F468010
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 600 | 369 | 522 | 335 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0016068|Ga0495580_0016068_3932_5029 |
| Length | 365 |
| Sequence | MELLPTVWFVAIAVLWTGYLFLEGFDLGVGMLMKLFARNNTDRRVLLNTVGPVWDGNEVWLLTAAGATFAAFPLWYASLFSALYLPLLIVLVALIFRAVAFEYRGKVDSARWRTVWDWAIALGSFTAAFGIGAALALTTTGLPIDSNGDRQGGPFAWFSGYAVLGGFAVVAFALVHALAFLALKTDGEVRHRARRWFVRLAPPALLPLLAWMVAVQLLSGKPLTWILVILGVLAAAGAWVLARKGAEGKAFGALGAFLVCATASIFGAAFPVVIPSTLNPAFNLTISNASSSAYTLGLMSIVAAVGLPLVIAYQAWTYWVFRRRVSAAHIPAAHGFLPAIAAKVLVGQSAPGGPAAKRAPRDAGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 2 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 3 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 4 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 5 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 6 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 7 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 8 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 9 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 10 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 11 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 12 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 13 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 14 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 15 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 16 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 17 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 18 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 19 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 20 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 21 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 22 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 23 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 24 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 25 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 26 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 27 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 28 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 29 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 30 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 31 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 32 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 33 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 34 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 35 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 36 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 37 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 38 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 39 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 40 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 41 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 42 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 43 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 44 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 45 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 46 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 47 | 2919051321 | Sinomonas atrocyanea 1003 | Isolate | Rhizosphere |
| 48 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 49 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 50 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 51 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 52 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 53 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 54 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 55 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 56 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 57 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 58 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 59 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 60 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 61 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 62 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 63 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 64 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 65 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 66 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 67 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 68 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 69 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 70 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 71 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 72 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 73 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 75 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 76 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 78 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 80 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 82 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 