3300053136 Bacteria 15763
513 Ga0500559_0001470 3300053136 Bacteria 13319
514 Ga0500568_0000486 3300053139 Bacteria 29334
515 Ga0500573_0012318 3300053140 Bacteria 4802
516 Ga0500573_0043186 3300053140 Bacteria 2602
517 Ga0500573_0067987 3300053140 Bacteria 2035
518 Ga0500573_0077127 3300053140 Bacteria 1896
519 Ga0500577_0036313 3300053142 Bacteria 1763
520 Ga0500590_006894 3300053148 Bacteria 5568
521 Ga0500616_0097619 3300053153 Bacteria 1442
522 Ga0501082_0026260 3300060353 Bacteria 5018

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10175685 Ga0157379_101756852 269
2 3300046459 Ga0495629_0270951 Ga0495629_0270951_189_1148 283
3 3300006051 Ga0075364_10027145 Ga0075364_100271453 288
4 3300049569 Ga0501032_0257573 Ga0501032_0257573_38_1072 294
5 3300037312 Ga0395899_0046187 Ga0395899_0046187_1420_2472 296
6 3300037466 Ga0395898_0024868 Ga0395898_0024868_3454_4506 296
7 iso_pu_bacteria 8055172936 8055179897 296
8 iso_pu_bacteria 2873314349 2873318796 297
9 iso_pu_bacteria 2891395885 2891403429 297
10 iso_pu_bacteria 2891554331 2891556820 297
11 3300026035 Ga0207703_10295505 Ga0207703_102955051 298
12 3300031824 Ga0307413_10148854 Ga0307413_101488542 298
13 3300006051 Ga0075364_10118356 Ga0075364_101183562 299
14 3300048920 Ga0496117_0039719 Ga0496117_0039719_1039_2067 299
15 3300048921 Ga0496118_0039338 Ga0496118_0039338_19_1047 299
16 3300048922 Ga0496119_0002666 Ga0496119_0002666_5399_6427 299
17 3300048923 Ga0496120_0000251 Ga0496120_0000251_59021_60049 299
18 3300049574 Ga0501038_0078890 Ga0501038_0078890_296_1351 299
19 3300050491 nmdc:mga00v17_52075_c1 nmdc:mga00v17_52075_c1_543_1583 299
20 3300006051 Ga0075364_10117831 Ga0075364_101178312 300
21 3300031548 Ga0307408_100194299 Ga0307408_1001942991 300
22 3300032126 Ga0307415_100046662 Ga0307415_1000466621 300
23 3300049573 Ga0501037_0022906 Ga0501037_0022906_3338_4369 300
24 3300049579 Ga0501043_0169928 Ga0501043_0169928_120_1151 300
25 iso_pu_bacteria 2856741275 2856744054 300
26 iso_pu_bacteria 2891562705 2891568053 300
27 3300031911 Ga0307412_10065676 Ga0307412_100656762 301
28 3300032002 Ga0307416_100205366 Ga0307416_1002053662 301
29 3300053142 Ga0500577_0036313 Ga0500577_0036313_214_1188 301
30 3300048929 Ga0496126_0004072 Ga0496126_0004072_2128_3159 302
31 3300049580 Ga0501046_0008013 Ga0501046_0008013_1201_2232 302
32 3300049581 Ga0501047_0124689 Ga0501047_0124689_601_1632 302
33 3300049823 Ga0501044_0011059 Ga0501044_0011059_7158_8189 302
34 3300005353 Ga0070669_100004417 Ga0070669_1000044172 303
35 3300005367 Ga0070667_100000171 Ga0070667_1000001718 303
36 3300005548 Ga0070665_100015519 Ga0070665_1000155192 303
37 3300005617 Ga0068859_100058958 Ga0068859_1000589583 303
38 3300005618 Ga0068864_100103970 Ga0068864_1001039702 303
39 3300005841 Ga0068863_100005765 Ga0068863_1000057658 303
40 3300005843 Ga0068860_100000112 Ga0068860_100000112103 303
41 3300005844 Ga0068862_100000012 Ga0068862_10000001274 303
42 3300006931 Ga0097620_100058953 Ga0097620_1000589533 303
43 3300009101 Ga0105247_10000007 Ga0105247_1000000797 303
44 3300009177 Ga0105248_10000254 Ga0105248_1000025413 303
45 3300009553 Ga0105249_10000001 Ga0105249_10000001388 303
46 3300013306 Ga0163162_10090637 Ga0163162_100906373 303
47 3300014325 Ga0163163_10002073 Ga0163163_100020733 303
48 3300014968 Ga0157379_10372486 Ga0157379_103724861 303
49 3300025900 Ga0207710_10000013 Ga0207710_1000001397 303
50 3300025923 Ga0207681_10009151 Ga0207681_100091512 303
51 3300025941 Ga0207711_10000509 Ga0207711_100005097 303
52 3300025961 Ga0207712_10000006 Ga0207712_10000006103 303
53 3300025986 Ga0207658_10000249 Ga0207658_100002498 303
54 3300026035 Ga0207703_10055241 Ga0207703_100552411 303
55 3300026088 Ga0207641_10003056 Ga0207641_100030569 303
56 3300028380 Ga0268265_10000016 Ga0268265_1000001699 303
57 3300028381 Ga0268264_10000026 Ga0268264_10000026101 303
58 3300031824 Ga0307413_10098340 Ga0307413_100983402 303
59 3300031852 Ga0307410_10026634 Ga0307410_100266342 303
60 3300037471 Ga0395905_0024297 Ga0395905_0024297_4558_5634 303
61 3300038443 Ga0395901_0118429 Ga0395901_0118429_1383_2459 303
62 3300048904 Ga0496101_0003626 Ga0496101_0003626_5223_6272 303
63 3300048905 Ga0496102_0000124 Ga0496102_0000124_98128_99177 303
64 3300048906 Ga0496103_0000560 Ga0496103_0000560_12942_13991 303
65 3300048917 Ga0496114_0080325 Ga0496114_0080325_1353_2402 303
66 3300048919 Ga0496116_0001159 Ga0496116_0001159_6176_7225 303
67 3300048920 Ga0496117_0000496 Ga0496117_0000496_28478_29527 303
68 3300048921 Ga0496118_0001104 Ga0496118_0001104_25360_26409 303
69 3300048922 Ga0496119_0027851 Ga0496119_0027851_2102_3151 303
70 3300048923 Ga0496120_0003803 Ga0496120_0003803_7787_8836 303
71 3300048924 Ga0496121_0011170 Ga0496121_0011170_8577_9626 303