99 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 100 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 101 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 103 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 106 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 107 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 108 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 109 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 110 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 111 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 112 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 113 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 114 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 118 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 119 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 120 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 121 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 122 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 123 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 125 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 126 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 127 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 129 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 134 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 135 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 144 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 149 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 157 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 159 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 215 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 216 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 217 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 218 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 219 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 220 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 221 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 222 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 223 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 224 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 225 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 226 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 229 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 230 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 231 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 233 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 239 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 240 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 241 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 242 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 243 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 244 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 247 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 248 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 249 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 250 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 251 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 252 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 253 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 254 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 255 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 256 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 257 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 258 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 261 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 262 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 263 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 267 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 268 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 269 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 272 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 315 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 316 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 317 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 318 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 319 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 320 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 321 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 329 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 333 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 334 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 348 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 349 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 352 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 353 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 355 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 356 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 357 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 358 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 359 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 360 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 361 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 362 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 363 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 364 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 365 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 366 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 367 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 368 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 369 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.17 |
| Metatranscriptomes | 0.83 |
| Isolates | 13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5 |
| Nodule | 0 |
| Rhizoplane | 6.83 |
| Rhizosphere | 75.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1001850 | 3300001976 | Bacteria | 2825 |
| 2 | JGI25154J39366_1002102 | 3300002738 | Bacteria | 5598 |
| 3 | JGI25152J39213_1000330 | 3300002773 | Bacteria | 29988 |
| 4 | JGI25406J46586_10000539 | 3300003203 | Bacteria | 17725 |
| 5 | Ga0006562J51391_1008978 | 3300003578 | Bacteria | 4644 |
| 6 | Ga0006562J51391_1016731 | 3300003578 | Bacteria | 16779 |
| 7 | Ga0055542_1003624 | 3300003762 | Bacteria | 4080 |
| 8 | Ga0070676_10049956 | 3300005328 | Bacteria | 2450 |
| 9 | Ga0070690_100185041 | 3300005330 | Bacteria | 1441 |
| 10 | Ga0070677_10017792 | 3300005333 | Bacteria | 2550 |
| 11 | Ga0068869_100031519 | 3300005334 | Bacteria | 3729 |
| 12 | Ga0070666_10057526 | 3300005335 | Bacteria | 2627 |
| 13 | Ga0070666_10129362 | 3300005335 | Bacteria | 1754 |
| 14 | Ga0070680_100008025 | 3300005336 | Bacteria | 8063 |
| 15 | Ga0070660_100018825 | 3300005339 | Bacteria | 5053 |
| 16 | Ga0070660_100020378 | 3300005339 | Bacteria | 4873 |
| 17 | Ga0070691_10008519 | 3300005341 | Bacteria | 4695 |
| 18 | Ga0070692_10043748 | 3300005345 | Bacteria | 2304 |
| 19 | Ga0070668_100136729 | 3300005347 | Bacteria | 1972 |
| 20 | Ga0070669_100004417 | 3300005353 | Bacteria | 10144 |
| 21 | Ga0070669_100035663 | 3300005353 | Bacteria | 3604 |
| 22 | Ga0070675_100140882 | 3300005354 | Bacteria | 2061 |
| 23 | Ga0070671_100000270 | 3300005355 | Bacteria | 35025 |
| 24 | Ga0070671_100034188 | 3300005355 | Bacteria | 4208 |
| 25 | Ga0070674_100101092 | 3300005356 | Bacteria | 2101 |
| 26 | Ga0070688_100179838 | 3300005365 | Bacteria | 1466 |
| 27 | Ga0070659_100007511 | 3300005366 | Bacteria | 7919 |
| 28 | Ga0070667_100000171 | 3300005367 | Bacteria | 80660 |
| 29 | Ga0070667_100051906 | 3300005367 | Bacteria | 3458 |
| 30 | Ga0070714_100188262 | 3300005435 | Bacteria | 1882 |
| 31 | Ga0070713_100024840 | 3300005436 | Bacteria | 4676 |
| 32 | Ga0070710_10143002 | 3300005437 | Bacteria | 1469 |
| 33 | Ga0070701_10044545 | 3300005438 | Bacteria | 2273 |
| 34 | Ga0070678_100013147 | 3300005456 | Bacteria | 5177 |
| 35 | Ga0070678_100019103 | 3300005456 | Bacteria | 4458 |
| 36 | Ga0070681_10134479 | 3300005458 | Bacteria | 2403 |
| 37 | Ga0070685_10011134 | 3300005466 | Bacteria | 4700 |
| 38 | Ga0068853_100006224 | 3300005539 | Bacteria | 9455 |
| 39 | Ga0070672_100053330 | 3300005543 | Bacteria | 3161 |
| 40 | Ga0070672_100139247 | 3300005543 | Bacteria | 2000 |
| 41 | Ga0070686_100118879 | 3300005544 | Bacteria | 1812 |
| 42 | Ga0070693_100000670 | 3300005547 | Bacteria | 15154 |
| 43 | Ga0070665_100001599 | 3300005548 | Bacteria | 26065 |
| 44 | Ga0070665_100012514 | 3300005548 | Bacteria | 8549 |
| 45 | Ga0070665_100015519 | 3300005548 | Bacteria | 7653 |
| 46 | Ga0070665_100285127 | 3300005548 | Bacteria | 1653 |
| 47 | Ga0068857_100002565 | 3300005577 | Bacteria | 14875 |
| 48 | Ga0068854_100141509 | 3300005578 | Bacteria | 1846 |
| 49 | Ga0068856_100002376 | 3300005614 | Bacteria | 19360 |
| 50 | Ga0068852_100002668 | 3300005616 | Bacteria | 12333 |
| 51 | Ga0068852_100057605 | 3300005616 | Bacteria | 3362 |
| 52 | Ga0068859_100058958 | 3300005617 | Bacteria | 3867 |
| 53 | Ga0068864_100103970 | 3300005618 | Bacteria | 2522 |
| 54 | Ga0068851_10000015 | 3300005834 | Bacteria | 145191 |
| 55 | Ga0068870_10000042 | 3300005840 | Bacteria | 38938 |
| 56 | Ga0068863_100002067 | 3300005841 | Bacteria | 19908 |
| 57 | Ga0068863_100005765 | 3300005841 | Bacteria | 12150 |
| 58 | Ga0068863_100006409 | 3300005841 | Bacteria | 11538 |
| 59 | Ga0068858_100000123 | 3300005842 | Bacteria | 80124 |
| 60 | Ga0068858_100023434 | 3300005842 | Bacteria | 5750 |
| 61 | Ga0068860_100000112 | 3300005843 | Bacteria | 130953 |
| 62 | Ga0068862_100000012 | 3300005844 | Bacteria | 267598 |
| 63 | Ga0081539_10000023 | 3300005985 | Bacteria | 356082 |
| 64 | Ga0075365_10000610 | 3300006038 | Bacteria | 14051 |
| 65 | Ga0075365_10060028 | 3300006038 | Bacteria | 2536 |
| 66 | Ga0075364_10016497 | 3300006051 | Bacteria | 4596 |
| 67 | Ga0075364_10027145 | 3300006051 | Bacteria | 3656 |
| 68 | Ga0075364_10087169 | 3300006051 | Bacteria | 2069 |
| 69 | Ga0075364_10117831 | 3300006051 | Bacteria | 1776 |
| 70 | Ga0075364_10118356 | 3300006051 | Bacteria | 1772 |
| 71 | Ga0075432_10004853 | 3300006058 | Bacteria | 4578 |
| 72 | Ga0075432_10005755 | 3300006058 | Bacteria | 4216 |
| 73 | Ga0075432_10099178 | 3300006058 | Bacteria | 1075 |
| 74 | Ga0070712_100051862 | 3300006175 | Bacteria | 2859 |
| 75 | Ga0075369_10012953 | 3300006186 | Bacteria | 3300 |
| 76 | Ga0097621_100057040 | 3300006237 | Bacteria | 3192 |
| 77 | Ga0075428_100007778 | 3300006844 | Bacteria | 11877 |
| 78 | Ga0075431_100129219 | 3300006847 | Bacteria | 2607 |
| 79 | Ga0075433_10049803 | 3300006852 | Bacteria | 3644 |
| 80 | Ga0097620_100058953 | 3300006931 | Bacteria | 3867 |
| 81 | Ga0075435_100023304 | 3300007076 | Bacteria | 4785 |
| 82 | Ga0105251_10005785 | 3300009011 | Bacteria | 8018 |
| 83 | Ga0105244_10001314 | 3300009036 | Bacteria | 20318 |
| 84 | Ga0105244_10005864 | 3300009036 | Bacteria | 8063 |
| 85 | Ga0105244_10013919 | 3300009036 | Bacteria | 4674 |
| 86 | Ga0105244_10018175 | 3300009036 | Bacteria | 3952 |
| 87 | Ga0105240_10001410 | 3300009093 | Bacteria | 41216 |
| 88 | Ga0105240_10094892 | 3300009093 | Bacteria | 3638 |
| 89 | Ga0105240_10345484 | 3300009093 | Bacteria | 1689 |
| 90 | Ga0111539_10080539 | 3300009094 | Bacteria | 3831 |
| 91 | Ga0105245_10016291 | 3300009098 | Bacteria | 6482 |
| 92 | Ga0105245_10107137 | 3300009098 | Bacteria | 2594 |
| 93 | Ga0105245_10260496 | 3300009098 | Bacteria | 1688 |
| 94 | Ga0105247_10000007 | 3300009101 | Bacteria | 409490 |
| 95 | Ga0105247_10020123 | 3300009101 | Bacteria | 4011 |
| 96 | Ga0114129_10011065 | 3300009147 | Bacteria | 12854 |
| 97 | Ga0114129_10082833 | 3300009147 | Bacteria | 4457 |
| 98 | Ga0114129_10269814 | 3300009147 | Bacteria | 2277 |
| 99 | Ga0105243_10048520 | 3300009148 | Bacteria | 3347 |
| 100 | Ga0105241_10001937 | 3300009174 | Bacteria | 15658 |
| 101 | Ga0105241_10028375 | 3300009174 | Bacteria | 4171 |
| 102 | Ga0105242_10339933 | 3300009176 | Bacteria | 1383 |
| 103 | Ga0105248_10000254 | 3300009177 | Bacteria | 62178 |
| 104 | Ga0105248_10013313 | 3300009177 | Bacteria | 9054 |
| 105 | Ga0105237_10000308 | 3300009545 | Bacteria | 67971 |
| 106 | Ga0105237_10166143 | 3300009545 | Bacteria | 2206 |
| 107 | Ga0105238_10005665 | 3300009551 | Bacteria | 12346 |
| 108 | Ga0105238_10130657 | 3300009551 | Bacteria | 2489 |
| 109 | Ga0105238_10321801 | 3300009551 | Bacteria | 1533 |
| 110 | Ga0105249_10000001 | 3300009553 | Bacteria | 504948 |
| 111 | Ga0105249_10323081 | 3300009553 | Bacteria | 1555 |
| 112 | Ga0105029_102556 | 3300009984 | Bacteria | 1186 |
| 113 | Ga0105239_10127634 | 3300010375 | Bacteria | 2828 |
| 114 | Ga0105239_10254192 | 3300010375 | Bacteria | 1974 |
| 115 | Ga0105246_10001123 | 3300011119 | Bacteria | 15556 |
| 116 | Ga0105246_10001461 | 3300011119 | Bacteria | 14021 |
| 117 | Ga0105246_10011546 | 3300011119 | Bacteria | 5483 |
| 118 | Ga0157371_10081061 | 3300013102 | Bacteria | 2298 |
| 119 | Ga0157370_10008426 | 3300013104 | Bacteria | 11117 |
| 120 | Ga0171462_1004 | 3300013250 | Bacteria | 678877 |
| 121 | Ga0157374_10031073 | 3300013296 | Bacteria | 4850 |
| 122 | Ga0163162_10090637 | 3300013306 | Bacteria | 3139 |
| 123 | Ga0163162_10523489 | 3300013306 | Bacteria | 1315 |
| 124 | Ga0163163_10002073 | 3300014325 | Bacteria | 16933 |
| 125 | Ga0157380_10091931 | 3300014326 | Bacteria | 2506 |
| 126 | Ga0157377_10001575 | 3300014745 | Bacteria | 9918 |
| 127 | Ga0157379_10175685 | 3300014968 | Bacteria | 1934 |
| 128 | Ga0157379_10372486 | 3300014968 | Bacteria | 1309 |
| 129 | Ga0163161_10242682 | 3300017792 | Bacteria | 1402 |
| 130 | Ga0206356_11422413 | 3300020070 | Bacteria | 3439 |
| 131 | Ga0207425_1003685 | 3300025245 | Bacteria | 4819 |
| 132 | Ga0209646_1000014 | 3300025246 | Bacteria | 550484 |
| 133 | Ga0209148_1000902 | 3300025254 | Bacteria | 20196 |
| 134 | Ga0209129_1000301 | 3300025258 | Bacteria | 45425 |
| 135 | Ga0209051_1045631 | 3300025303 | Bacteria | 1515 |
| 136 | Ga0207697_10008491 | 3300025315 | Bacteria | 4490 |
| 137 | Ga0207656_10000001 | 3300025321 | Bacteria | 1323684 |
| 138 | Ga0207656_10005038 | 3300025321 | Bacteria | 4643 |
| 139 | Ga0207655_1003646 | 3300025728 | Bacteria | 11371 |
| 140 | Ga0207655_1003750 | 3300025728 | Bacteria | 11143 |
| 141 | Ga0207655_1016308 | 3300025728 | Bacteria | 4072 |
| 142 | Ga0207713_1026361 | 3300025735 | Bacteria | 2665 |
| 143 | Ga0207682_10018946 | 3300025893 | Bacteria | 2693 |
| 144 | Ga0207710_10000013 | 3300025900 | Bacteria | 409402 |
| 145 | Ga0207688_10029131 | 3300025901 | Bacteria | 3038 |
| 146 | Ga0207680_10103779 | 3300025903 | Bacteria | 1831 |
| 147 | Ga0207680_10129552 | 3300025903 | Bacteria | 1661 |
| 148 | Ga0207647_10033044 | 3300025904 | Bacteria | 3317 |
| 149 | Ga0207645_10036080 | 3300025907 | Bacteria | 3174 |
| 150 | Ga0207645_10041558 | 3300025907 | Bacteria | 2942 |
| 151 | Ga0207643_10000232 | 3300025908 | Bacteria | 38984 |
| 152 | Ga0207705_10011820 | 3300025909 | Bacteria | 6308 |