72 3300048927 Ga0496124_0009186 Ga0496124_0009186_8976_10025 303
73 3300048928 Ga0496125_0077443 Ga0496125_0077443_634_1683 303
74 3300048929 Ga0496126_0005977 Ga0496126_0005977_390_1439 303
75 3300041451 Ga0451791_0114968 Ga0451791_0114968_10_960 304
76 3300044684 Ga0466966_0142334 Ga0466966_0142334_289_1374 304
77 3300031903 Ga0307407_10016558 Ga0307407_100165582 306
78 3300048915 Ga0496112_0113901 Ga0496112_0113901_678_1727 306
79 3300049823 Ga0501044_0246812 Ga0501044_0246812_83_1126 307
80 3300005328 Ga0070676_10049956 Ga0070676_100499562 308
81 3300005333 Ga0070677_10017792 Ga0070677_100177922 308
82 3300005335 Ga0070666_10129362 Ga0070666_101293622 308
83 3300005353 Ga0070669_100035663 Ga0070669_1000356632 308
84 3300005356 Ga0070674_100101092 Ga0070674_1001010922 308
85 3300005456 Ga0070678_100019103 Ga0070678_1000191032 308
86 3300005543 Ga0070672_100053330 Ga0070672_1000533302 308
87 3300005548 Ga0070665_100285127 Ga0070665_1002851272 308
88 3300009011 Ga0105251_10005785 Ga0105251_100057852 308
89 3300009036 Ga0105244_10018175 Ga0105244_100181752 308
90 3300011119 Ga0105246_10011546 Ga0105246_100115462 308
91 3300025315 Ga0207697_10008491 Ga0207697_100084912 308
92 3300025728 Ga0207655_1016308 Ga0207655_10163082 308
93 3300025893 Ga0207682_10018946 Ga0207682_100189462 308
94 3300025903 Ga0207680_10129552 Ga0207680_101295522 308
95 3300025907 Ga0207645_10036080 Ga0207645_100360803 308
96 3300025940 Ga0207691_10000351 Ga0207691_1000035113 308
97 3300026121 Ga0207683_10044700 Ga0207683_100447002 308
98 3300028379 Ga0268266_10198610 Ga0268266_101986102 308
99 3300048907 Ga0496104_0071163 Ga0496104_0071163_1320_2369 308
100 3300048912 Ga0496109_0140679 Ga0496109_0140679_317_1366 308
101 3300048915 Ga0496112_0100994 Ga0496112_0100994_596_1645 308
102 3300005355 Ga0070671_100034188 Ga0070671_1000341882 310
103 3300037418 Ga0395900_0009801 Ga0395900_0009801_5853_6905 310
104 3300037471 Ga0395905_0069267 Ga0395905_0069267_357_1409 310
105 3300038443 Ga0395901_0034596 Ga0395901_0034596_2653_3684 310
106 3300046674 Ga0495588_0111639 Ga0495588_0111639_309_1358 310
107 3300049581 Ga0501047_0088730 Ga0501047_0088730_1816_2901 310
108 3300053139 Ga0500568_0000486 Ga0500568_0000486_27783_28832 310
109 3300053140 Ga0500573_0043186 Ga0500573_0043186_693_1703 310
110 3300006844 Ga0075428_100007778 Ga0075428_1000077782 311
111 3300006847 Ga0075431_100129219 Ga0075431_1001292192 311
112 3300009147 Ga0114129_10011065 Ga0114129_100110653 311
113 3300031456 Ga0307513_10007035 Ga0307513_1000703512 311
114 3300037466 Ga0395898_0134822 Ga0395898_0134822_56_1105 311
115 3300037471 Ga0395905_0275678 Ga0395905_0275678_480_1529 311
116 3300042125 Ga0450923_019257 Ga0450923_019257_265_1266 311
117 3300050510 nmdc:mga06r32_14178_c1 nmdc:mga06r32_14178_c1_1432_2472 311
118 3300053093 Ga0500651_0000276 Ga0500651_0000276_16330_17358 311
119 3300006186 Ga0075369_10012953 Ga0075369_100129533 312
120 3300009098 Ga0105245_10016291 Ga0105245_100162916 312
121 3300009177 Ga0105248_10013313 Ga0105248_100133134 312
122 3300025927 Ga0207687_10008999 Ga0207687_100089992 312
123 3300025941 Ga0207711_10043235 Ga0207711_100432354 312
124 3300046463 Ga0495653_0060228 Ga0495653_0060228_487_1536 312
125 3300046473 Ga0495582_0178898 Ga0495582_0178898_32_1081 312
126 3300046476 Ga0495662_0007098 Ga0495662_0007098_1409_2458 312
127 3300046477 Ga0495664_0003644 Ga0495664_0003644_537_1586 312
128 3300046531 Ga0495665_0003196 Ga0495665_0003196_5601_6650 312
129 3300046535 Ga0495586_0004820 Ga0495586_0004820_547_1596 312
130 3300046536 Ga0495587_0004288 Ga0495587_0004288_1451_2500 312
131 3300046543 Ga0495645_0005930 Ga0495645_0005930_4342_5391 312
132 3300046559 Ga0495667_0002366 Ga0495667_0002366_3009_4058 312
133 3300046663 Ga0495635_0226374 Ga0495635_0226374_118_1167 312
134 3300046809 Ga0495600_0002402 Ga0495600_0002402_8968_10017 312
135 3300047317 Ga0495604_0122374 Ga0495604_0122374_735_1784 312
136 3300047322 Ga0495680_0065264 Ga0495680_0065264_620_1669 312
137 3300048911 Ga0496108_0080023 Ga0496108_0080023_1713_2714 312
138 3300048928 Ga0496125_0158536 Ga0496125_0158536_103_1104 312
139 3300053148 Ga0500590_006894 Ga0500590_006894_1380_2408 312
140 3300005339 Ga0070660_100018825 Ga0070660_1000188255 313
141 3300005365 Ga0070688_100179838 Ga0070688_1001798381 313
142 3300005366 Ga0070659_100007511 Ga0070659_1000075116 313
143 3300005367 Ga0070667_100051906 Ga0070667_1000519062 313
144 3300005435 Ga0070714_100188262 Ga0070714_1001882622 313
145 3300005466 Ga0070685_10011134 Ga0070685_100111342 313
146 3300005539 Ga0068853_100006224 Ga0068853_1000062244 313
147 3300005577 Ga0068857_100002565 Ga0068857_1000025656 313
148 3300005578 Ga0068854_100141509 Ga0068854_1001415092 313
149 3300005616 Ga0068852_100057605 Ga0068852_1000576053 313
150 3300005834 Ga0068851_10000015 Ga0068851_10000015124 313
151 3300005842 Ga0068858_100000123 Ga0068858_10000012372 313
152 3300009093 Ga0105240_10094892 Ga0105240_100948922 313
153 3300009545 Ga0105237_10000308 Ga0105237_1000030817 313
154 3300009551 Ga0105238_10005665 Ga0105238_100056659 313
155 3300010375 Ga0105239_10127634 Ga0105239_101276342 313
156 3300010375 Ga0105239_10254192 Ga0105239_102541922 313
157 3300025254 Ga0209148_1000902 Ga0209148_10009024 313
158 3300025321 Ga0207656_10000001 Ga0207656_10000001760 313
159 3300025909 Ga0207705_10015369 Ga0207705_100153694 313
160 3300025913 Ga0207695_10003491 Ga0207695_100034914 313
161 3300025914 Ga0207671_10000001 Ga0207671_10000001759 313
162 3300025919 Ga0207657_10008363 Ga0207657_100083634 313
163 3300025924 Ga0207694_10000052 Ga0207694_1000005234 313
164 3300025932 Ga0207690_10002420 Ga0207690_100024205 313
165 3300025941 Ga0207711_10186820 Ga0207711_101868202 313
166 3300025949 Ga0207667_10128997 Ga0207667_101289972 313
167 3300025986 Ga0207658_10051660 Ga0207658_100516602 313
168 3300026035 Ga0207703_10001488 Ga0207703_100014884 313
169 3300026041 Ga0207639_10003999 Ga0207639_100039992 313
170 3300026088 Ga0207641_10082851 Ga0207641_100828512 313
171 3300026116 Ga0207674_10008539 Ga0207674_100085394 313
172 3300032004 Ga0307414_10203678 Ga0307414_102036782 313
173 3300046471 Ga0495650_0000555 Ga0495650_0000555_31051_32079 313
174 3300048916 Ga0496113_0311917 Ga0496113_0311917_70_1119 313
175 3300048923 Ga0496120_0007793 Ga0496120_0007793_4518_5546 313
176 3300038443 Ga0395901_0029621 Ga0395901_0029621_413_1489 314
177 3300048903 Ga0496100_0004281 Ga0496100_0004281_6448_7449 314
178 3300048904 Ga0496101_0018777 Ga0496101_0018777_288_1289 314
179 3300005347 Ga0070668_100136729 Ga0070668_1001367292 315
180 3300005355 Ga0070671_100000270 Ga0070671_10000027023 315
181 3300025931 Ga0207644_10027589 Ga0207644_100275892 315
182 3300025986 Ga0207658_10082184 Ga0207658_100821842 315
183 3300031548 Ga0307408_100289864 Ga0307408_1002898642 315
184 3300031731 Ga0307405_10112633 Ga0307405_101126331 315
185 3300037418 Ga0395900_0063338 Ga0395900_0063338_1601_2650 315
186 3300038443 Ga0395901_0305936 Ga0395901_0305936_523_1572 315
187 3300031824 Ga0307413_10290291 Ga0307413_102902912 316
188 3300031995 Ga0307409_100042115 Ga0307409_1000421152 316
189 3300032126 Ga0307415_100008200 Ga0307415_1000082001 316
190 3300042007 Ga0439449_0014819 Ga0439449_0014819_1151_2200 316
191 3300053083 Ga0495655_0007293 Ga0495655_0007293_12_1031 316
192 3300031911 Ga0307412_10179950 Ga0307412_101799501 317
193 3300041453 Ga0451797_1153456 Ga0451797_1153456_841_1884 317
194 3300049574 Ga0501038_0031943 Ga0501038_0031943_2391_3428 317
195 3300003762 Ga0055542_1003624 Ga0055542_10036242 318
196 3300031548 Ga0307408_100116354 Ga0307408_1001163542 318
197 3300031731 Ga0307405_10094216 Ga0307405_100942162 318
198 3300031852 Ga0307410_10176092 Ga0307410_101760922 318
199 3300031911 Ga0307412_10001498 Ga0307412_100014987 318
200 3300037418 Ga0395900_0381546 Ga0395900_0381546_75_1178 318
201 3300037466 Ga0395898_0013573 Ga0395898_0013573_2905_4008 318
202 3300037466 Ga0395898_0328683 Ga0395898_0328683_311_1414 318
203 3300044658 Ga0466972_0052051 Ga0466972_0052051_824_1927 318
204 3300044765 Ga0466970_0071612 Ga0466970_0071612_140_1243 318
205 3300049569 Ga0501032_0001293 Ga0501032_0001293_14675_15751 318
206 3300049571 Ga0501034_0000080 Ga0501034_0000080_121178_122254 318
207 3300049579 Ga0501043_0233953 Ga0501043_0233953_121_1197 318
208 3300005548 Ga0070665_100001599 Ga0070665_1000015995 319
209 3300009098 Ga0105245_10260496 Ga0105245_102604962 319
210 3300009551 Ga0105238_10321801 Ga0105238_103218012 319
211 3300025735 Ga0207713_1026361 Ga0207713_10263612 319
212 3300030521 Ga0307511_10000634 Ga0307511_1000063414 319
213 3300046473 Ga0495582_0044712 Ga0495582_0044712_211_1260 319
214 3300046475 Ga0495639_0013473 Ga0495639_0013473_1078_2127 319
215 3300046528 Ga0495642_0033770 Ga0495642_0033770_350_1399 319
216 3300046531 Ga0495665_0043572 Ga0495665_0043572_495_1544 319
217 3300046535 Ga0495586_0029503 Ga0495586_0029503_38_1087 319
218 3300046558 Ga0495633_0049256 Ga0495633_0049256_846_1895 319
219 3300046615 Ga0495656_0014477 Ga0495656_0014477_735_1784 319
220 3300046616 Ga0495668_0108501 Ga0495668_0108501_408_1457 319
221 3300046674 Ga0495588_0000879 Ga0495588_0000879_5786_6835 319
222 3300046691 Ga0495670_0003138 Ga0495670_0003138_1581_2630 319
223 3300047673 Ga0495593_0057938 Ga0495593_0057938_341_1390 319
224 3300048905 Ga0496102_0033364 Ga0496102_0033364_2707_3756 319
225 3300048918 Ga0496115_0045709 Ga0496115_0045709_1289_2338 319
226 3300048929 Ga0496126_0034191 Ga0496126_0034191_1198_2226 319