| 153 | Ga0207705_10015369 | 3300025909 | Bacteria | 5491 |
| 154 | Ga0207654_10000001 | 3300025911 | Bacteria | 1816198 |
| 155 | Ga0207707_10095155 | 3300025912 | Bacteria | 2603 |
| 156 | Ga0207695_10003491 | 3300025913 | Bacteria | 22101 |
| 157 | Ga0207695_10004401 | 3300025913 | Bacteria | 19260 |
| 158 | Ga0207671_10000001 | 3300025914 | Bacteria | 1318881 |
| 159 | Ga0207671_10019773 | 3300025914 | Bacteria | 5141 |
| 160 | Ga0207663_10030531 | 3300025916 | Bacteria | 3180 |
| 161 | Ga0207662_10053216 | 3300025918 | Bacteria | 2411 |
| 162 | Ga0207657_10008363 | 3300025919 | Bacteria | 10507 |
| 163 | Ga0207649_10066230 | 3300025920 | Bacteria | 2289 |
| 164 | Ga0207681_10009151 | 3300025923 | Bacteria | 6049 |
| 165 | Ga0207694_10000052 | 3300025924 | Bacteria | 157700 |
| 166 | Ga0207694_10148740 | 3300025924 | Bacteria | 1886 |
| 167 | Ga0207650_10004300 | 3300025925 | Bacteria | 9722 |
| 168 | Ga0207659_10030587 | 3300025926 | Bacteria | 3680 |
| 169 | Ga0207687_10008999 | 3300025927 | Bacteria | 6527 |
| 170 | Ga0207700_10004672 | 3300025928 | Bacteria | 8111 |
| 171 | Ga0207644_10013662 | 3300025931 | Bacteria | 5419 |
| 172 | Ga0207644_10027589 | 3300025931 | Bacteria | 3924 |
| 173 | Ga0207690_10002420 | 3300025932 | Bacteria | 11289 |
| 174 | Ga0207686_10247751 | 3300025934 | Bacteria | 1300 |
| 175 | Ga0207691_10000351 | 3300025940 | Bacteria | 46524 |
| 176 | Ga0207691_10114867 | 3300025940 | Bacteria | 2391 |
| 177 | Ga0207711_10000509 | 3300025941 | Bacteria | 40017 |
| 178 | Ga0207711_10043235 | 3300025941 | Bacteria | 3842 |
| 179 | Ga0207711_10132717 | 3300025941 | Bacteria | 2234 |
| 180 | Ga0207711_10186820 | 3300025941 | Bacteria | 1887 |
| 181 | Ga0207689_10001645 | 3300025942 | Bacteria | 21174 |
| 182 | Ga0207679_10005712 | 3300025945 | Bacteria | 7805 |
| 183 | Ga0207667_10128997 | 3300025949 | Bacteria | 2604 |
| 184 | Ga0207712_10000006 | 3300025961 | Bacteria | 573204 |
| 185 | Ga0207640_10011755 | 3300025981 | Bacteria | 4965 |
| 186 | Ga0207658_10000249 | 3300025986 | Bacteria | 56248 |
| 187 | Ga0207658_10051660 | 3300025986 | Bacteria | 3030 |
| 188 | Ga0207658_10082184 | 3300025986 | Bacteria | 2473 |
| 189 | Ga0207677_10018978 | 3300026023 | Bacteria | 4141 |
| 190 | Ga0207703_10001488 | 3300026035 | Bacteria | 21381 |
| 191 | Ga0207703_10055241 | 3300026035 | Bacteria | 3231 |
| 192 | Ga0207703_10295505 | 3300026035 | Bacteria | 1475 |
| 193 | Ga0207639_10003999 | 3300026041 | Bacteria | 9957 |
| 194 | Ga0207639_10078419 | 3300026041 | Bacteria | 2607 |
| 195 | Ga0207639_10159112 | 3300026041 | Bacteria | 1901 |
| 196 | Ga0207678_10000474 | 3300026067 | Bacteria | 36371 |
| 197 | Ga0207708_10013253 | 3300026075 | Bacteria | 6155 |
| 198 | Ga0207702_10006935 | 3300026078 | Bacteria | 9703 |
| 199 | Ga0207702_10012603 | 3300026078 | Bacteria | 7037 |
| 200 | Ga0207641_10003056 | 3300026088 | Bacteria | 15083 |
| 201 | Ga0207641_10082851 | 3300026088 | Bacteria | 2788 |
| 202 | Ga0207676_10004942 | 3300026095 | Bacteria | 9448 |
| 203 | Ga0207674_10008539 | 3300026116 | Bacteria | 11815 |
| 204 | Ga0207674_10138128 | 3300026116 | Bacteria | 2398 |
| 205 | Ga0207683_10037590 | 3300026121 | Bacteria | 4216 |
| 206 | Ga0207683_10044700 | 3300026121 | Bacteria | 3872 |
| 207 | Ga0207698_10033840 | 3300026142 | Bacteria | 3718 |
| 208 | Ga0207698_10035213 | 3300026142 | Bacteria | 3660 |
| 209 | Ga0207428_10002680 | 3300027907 | Bacteria | 17744 |
| 210 | Ga0207428_10011068 | 3300027907 | Bacteria | 8015 |
| 211 | Ga0268266_10198610 | 3300028379 | Bacteria | 1835 |
| 212 | Ga0268266_10264309 | 3300028379 | Bacteria | 1595 |
| 213 | Ga0268265_10000016 | 3300028380 | Bacteria | 299380 |
| 214 | Ga0268264_10000026 | 3300028381 | Bacteria | 459088 |
| 215 | Ga0307511_10000634 | 3300030521 | Bacteria | 37652 |
| 216 | Ga0307511_10001437 | 3300030521 | Bacteria | 25148 |
| 217 | Ga0307512_10009369 | 3300030522 | Bacteria | 9438 |
| 218 | Ga0307513_10007035 | 3300031456 | Bacteria | 14635 |
| 219 | Ga0307408_100004023 | 3300031548 | Bacteria | 10028 |
| 220 | Ga0307408_100046033 | 3300031548 | Bacteria | 3119 |
| 221 | Ga0307408_100068909 | 3300031548 | Bacteria | 2606 |
| 222 | Ga0307408_100116354 | 3300031548 | Bacteria | 2063 |
| 223 | Ga0307408_100194299 | 3300031548 | Bacteria | 1637 |
| 224 | Ga0307408_100240134 | 3300031548 | Bacteria | 1488 |
| 225 | Ga0307408_100289864 | 3300031548 | Bacteria | 1366 |
| 226 | Ga0307514_10005422 | 3300031649 | Bacteria | 11397 |
| 227 | Ga0316576_10012344 | 3300031727 | Bacteria | 5639 |
| 228 | Ga0316576_10014452 | 3300031727 | Bacteria | 5275 |
| 229 | Ga0316578_10021445 | 3300031728 | Bacteria | 3586 |
| 230 | Ga0316578_10083712 | 3300031728 | Bacteria | 1900 |
| 231 | Ga0307405_10021445 | 3300031731 | Bacteria | 3632 |
| 232 | Ga0307405_10094216 | 3300031731 | Bacteria | 1991 |
| 233 | Ga0307405_10112633 | 3300031731 | Bacteria | 1846 |
| 234 | Ga0307405_10161040 | 3300031731 | Bacteria | 1589 |
| 235 | Ga0307413_10028203 | 3300031824 | Bacteria | 3123 |