227 3300006038 Ga0075365_10060028 Ga0075365_100600282 320
228 3300044683 Ga0466965_0000011 Ga0466965_0000011_1432_2487 320
229 3300048906 Ga0496103_0247709 Ga0496103_0247709_15_1064 320
230 3300048909 Ga0496106_0007029 Ga0496106_0007029_1352_2401 320
231 3300048910 Ga0496107_0107004 Ga0496107_0107004_82_1131 320
232 3300049589 Ga0501073_0000050 Ga0501073_0000050_58932_59957 320
233 3300050491 nmdc:mga00v17_146268_c1 nmdc:mga00v17_146268_c1_189_1217 320
234 3300003578 Ga0006562J51391_1008978 Ga0006562J51391_10089782 321
235 3300006038 Ga0075365_10000610 Ga0075365_100006102 321
236 3300006051 Ga0075364_10087169 Ga0075364_100871692 321
237 3300006058 Ga0075432_10005755 Ga0075432_100057552 321
238 3300009148 Ga0105243_10048520 Ga0105243_100485202 321
239 3300011119 Ga0105246_10001461 Ga0105246_100014613 321
240 3300025303 Ga0209051_1045631 Ga0209051_10456312 321
241 3300031548 Ga0307408_100004023 Ga0307408_1000040237 321
242 3300031852 Ga0307410_10005325 Ga0307410_100053255 321
243 3300031903 Ga0307407_10005168 Ga0307407_100051682 321
244 3300031911 Ga0307412_10129379 Ga0307412_101293792 321
245 3300031995 Ga0307409_100006663 Ga0307409_1000066635 321
246 3300032004 Ga0307414_10182003 Ga0307414_101820032 321
247 3300037312 Ga0395899_0004426 Ga0395899_0004426_1409_2500 321
248 3300037466 Ga0395898_0033510 Ga0395898_0033510_2414_3505 321
249 3300038443 Ga0395901_0008965 Ga0395901_0008965_7456_8547 321
250 3300050491 nmdc:mga00v17_98747_c1 nmdc:mga00v17_98747_c1_653_1681 321
251 3300050492 nmdc:mga0yw44_47999_c1 nmdc:mga0yw44_47999_c1_574_1602 321
252 3300053136 Ga0500559_0001470 Ga0500559_0001470_12079_13107 321
253 iso_pu_bacteria 2995463766 2995471647 321
254 3300003203 JGI25406J46586_10000539 JGI25406J46586_100005392 322
255 3300005985 Ga0081539_10000023 Ga0081539_100000235 322
256 3300009984 Ga0105029_102556 Ga0105029_1025561 322
257 3300013102 Ga0157371_10081061 Ga0157371_100810612 322
258 3300013104 Ga0157370_10008426 Ga0157370_100084264 322
259 3300030522 Ga0307512_10009369 Ga0307512_100093695 322
260 3300031911 Ga0307412_10057668 Ga0307412_100576682 322
261 3300049568 Ga0501031_0158903 Ga0501031_0158903_127_1173 322
262 3300049570 Ga0501033_0117495 Ga0501033_0117495_314_1360 322
263 3300049571 Ga0501034_0109064 Ga0501034_0109064_602_1648 322
264 3300049574 Ga0501038_0013882 Ga0501038_0013882_2515_3561 322
265 3300053140 Ga0500573_0012318 Ga0500573_0012318_2921_3937 322
266 3300031731 Ga0307405_10161040 Ga0307405_101610402 323
267 3300031824 Ga0307413_10028203 Ga0307413_100282032 323
268 3300031903 Ga0307407_10052360 Ga0307407_100523602 323
269 3300031995 Ga0307409_100224685 Ga0307409_1002246852 323
270 3300041404 Ga0439436_0009320 Ga0439436_0009320_534_1583 323
271 3300041405 Ga0439438_012500 Ga0439438_012500_1502_2551 323
272 3300041406 Ga0439439_0022988 Ga0439439_0022988_182_1231 323
273 3300041411 Ga0439466_0001958 Ga0439466_0001958_2368_3417 323
274 3300041999 Ga0439433_0000371 Ga0439433_0000371_2516_3565 323
275 3300042002 Ga0439442_001380 Ga0439442_001380_69_1118 323
276 3300042007 Ga0439449_0000723 Ga0439449_0000723_7968_9017 323
277 3300042014 Ga0439457_003890 Ga0439457_003890_1349_2398 323
278 3300053136 Ga0500559_0001167 Ga0500559_0001167_45_1046 323
279 3300053153 Ga0500616_0097619 Ga0500616_0097619_207_1235 323
280 3300031911 Ga0307412_10015965 Ga0307412_100159652 324
281 3300046691 Ga0495670_0122761 Ga0495670_0122761_86_1117 324
282 iso_pu_bacteria 2585428094 2587862547 324
283 iso_pu_bacteria 2643221649 2644279287 324
284 3300009093 Ga0105240_10001410 Ga0105240_1000141018 325
285 3300009174 Ga0105241_10001937 Ga0105241_100019372 325
286 3300009545 Ga0105237_10166143 Ga0105237_101661432 325
287 3300025911 Ga0207654_10000001 Ga0207654_1000000143 325
288 3300025913 Ga0207695_10004401 Ga0207695_100044017 325
289 3300031548 Ga0307408_100046033 Ga0307408_1000460332 325
290 3300031731 Ga0307405_10021445 Ga0307405_100214452 325
291 3300031824 Ga0307413_10333433 Ga0307413_103334331 325
292 3300031911 Ga0307412_10191545 Ga0307412_101915452 325
293 iso_pu_bacteria 8047710418 8047717601 325
294 3300031727 Ga0316576_10014452 Ga0316576_100144523 326
295 3300031728 Ga0316578_10021445 Ga0316578_100214452 326
296 3300032168 Ga0316593_10043060 Ga0316593_100430601 326
297 3300035398 Ga0316574_0050619 Ga0316574_0050619_817_1896 326
298 3300049581 Ga0501047_0051462 Ga0501047_0051462_2022_3053 326
299 3300049822 Ga0501035_0041624 Ga0501035_0041624_1574_2605 326
300 iso_pu_bacteria 2558860280 2559422979 326
301 iso_pu_bacteria 2816332139 2816511182 326
302 3300006051 Ga0075364_10016497 Ga0075364_100164974 327
303 3300041494 Ga0451837_0226511 Ga0451837_0226511_428_1450 327
304 3300041512 Ga0451853_2071353 Ga0451853_2071353_1251_2273 327
305 3300050491 nmdc:mga00v17_80920_c1 nmdc:mga00v17_80920_c1_352_1380 327
306 iso_pu_bacteria 2558860280 2559427837 327
307 iso_pu_bacteria 2643221553 2643784914 327
308 iso_pu_bacteria 2643221724 2644680754 327
309 iso_pu_bacteria 2728369380 2730230828 327
310 iso_pu_bacteria 2747842429 2747954608 327
311 iso_pu_bacteria 2866612099 2866612347 327
312 iso_pu_bacteria 2891326441 2891332052 327
313 iso_pu_bacteria 2946041624 2946045399 327
314 iso_pu_bacteria 8054472261 8054475887 327
315 iso_pu_bacteria 8056060235 8056064885 327
316 3300009551 Ga0105238_10130657 Ga0105238_101306573 328
317 3300025924 Ga0207694_10148740 Ga0207694_101487402 328
318 3300026041 Ga0207639_10078419 Ga0207639_100784192 328
319 3300030521 Ga0307511_10001437 Ga0307511_1000143719 328
320 3300041512 Ga0451853_3819697 Ga0451853_3819697_215_1228 328
321 3300044735 Ga0466968_0004574 Ga0466968_0004574_3301_4332 328
322 iso_pu_bacteria 2537561592 2537897511 328
323 iso_pu_bacteria 2554235227 2555231302 328
324 iso_pu_bacteria 2643221546 2643752222 328
325 iso_pu_bacteria 2643221632 2644183517 328
326 iso_pu_bacteria 2654587600 2655032966 328
327 iso_pu_bacteria 2690315906 2691513617 328
328 iso_pu_bacteria 2775506735 2775656062 328
329 iso_pu_bacteria 2808606357 2808830872 328
330 iso_pu_bacteria 2808606360 2808852073 328
331 iso_pu_bacteria 2808606366 2808879628 328
332 iso_pu_bacteria 2808606370 2808890804 328
333 iso_pu_bacteria 2808606371 2808896082 328
334 iso_pu_bacteria 2811994871 2812321575 328
335 iso_pu_bacteria 2844849076 2844852445 328
336 iso_pu_bacteria 2857710386 2857712670 328
337 iso_pu_bacteria 2857733635 2857734578 328
338 iso_pu_bacteria 2857740372 2857743833 328
339 iso_pu_bacteria 2862993130 2862993993 328
340 iso_pu_bacteria 2904497146 2904501002 328
341 iso_pu_bacteria 2904776348 2904777985 328
342 iso_pu_bacteria 2906799679 2906802460 328
343 iso_pu_bacteria 2910809715 2910809732 328
344 iso_pu_bacteria 2919034639 2919038783 328
345 iso_pu_bacteria 2919051321 2919051593 328
346 iso_pu_bacteria 2919059106 2919062898 328
347 iso_pu_bacteria 2919391150 2919393302 328
348 iso_pu_bacteria 2919538618 2919542515 328
349 iso_pu_bacteria 2932426870 2932430449 328
350 iso_pu_bacteria 2933418574 2933422245 328
351 iso_pu_bacteria 2939598168 2939600183 328
352 iso_pu_bacteria 2939647034 2939651027 328
353 iso_pu_bacteria 2939674588 2939674609 328
354 iso_pu_bacteria 2945916053 2945919441 328
355 iso_pu_bacteria 2945920336 2945920445 328
356 iso_pu_bacteria 2945941187 2945943616 328
357 iso_pu_bacteria 2945956166 2945958204 328
358 iso_pu_bacteria 2946024296 2946025876 328
359 iso_pu_bacteria 2946033335 2946034534 328
360 iso_pu_bacteria 2946037020 2946039582 328
361 iso_pu_bacteria 2946059875 2946063166 328
362 iso_pu_bacteria 2953998280 2954000814 328
363 iso_pu_bacteria 2974302888 2974303084 328
364 iso_pu_bacteria 8004021418 8004024205 328
365 iso_pu_bacteria 8004025490 8004025964 328
366 iso_pu_bacteria 8054107350 8054111844 328
367 3300025904 Ga0207647_10033044 Ga0207647_100330442 329
368 3300026041 Ga0207639_10159112 Ga0207639_101591121 329
369 3300026142 Ga0207698_10035213 Ga0207698_100352132 329
370 3300031727 Ga0316576_10012344 Ga0316576_100123442 329
371 3300036712 Ga0316584_0141092 Ga0316584_0141092_145_1158 329
372 3300037068 Ga0373925_0151698 Ga0373925_0151698_542_1549 329
373 3300044658 Ga0466972_0063211 Ga0466972_0063211_581_1612 329
374 3300044684 Ga0466966_0057963 Ga0466966_0057963_1251_2258 329
375 3300044693 Ga0466961_0014211 Ga0466961_0014211_524_1531 329
376 3300045049 Ga0466959_0001223 Ga0466959_0001223_6740_7747 329
377 iso_pu_bacteria 2643221542 2643732779 329
378 iso_pu_bacteria 2643221630 2644171569 329
379 iso_pu_bacteria 2773857759 2774383166 329
380 iso_pu_bacteria 2808606447 2809228164 329
381 iso_pu_bacteria 2808606700 2810363607 329
382 iso_pu_bacteria 2852632344 2852634876 329
383 iso_pu_bacteria 2852663356 2852663846 329
384 iso_pu_bacteria 2905926851 2905926962 329
385 iso_pu_bacteria 2946003308 2946004184 329
386 iso_pu_bacteria 2977251589 2977253344 329
387 iso_pu_bacteria 8004182704 8004184264 329
388 3300002773 JGI25152J39213_1000330 JGI25152J39213_10003306 331
389 3300005841 Ga0068863_100006409 Ga0068863_1000064093 331
390 3300006058 Ga0075432_10004853 Ga0075432_100048532 331
391 3300009036 Ga0105244_10001314 Ga0105244_1000131412 331
392 3300009036 Ga0105244_10005864 Ga0105244_100058642 331
393 3300009147 Ga0114129_10269814 Ga0114129_102698142 331
394 3300025245 Ga0207425_1003685 Ga0207425_10036854 331
395 3300025258 Ga0209129_1000301 Ga0209129_10003016 331
396 3300025728 Ga0207655_1003646 Ga0207655_10036462 331
397 3300025728 Ga0207655_1003750 Ga0207655_10037503 331
398 3300025909 Ga0207705_10011820 Ga0207705_100118202 331