| 236 | Ga0307413_10098340 | 3300031824 | Bacteria | 1926 |
| 237 | Ga0307413_10148854 | 3300031824 | Bacteria | 1629 |
| 238 | Ga0307413_10196574 | 3300031824 | Bacteria | 1452 |
| 239 | Ga0307413_10290291 | 3300031824 | Bacteria | 1235 |
| 240 | Ga0307413_10333433 | 3300031824 | Bacteria | 1164 |
| 241 | Ga0307410_10005325 | 3300031852 | Bacteria | 6793 |
| 242 | Ga0307410_10018983 | 3300031852 | Bacteria | 4171 |
| 243 | Ga0307410_10026634 | 3300031852 | Bacteria | 3643 |
| 244 | Ga0307410_10176092 | 3300031852 | Bacteria | 1616 |
| 245 | Ga0307406_10000136 | 3300031901 | Bacteria | 43889 |
| 246 | Ga0307406_10000222 | 3300031901 | Bacteria | 34546 |
| 247 | Ga0307406_10030755 | 3300031901 | Bacteria | 3263 |
| 248 | Ga0307406_10077982 | 3300031901 | Bacteria | 2193 |
| 249 | Ga0307407_10005168 | 3300031903 | Bacteria | 5634 |
| 250 | Ga0307407_10016558 | 3300031903 | Bacteria | 3673 |
| 251 | Ga0307407_10052360 | 3300031903 | Bacteria | 2344 |
| 252 | Ga0307412_10001498 | 3300031911 | Bacteria | 12970 |
| 253 | Ga0307412_10015965 | 3300031911 | Bacteria | 4462 |
| 254 | Ga0307412_10057668 | 3300031911 | Bacteria | 2593 |
| 255 | Ga0307412_10065676 | 3300031911 | Bacteria | 2456 |
| 256 | Ga0307412_10129379 | 3300031911 | Bacteria | 1831 |
| 257 | Ga0307412_10179950 | 3300031911 | Bacteria | 1589 |
| 258 | Ga0307412_10191545 | 3300031911 | Bacteria | 1546 |
| 259 | Ga0307412_10237948 | 3300031911 | Bacteria | 1406 |
| 260 | Ga0307409_100003955 | 3300031995 | Bacteria | 8212 |
| 261 | Ga0307409_100006663 | 3300031995 | Bacteria | 6820 |
| 262 | Ga0307409_100042115 | 3300031995 | Bacteria | 3417 |
| 263 | Ga0307409_100162562 | 3300031995 | Bacteria | 1955 |
| 264 | Ga0307409_100224685 | 3300031995 | Bacteria | 1697 |
| 265 | Ga0307416_100011588 | 3300032002 | Bacteria | 5890 |
| 266 | Ga0307416_100131275 | 3300032002 | Bacteria | 2255 |
| 267 | Ga0307416_100205366 | 3300032002 | Bacteria | 1873 |
| 268 | Ga0307414_10182003 | 3300032004 | Bacteria | 1691 |
| 269 | Ga0307414_10203329 | 3300032004 | Bacteria | 1613 |
| 270 | Ga0307414_10203678 | 3300032004 | Bacteria | 1612 |
| 271 | Ga0307415_100008200 | 3300032126 | Bacteria | 5780 |
| 272 | Ga0307415_100046662 | 3300032126 | Bacteria | 2911 |
| 273 | Ga0316593_10043060 | 3300032168 | Bacteria | 1507 |
| 274 | Ga0316574_0009490 | 3300035398 | Bacteria | 5452 |
| 275 | Ga0316574_0050619 | 3300035398 | Bacteria | 2586 |
| 276 | Ga0316584_0141092 | 3300036712 | Bacteria | 1797 |
| 277 | Ga0373925_0151698 | 3300037068 | Bacteria | 1820 |
| 278 | Ga0395899_0004426 | 3300037312 | Bacteria | 10958 |
| 279 | Ga0395899_0046187 | 3300037312 | Bacteria | 3244 |
| 280 | Ga0395900_0009801 | 3300037418 | Bacteria | 9817 |
| 281 | Ga0395900_0056980 | 3300037418 | Bacteria | 4022 |
| 282 | Ga0395900_0063338 | 3300037418 | Bacteria | 3801 |
| 283 | Ga0395900_0085759 | 3300037418 | Bacteria | 3236 |
| 284 | Ga0395900_0381546 | 3300037418 | Bacteria | 1377 |
| 285 | Ga0395898_0013573 | 3300037466 | Bacteria | 8384 |
| 286 | Ga0395898_0024868 | 3300037466 | Bacteria | 6037 |
| 287 | Ga0395898_0033510 | 3300037466 | Bacteria | 5124 |
| 288 | Ga0395898_0134822 | 3300037466 | Bacteria | 2364 |
| 289 | Ga0395898_0328683 | 3300037466 | Bacteria | 1458 |
| 290 | Ga0395905_0024297 | 3300037471 | Bacteria | 5720 |
| 291 | Ga0395905_0069267 | 3300037471 | Bacteria | 3304 |
| 292 | Ga0395905_0275678 | 3300037471 | Bacteria | 1568 |
| 293 | Ga0395901_0008965 | 3300038443 | Bacteria | 10128 |
| 294 | Ga0395901_0029621 | 3300038443 | Bacteria | 5637 |
| 295 | Ga0395901_0034596 | 3300038443 | Bacteria | 5218 |
| 296 | Ga0395901_0046535 | 3300038443 | Bacteria | 4507 |
| 297 | Ga0395901_0118429 | 3300038443 | Bacteria | 2782 |
| 298 | Ga0395901_0305936 | 3300038443 | Bacteria | 1647 |
| 299 | Ga0395901_0343834 | 3300038443 | Bacteria | 1541 |
| 300 | Ga0439436_0001513 | 3300041404 | Bacteria | 6760 |
| 301 | Ga0439436_0009320 | 3300041404 | Bacteria | 3009 |
| 302 | Ga0439436_0019313 | 3300041404 | Bacteria | 2035 |
| 303 | Ga0439438_012500 | 3300041405 | Bacteria | 2602 |
| 304 | Ga0439439_0015676 | 3300041406 | Bacteria | 1852 |
| 305 | Ga0439439_0022988 | 3300041406 | Bacteria | 1560 |
| 306 | Ga0439466_0001958 | 3300041411 | Bacteria | 8081 |
| 307 | Ga0439466_0055118 | 3300041411 | Bacteria | 1293 |
| 308 | Ga0451791_0114968 | 3300041451 | Bacteria | 980 |
| 309 | Ga0451797_1153456 | 3300041453 | Bacteria | 1981 |
| 310 | Ga0451837_0226511 | 3300041494 | Bacteria | 2603 |
| 311 | Ga0451853_2071353 | 3300041512 | Bacteria | 2500 |
| 312 | Ga0451853_3819697 | 3300041512 | Bacteria | 1459 |
| 313 | Ga0439433_0000371 | 3300041999 | Bacteria | 7988 |
| 314 | Ga0439442_000062 | 3300042002 | Bacteria | 25596 |
| 315 | Ga0439442_000404 | 3300042002 | Bacteria | 10144 |
| 316 | Ga0439442_001380 | 3300042002 | Bacteria | 4808 |
| 317 | Ga0439442_004729 | 3300042002 | Bacteria | 2707 |
| 318 | Ga0439448_0011579 | 3300042005 | Bacteria | 2630 |
| 319 | Ga0439449_0000723 | 3300042007 | Bacteria | 12649 |