399 3300027907 Ga0207428_10002680 Ga0207428_1000268012 331
400 3300031548 Ga0307408_100068909 Ga0307408_1000689092 331
401 3300031548 Ga0307408_100240134 Ga0307408_1002401342 331
402 3300031649 Ga0307514_10005422 Ga0307514_1000542212 331
403 3300031728 Ga0316578_10083712 Ga0316578_100837122 331
404 3300031824 Ga0307413_10196574 Ga0307413_101965742 331
405 3300031852 Ga0307410_10018983 Ga0307410_100189832 331
406 3300031901 Ga0307406_10077982 Ga0307406_100779822 331
407 3300031911 Ga0307412_10237948 Ga0307412_102379482 331
408 3300031995 Ga0307409_100003955 Ga0307409_1000039552 331
409 3300031995 Ga0307409_100162562 Ga0307409_1001625622 331
410 3300032002 Ga0307416_100011588 Ga0307416_1000115883 331
411 3300032002 Ga0307416_100131275 Ga0307416_1001312752 331
412 3300035398 Ga0316574_0009490 Ga0316574_0009490_1422_2501 331
413 3300037418 Ga0395900_0056980 Ga0395900_0056980_2419_3468 331
414 3300037418 Ga0395900_0085759 Ga0395900_0085759_216_1253 331
415 3300038443 Ga0395901_0046535 Ga0395901_0046535_3224_4273 331
416 3300038443 Ga0395901_0343834 Ga0395901_0343834_278_1315 331
417 3300041404 Ga0439436_0001513 Ga0439436_0001513_1857_2918 331
418 3300041404 Ga0439436_0019313 Ga0439436_0019313_778_1824 331
419 3300041406 Ga0439439_0015676 Ga0439439_0015676_681_1742 331
420 3300041411 Ga0439466_0055118 Ga0439466_0055118_33_1082 331
421 3300042002 Ga0439442_000062 Ga0439442_000062_16831_17877 331
422 3300042002 Ga0439442_000404 Ga0439442_000404_8701_9750 331
423 3300042002 Ga0439442_004729 Ga0439442_004729_140_1219 331
424 3300042007 Ga0439449_0004612 Ga0439449_0004612_4003_5052 331
425 3300042007 Ga0439449_0025924 Ga0439449_0025924_63_1124 331
426 3300042010 Ga0439452_004807 Ga0439452_004807_469_1530 331
427 3300042014 Ga0439457_005563 Ga0439457_005563_1934_2995 331
428 3300042122 Ga0450920_000019 Ga0450920_000019_1609_2655 331
429 3300042146 Ga0450907_000193 Ga0450907_000193_15564_16610 331
430 3300042435 Ga0439434_0000287 Ga0439434_0000287_6113_7159 331
431 3300042531 Ga0450918_000625 Ga0450918_000625_922_1968 331
432 3300044658 Ga0466972_0008191 Ga0466972_0008191_1852_2856 331
433 3300044683 Ga0466965_0000329 Ga0466965_0000329_13855_14859 331
434 3300044765 Ga0466970_0009705 Ga0466970_0009705_2032_3036 331
435 3300044765 Ga0466970_0104781 Ga0466970_0104781_165_1187 331
436 3300044842 Ga0466957_0014479 Ga0466957_0014479_3481_4485 331
437 3300044901 Ga0466960_0009929 Ga0466960_0009929_2801_3805 331
438 3300045836 Ga0466958_0084007 Ga0466958_0084007_858_1895 331
439 3300046472 Ga0495580_0016068 Ga0495580_0016068_3932_5029 331
440 3300047472 Ga0495686_0109092 Ga0495686_0109092_553_1581 331
441 3300048903 Ga0496100_0243843 Ga0496100_0243843_122_1219 331
442 3300048905 Ga0496102_0011832 Ga0496102_0011832_1989_3086 331
443 3300048905 Ga0496102_0194672 Ga0496102_0194672_528_1577 331
444 3300048906 Ga0496103_0034406 Ga0496103_0034406_841_1890 331
445 3300048906 Ga0496103_0102796 Ga0496103_0102796_568_1665 331
446 3300048909 Ga0496106_0127431 Ga0496106_0127431_117_1166 331
447 3300048915 Ga0496112_0004659 Ga0496112_0004659_3093_4190 331
448 3300048925 Ga0496122_0006826 Ga0496122_0006826_8782_9813 331
449 3300048926 Ga0496123_0000363 Ga0496123_0000363_84129_85160 331
450 3300049541 Ga0501325_000271 Ga0501325_000271_970_2019 331
451 3300049568 Ga0501031_0025027 Ga0501031_0025027_542_1585 331
452 3300049568 Ga0501031_0027643 Ga0501031_0027643_2512_3543 331
453 3300049569 Ga0501032_0062602 Ga0501032_0062602_413_1441 331
454 3300049570 Ga0501033_0010022 Ga0501033_0010022_1478_2509 331
455 3300049570 Ga0501033_0253927 Ga0501033_0253927_98_1171 331
456 3300049571 Ga0501034_0000527 Ga0501034_0000527_53932_54951 331
457 3300049572 Ga0501036_0012292 Ga0501036_0012292_1464_2495 331
458 3300049573 Ga0501037_0002373 Ga0501037_0002373_173_1216 331
459 3300049573 Ga0501037_0006609 Ga0501037_0006609_2320_3411 331
460 3300049574 Ga0501038_0018417 Ga0501038_0018417_4477_5508 331
461 3300049575 Ga0501039_0013723 Ga0501039_0013723_4846_5889 331
462 3300049575 Ga0501039_0014163 Ga0501039_0014163_3782_4813 331
463 3300049578 Ga0501042_0001396 Ga0501042_0001396_2830_3903 331
464 3300049578 Ga0501042_0153707 Ga0501042_0153707_401_1432 331
465 3300049579 Ga0501043_0074250 Ga0501043_0074250_122_1150 331
466 3300049579 Ga0501043_0145172 Ga0501043_0145172_131_1180 331
467 3300049580 Ga0501046_0008849 Ga0501046_0008849_3736_4767 331
468 3300049580 Ga0501046_0018440 Ga0501046_0018440_962_2005 331
469 3300049581 Ga0501047_0027561 Ga0501047_0027561_1448_2479 331
470 3300049581 Ga0501047_0030136 Ga0501047_0030136_2155_3183 331
471 3300049581 Ga0501047_0099507 Ga0501047_0099507_197_1270 331
472 3300049582 Ga0501048_0006285 Ga0501048_0006285_2641_3672 331
473 3300049586 Ga0501070_0137147 Ga0501070_0137147_422_1465 331
474 3300049586 Ga0501070_0217214 Ga0501070_0217214_508_1539 331
475 3300049590 Ga0501074_0052514 Ga0501074_0052514_794_1825 331
476 3300049742 Ga0501080_0131705 Ga0501080_0131705_1115_2146 331
477 3300049744 Ga0501083_0000169 Ga0501083_0000169_10734_11807 331
478 3300049744 Ga0501083_0021463 Ga0501083_0021463_392_1465 331
479 3300049822 Ga0501035_0038173 Ga0501035_0038173_2458_3489 331
480 3300049823 Ga0501044_0001927 Ga0501044_0001927_2079_3107 331
481 3300049823 Ga0501044_0035771 Ga0501044_0035771_1055_2086 331
482 3300049823 Ga0501044_0086055 Ga0501044_0086055_1704_2777 331
483 3300049824 Ga0501045_0019511 Ga0501045_0019511_1464_2507 331
484 3300050507 nmdc:mga05p37_123326_c1 nmdc:mga05p37_123326_c1_1062_2111 331
485 3300053140 Ga0500573_0067987 Ga0500573_0067987_463_1491 331
486 3300053140 Ga0500573_0077127 Ga0500573_0077127_79_1110 331
487 3300060353 Ga0501082_0026260 Ga0501082_0026260_389_1432 331
488 3300003578 Ga0006562J51391_1016731 Ga0006562J51391_101673118 332
489 3300049574 Ga0501038_0002633 Ga0501038_0002633_13480_14520 332
490 3300001976 JGI24752J21851_1001850 JGI24752J21851_10018501 333
491 3300002738 JGI25154J39366_1002102 JGI25154J39366_10021023 333
492 3300005330 Ga0070690_100185041 Ga0070690_1001850411 333
493 3300005334 Ga0068869_100031519 Ga0068869_1000315192 333
494 3300005335 Ga0070666_10057526 Ga0070666_100575262 333
495 3300005336 Ga0070680_100008025 Ga0070680_1000080256 333
496 3300005339 Ga0070660_100020378 Ga0070660_1000203782 333
497 3300005341 Ga0070691_10008519 Ga0070691_100085193 333
498 3300005345 Ga0070692_10043748 Ga0070692_100437482 333
499 3300005354 Ga0070675_100140882 Ga0070675_1001408822 333
500 3300005436 Ga0070713_100024840 Ga0070713_1000248403 333
501 3300005437 Ga0070710_10143002 Ga0070710_101430022 333
502 3300005438 Ga0070701_10044545 Ga0070701_100445452 333
503 3300005456 Ga0070678_100013147 Ga0070678_1000131473 333
504 3300005458 Ga0070681_10134479 Ga0070681_101344792 333
505 3300005543 Ga0070672_100139247 Ga0070672_1001392472 333
506 3300005544 Ga0070686_100118879 Ga0070686_1001188792 333
507 3300005547 Ga0070693_100000670 Ga0070693_1000006702 333
508 3300005548 Ga0070665_100012514 Ga0070665_1000125143 333
509 3300005614 Ga0068856_100002376 Ga0068856_10000237613 333
510 3300005616 Ga0068852_100002668 Ga0068852_1000026684 333
511 3300005840 Ga0068870_10000042 Ga0068870_1000004231 333
512 3300005841 Ga0068863_100002067 Ga0068863_1000020675 333
513 3300005842 Ga0068858_100023434 Ga0068858_1000234342 333
514 3300006058 Ga0075432_10099178 Ga0075432_100991781 333
515 3300006175 Ga0070712_100051862 Ga0070712_1000518622 333
516 3300006237 Ga0097621_100057040 Ga0097621_1000570402 333
517 3300006852 Ga0075433_10049803 Ga0075433_100498033 333
518 3300007076 Ga0075435_100023304 Ga0075435_1000233042 333
519 3300009036 Ga0105244_10013919 Ga0105244_100139192 333
520 3300009093 Ga0105240_10345484 Ga0105240_103454842 333
521 3300009094 Ga0111539_10080539 Ga0111539_100805393 333
522 3300009098 Ga0105245_10107137 Ga0105245_101071372 333
523 3300009101 Ga0105247_10020123 Ga0105247_100201233 333
524 3300009147 Ga0114129_10082833 Ga0114129_100828333 333
525 3300009174 Ga0105241_10028375 Ga0105241_100283752 333
526 3300009176 Ga0105242_10339933 Ga0105242_103399332 333
527 3300009553 Ga0105249_10323081 Ga0105249_103230812 333
528 3300011119 Ga0105246_10001123 Ga0105246_100011232 333
529 3300013250 Ga0171462_1004 Ga0171462_1004546 333
530 3300013296 Ga0157374_10031073 Ga0157374_100310732 333
531 3300013306 Ga0163162_10523489 Ga0163162_105234891 333
532 3300014326 Ga0157380_10091931 Ga0157380_100919312 333
533 3300014745 Ga0157377_10001575 Ga0157377_100015752 333
534 3300017792 Ga0163161_10242682 Ga0163161_102426822 333
535 3300020070 Ga0206356_11422413 Ga0206356_114224133 333
536 3300025246 Ga0209646_1000014 Ga0209646_1000014302 333
537 3300025321 Ga0207656_10005038 Ga0207656_100050382 333
538 3300025901 Ga0207688_10029131 Ga0207688_100291313 333
539 3300025903 Ga0207680_10103779 Ga0207680_101037792 333
540 3300025907 Ga0207645_10041558 Ga0207645_100415582 333
541 3300025908 Ga0207643_10000232 Ga0207643_1000023231 333
542 3300025912 Ga0207707_10095155 Ga0207707_100951552 333
543 3300025914 Ga0207671_10019773 Ga0207671_100197735 333
544 3300025916 Ga0207663_10030531 Ga0207663_100305313 333
545 3300025918 Ga0207662_10053216 Ga0207662_100532162 333
546 3300025920 Ga0207649_10066230 Ga0207649_100662302 333
547 3300025925 Ga0207650_10004300 Ga0207650_100043006 333
548 3300025926 Ga0207659_10030587 Ga0207659_100305873 333
549 3300025928 Ga0207700_10004672 Ga0207700_100046722 333
550 3300025931 Ga0207644_10013662 Ga0207644_100136623 333
551 3300025934 Ga0207686_10247751 Ga0207686_102477512 333
552 3300025940 Ga0207691_10114867 Ga0207691_101148673 333