| 320 | Ga0439449_0004612 | 3300042007 | Bacteria | 5325 |
| 321 | Ga0439449_0014819 | 3300042007 | Bacteria | 2930 |
| 322 | Ga0439449_0025924 | 3300042007 | Bacteria | 2189 |
| 323 | Ga0439452_004807 | 3300042010 | Bacteria | 4447 |
| 324 | Ga0439457_003890 | 3300042014 | Bacteria | 3996 |
| 325 | Ga0439457_005563 | 3300042014 | Bacteria | 3156 |
| 326 | Ga0450920_000019 | 3300042122 | Bacteria | 18359 |
| 327 | Ga0450923_019257 | 3300042125 | Bacteria | 1314 |
| 328 | Ga0450905_005650 | 3300042142 | Bacteria | 1678 |
| 329 | Ga0450907_000193 | 3300042146 | Bacteria | 22282 |
| 330 | Ga0439458_0022318 | 3300042157 | Bacteria | 1470 |
| 331 | Ga0439434_0000287 | 3300042435 | Bacteria | 14415 |
| 332 | Ga0439464_0026108 | 3300042439 | Bacteria | 1619 |
| 333 | Ga0450918_000625 | 3300042531 | Bacteria | 7586 |
| 334 | Ga0466972_0008191 | 3300044658 | Bacteria | 5242 |
| 335 | Ga0466972_0052051 | 3300044658 | Bacteria | 1974 |
| 336 | Ga0466972_0063211 | 3300044658 | Bacteria | 1773 |
| 337 | Ga0466965_0000011 | 3300044683 | Bacteria | 107319 |
| 338 | Ga0466965_0000329 | 3300044683 | Bacteria | 15867 |
| 339 | Ga0466966_0057963 | 3300044684 | Bacteria | 2448 |
| 340 | Ga0466966_0142334 | 3300044684 | Bacteria | 1465 |
| 341 | Ga0466961_0014211 | 3300044693 | Bacteria | 5109 |
| 342 | Ga0466968_0004574 | 3300044735 | Bacteria | 5176 |
| 343 | Ga0466970_0009705 | 3300044765 | Bacteria | 4870 |
| 344 | Ga0466970_0071612 | 3300044765 | Bacteria | 1865 |
| 345 | Ga0466970_0104781 | 3300044765 | Bacteria | 1542 |
| 346 | Ga0466957_0014479 | 3300044842 | Bacteria | 4593 |
| 347 | Ga0466960_0009929 | 3300044901 | Bacteria | 3939 |
| 348 | Ga0466959_0001223 | 3300045049 | Bacteria | 15502 |
| 349 | Ga0466958_0084007 | 3300045836 | Bacteria | 1963 |
| 350 | Ga0495627_000642 | 3300046453 | Bacteria | 27306 |
| 351 | Ga0495629_0270951 | 3300046459 | Bacteria | 1166 |
| 352 | Ga0495653_0060228 | 3300046463 | Bacteria | 2877 |
| 353 | Ga0495650_0000555 | 3300046471 | Bacteria | 53150 |
| 354 | Ga0495580_0016068 | 3300046472 | Bacteria | 5626 |
| 355 | Ga0495582_0044712 | 3300046473 | Bacteria | 2439 |
| 356 | Ga0495582_0178898 | 3300046473 | Bacteria | 1208 |
| 357 | Ga0495639_0013473 | 3300046475 | Bacteria | 3532 |
| 358 | Ga0495662_0007098 | 3300046476 | Bacteria | 5560 |
| 359 | Ga0495664_0003644 | 3300046477 | Bacteria | 8394 |
| 360 | Ga0495642_0033770 | 3300046528 | Bacteria | 2058 |
| 361 | Ga0495665_0003196 | 3300046531 | Bacteria | 8871 |
| 362 | Ga0495665_0043572 | 3300046531 | Bacteria | 2386 |
| 363 | Ga0495586_0004820 | 3300046535 | Bacteria | 7210 |
| 364 | Ga0495586_0029503 | 3300046535 | Bacteria | 2935 |
| 365 | Ga0495587_0004288 | 3300046536 | Bacteria | 9417 |
| 366 | Ga0495645_0005930 | 3300046543 | Bacteria | 8441 |
| 367 | Ga0495633_0049256 | 3300046558 | Bacteria | 1989 |
| 368 | Ga0495667_0002366 | 3300046559 | Bacteria | 12597 |
| 369 | Ga0495656_0014477 | 3300046615 | Bacteria | 2958 |
| 370 | Ga0495668_0108501 | 3300046616 | Bacteria | 1518 |
| 371 | Ga0495635_0226374 | 3300046663 | Bacteria | 1264 |
| 372 | Ga0495588_0000879 | 3300046674 | Bacteria | 13274 |
| 373 | Ga0495588_0111639 | 3300046674 | Bacteria | 1440 |
| 374 | Ga0495670_0003138 | 3300046691 | Bacteria | 8141 |
| 375 | Ga0495670_0122761 | 3300046691 | Bacteria | 1350 |
| 376 | Ga0495600_0002402 | 3300046809 | Bacteria | 10730 |
| 377 | Ga0495604_0122374 | 3300047317 | Bacteria | 1882 |
| 378 | Ga0495680_0065264 | 3300047322 | Bacteria | 2788 |
| 379 | Ga0495686_0109092 | 3300047472 | Bacteria | 1662 |
| 380 | Ga0495593_0057938 | 3300047673 | Bacteria | 2033 |
| 381 | Ga0496100_0004281 | 3300048903 | Bacteria | 7552 |
| 382 | Ga0496100_0243843 | 3300048903 | Bacteria | 1327 |
| 383 | Ga0496101_0003626 | 3300048904 | Bacteria | 9639 |
| 384 | Ga0496101_0018777 | 3300048904 | Bacteria | 4708 |
| 385 | Ga0496102_0000124 | 3300048905 | Bacteria | 110030 |
| 386 | Ga0496102_0011832 | 3300048905 | Bacteria | 7531 |
| 387 | Ga0496102_0033364 | 3300048905 | Bacteria | 4625 |
| 388 | Ga0496102_0194672 | 3300048905 | Bacteria | 1910 |
| 389 | Ga0496103_0000560 | 3300048906 | Bacteria | 29543 |
| 390 | Ga0496103_0034371 | 3300048906 | Bacteria | 3100 |
| 391 | Ga0496103_0034406 | 3300048906 | Bacteria | 3098 |
| 392 | Ga0496103_0052109 | 3300048906 | Bacteria | 2534 |
| 393 | Ga0496103_0102796 | 3300048906 | Bacteria | 1810 |
| 394 | Ga0496103_0247709 | 3300048906 | Bacteria | 1146 |
| 395 | Ga0496104_0005550 | 3300048907 | Bacteria | 11048 |
| 396 | Ga0496104_0071163 | 3300048907 | Bacteria | 3307 |
| 397 | Ga0496105_0065665 | 3300048908 | Bacteria | 2994 |
| 398 | Ga0496106_0007029 | 3300048909 | Bacteria | 8313 |
| 399 | Ga0496106_0127431 | 3300048909 | Bacteria | 1994 |
| 400 | Ga0496107_0035550 | 3300048910 | Bacteria | 3571 |
| 401 | Ga0496107_0041565 | 3300048910 | Bacteria | 3301 |
| 402 | Ga0496107_0107004 | 3300048910 | Bacteria | 2054 |
| 403 | Ga0496108_0068817 | 3300048911 | Bacteria | 2987 |
| 404 | Ga0496108_0080023 | 3300048911 | Bacteria | 2767 |