553 3300025941 Ga0207711_10132717 Ga0207711_101327172 333
554 3300025942 Ga0207689_10001645 Ga0207689_1000164513 333
555 3300025945 Ga0207679_10005712 Ga0207679_100057124 333
556 3300025981 Ga0207640_10011755 Ga0207640_100117553 333
557 3300026023 Ga0207677_10018978 Ga0207677_100189782 333
558 3300026067 Ga0207678_10000474 Ga0207678_1000047431 333
559 3300026075 Ga0207708_10013253 Ga0207708_100132533 333
560 3300026078 Ga0207702_10006935 Ga0207702_100069356 333
561 3300026078 Ga0207702_10012603 Ga0207702_100126032 333
562 3300026095 Ga0207676_10004942 Ga0207676_100049426 333
563 3300026116 Ga0207674_10138128 Ga0207674_101381281 333
564 3300026121 Ga0207683_10037590 Ga0207683_100375903 333
565 3300026142 Ga0207698_10033840 Ga0207698_100338402 333
566 3300027907 Ga0207428_10011068 Ga0207428_100110683 333
567 3300028379 Ga0268266_10264309 Ga0268266_102643092 333
568 3300031901 Ga0307406_10000136 Ga0307406_100001362 333
569 3300031901 Ga0307406_10000222 Ga0307406_1000022224 333
570 3300031901 Ga0307406_10030755 Ga0307406_100307552 333
571 3300032004 Ga0307414_10203329 Ga0307414_102033291 333
572 3300042005 Ga0439448_0011579 Ga0439448_0011579_1394_2395 333
573 3300042142 Ga0450905_005650 Ga0450905_005650_457_1458 333
574 3300042157 Ga0439458_0022318 Ga0439458_0022318_405_1406 333
575 3300042439 Ga0439464_0026108 Ga0439464_0026108_124_1125 333
576 3300046453 Ga0495627_000642 Ga0495627_000642_20974_22002 333
577 3300048906 Ga0496103_0034371 Ga0496103_0034371_2065_3066 333
578 3300048906 Ga0496103_0052109 Ga0496103_0052109_1004_2038 333
579 3300048907 Ga0496104_0005550 Ga0496104_0005550_1931_2932 333
580 3300048908 Ga0496105_0065665 Ga0496105_0065665_260_1294 333
581 3300048910 Ga0496107_0035550 Ga0496107_0035550_799_1800 333
582 3300048910 Ga0496107_0041565 Ga0496107_0041565_516_1550 333
583 3300048911 Ga0496108_0068817 Ga0496108_0068817_1259_2293 333
584 3300048911 Ga0496108_0149580 Ga0496108_0149580_187_1188 333
585 3300048912 Ga0496109_0001855 Ga0496109_0001855_9937_10938 333
586 3300048913 Ga0496110_0005637 Ga0496110_0005637_8210_9211 333
587 3300048913 Ga0496110_0023571 Ga0496110_0023571_2941_3975 333
588 3300048914 Ga0496111_0001410 Ga0496111_0001410_10357_11358 333
589 3300048914 Ga0496111_0059797 Ga0496111_0059797_941_1975 333
590 3300048916 Ga0496113_0094358 Ga0496113_0094358_1135_2136 333
591 3300048918 Ga0496115_0011845 Ga0496115_0011845_1233_2267 333
592 3300048920 Ga0496117_0015229 Ga0496117_0015229_3816_4844 333
593 3300048921 Ga0496118_0019129 Ga0496118_0019129_307_1335 333
594 3300048928 Ga0496125_0011795 Ga0496125_0011795_2048_3076 333
595 3300048929 Ga0496126_0009535 Ga0496126_0009535_4244_5272 333
596 3300048929 Ga0496126_0036340 Ga0496126_0036340_1636_2664 333
597 3300050507 nmdc:mga05p37_442473_c1 nmdc:mga05p37_442473_c1_199_1200 333
598 3300050510 nmdc:mga06r32_70588_c1 nmdc:mga06r32_70588_c1_1662_2663 333
599 3300050513 nmdc:mga0rr50_3408_c1 nmdc:mga0rr50_3408_c1_25_1026 333
600 3300050515 nmdc:mga0a205_20264_c1 nmdc:mga0a205_20264_c1_2539_3540 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

4

321

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.957 1 325
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.9565 1 328
7d5i-assembly1.cif.gz_B structure of mycobacterium smegmatis bd complex in the apo-form. 0.9514 1 333
7d5i-assembly1.cif.gz_B structure of mycobacterium smegmatis bd complex in the apo-form. 0.9486 1 333
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.9401 1 325
ID Description Score Start End Superfamily
af_B6U466_3_118_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6665 166 264 1.20.120.290
2vpwG00 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6518 16 267 1.20.1630.10
af_Q9SSA5_113_219_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6178 170 269 1.20.120.290
af_Q9XI73_53_190_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6162 150 268 1.20.120.290
af_I1N5T2_121_227_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6095 170 269 1.20.120.290
ID Description Score Start End GO Terms
AF-A0A1I4I5E2-F1-model_v4 Cytochrome bd-I ubiquinol oxidase subunit 2 apoprotein 0.9778 1 332 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A3D1JH25-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9773 1 326 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A4Q2M8U1-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) 0.9759 1 329 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069
AF-A0A2N3S2X2-F1-model_v4 deleted 0.9756 1 328
AF-A0A840IDQ1-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) 0.9752 1 331 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0046872
GO:0070069

Feature Viewer

pLDDT pTM Quality
92.22 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map