| 405 | Ga0496108_0149580 | 3300048911 | Bacteria | 2014 |
| 406 | Ga0496109_0001855 | 3300048912 | Bacteria | 17503 |
| 407 | Ga0496109_0140679 | 3300048912 | Bacteria | 2256 |
| 408 | Ga0496110_0005637 | 3300048913 | Bacteria | 9825 |
| 409 | Ga0496110_0023571 | 3300048913 | Bacteria | 5237 |
| 410 | Ga0496111_0001410 | 3300048914 | Bacteria | 13660 |
| 411 | Ga0496111_0059797 | 3300048914 | Bacteria | 2761 |
| 412 | Ga0496112_0004659 | 3300048915 | Bacteria | 11660 |
| 413 | Ga0496112_0100994 | 3300048915 | Bacteria | 2854 |
| 414 | Ga0496112_0113901 | 3300048915 | Bacteria | 2675 |
| 415 | Ga0496113_0094358 | 3300048916 | Bacteria | 2311 |
| 416 | Ga0496113_0311917 | 3300048916 | Bacteria | 1260 |
| 417 | Ga0496114_0080325 | 3300048917 | Bacteria | 2754 |
| 418 | Ga0496115_0011845 | 3300048918 | Bacteria | 6550 |
| 419 | Ga0496115_0045709 | 3300048918 | Bacteria | 3496 |
| 420 | Ga0496116_0001159 | 3300048919 | Bacteria | 31113 |
| 421 | Ga0496117_0000496 | 3300048920 | Bacteria | 64935 |
| 422 | Ga0496117_0015229 | 3300048920 | Bacteria | 6574 |
| 423 | Ga0496117_0039719 | 3300048920 | Bacteria | 3469 |
| 424 | Ga0496118_0001104 | 3300048921 | Bacteria | 41942 |
| 425 | Ga0496118_0019129 | 3300048921 | Bacteria | 6135 |
| 426 | Ga0496118_0039338 | 3300048921 | Bacteria | 3775 |
| 427 | Ga0496119_0002666 | 3300048922 | Bacteria | 19308 |
| 428 | Ga0496119_0027851 | 3300048922 | Bacteria | 3871 |
| 429 | Ga0496120_0000251 | 3300048923 | Bacteria | 90074 |
| 430 | Ga0496120_0003803 | 3300048923 | Bacteria | 13301 |
| 431 | Ga0496120_0007793 | 3300048923 | Bacteria | 7908 |
| 432 | Ga0496121_0011170 | 3300048924 | Bacteria | 10015 |
| 433 | Ga0496122_0006826 | 3300048925 | Bacteria | 12943 |
| 434 | Ga0496123_0000363 | 3300048926 | Bacteria | 85560 |
| 435 | Ga0496124_0009186 | 3300048927 | Bacteria | 10205 |
| 436 | Ga0496125_0011795 | 3300048928 | Bacteria | 8709 |
| 437 | Ga0496125_0077443 | 3300048928 | Bacteria | 2563 |
| 438 | Ga0496125_0158536 | 3300048928 | Bacteria | 1541 |
| 439 | Ga0496126_0004072 | 3300048929 | Bacteria | 17736 |
| 440 | Ga0496126_0005977 | 3300048929 | Bacteria | 13680 |
| 441 | Ga0496126_0009535 | 3300048929 | Bacteria | 10298 |
| 442 | Ga0496126_0034191 | 3300048929 | Bacteria | 4776 |
| 443 | Ga0496126_0036340 | 3300048929 | Bacteria | 4606 |
| 444 | Ga0501325_000271 | 3300049541 | Bacteria | 2226 |
| 445 | Ga0501031_0025027 | 3300049568 | Bacteria | 3893 |
| 446 | Ga0501031_0027643 | 3300049568 | Bacteria | 3697 |
| 447 | Ga0501031_0158903 | 3300049568 | Bacteria | 1477 |
| 448 | Ga0501032_0001293 | 3300049569 | Bacteria | 20070 |
| 449 | Ga0501032_0062602 | 3300049569 | Bacteria | 2493 |
| 450 | Ga0501032_0257573 | 3300049569 | Bacteria | 1132 |
| 451 | Ga0501033_0010022 | 3300049570 | Bacteria | 7277 |
| 452 | Ga0501033_0117495 | 3300049570 | Bacteria | 1932 |
| 453 | Ga0501033_0253927 | 3300049570 | Bacteria | 1245 |
| 454 | Ga0501034_0000080 | 3300049571 | Bacteria | 170742 |
| 455 | Ga0501034_0000527 | 3300049571 | Bacteria | 61221 |
| 456 | Ga0501034_0109064 | 3300049571 | Bacteria | 2759 |
| 457 | Ga0501036_0012292 | 3300049572 | Bacteria | 7088 |
| 458 | Ga0501037_0002373 | 3300049573 | Bacteria | 13597 |
| 459 | Ga0501037_0006609 | 3300049573 | Bacteria | 8480 |
| 460 | Ga0501037_0022906 | 3300049573 | Bacteria | 4620 |
| 461 | Ga0501038_0002633 | 3300049574 | Bacteria | 16783 |
| 462 | Ga0501038_0013882 | 3300049574 | Bacteria | 7341 |
| 463 | Ga0501038_0018417 | 3300049574 | Bacteria | 6304 |
| 464 | Ga0501038_0031943 | 3300049574 | Bacteria | 4650 |
| 465 | Ga0501038_0078890 | 3300049574 | Bacteria | 2777 |
| 466 | Ga0501039_0013723 | 3300049575 | Bacteria | 6197 |
| 467 | Ga0501039_0014163 | 3300049575 | Bacteria | 6106 |
| 468 | Ga0501042_0001396 | 3300049578 | Bacteria | 14173 |
| 469 | Ga0501042_0153707 | 3300049578 | Bacteria | 1659 |
| 470 | Ga0501043_0074250 | 3300049579 | Bacteria | 2671 |
| 471 | Ga0501043_0145172 | 3300049579 | Bacteria | 1858 |
| 472 | Ga0501043_0169928 | 3300049579 | Bacteria | 1701 |
| 473 | Ga0501043_0233953 | 3300049579 | Bacteria | 1418 |
| 474 | Ga0501046_0008013 | 3300049580 | Bacteria | 9234 |
| 475 | Ga0501046_0008849 | 3300049580 | Bacteria | 8745 |
| 476 | Ga0501046_0018440 | 3300049580 | Bacteria | 5808 |
| 477 | Ga0501047_0027561 | 3300049581 | Bacteria | 5473 |
| 478 | Ga0501047_0030136 | 3300049581 | Bacteria | 5231 |
| 479 | Ga0501047_0051462 | 3300049581 | Bacteria | 3980 |
| 480 | Ga0501047_0088730 | 3300049581 | Bacteria | 2969 |
| 481 | Ga0501047_0099507 | 3300049581 | Bacteria | 2787 |
| 482 | Ga0501047_0124689 | 3300049581 | Bacteria | 2456 |
| 483 | Ga0501048_0006285 | 3300049582 | Bacteria | 9032 |
| 484 | Ga0501070_0137147 | 3300049586 | Bacteria | 2020 |
| 485 | Ga0501070_0217214 | 3300049586 | Bacteria | 1568 |
| 486 | Ga0501073_0000050 | 3300049589 | Bacteria | 75004 |
| 487 | Ga0501074_0052514 | 3300049590 | Bacteria | 2942 |
| 488 | Ga0501080_0131705 | 3300049742 | Bacteria | 2315 |
| 489 | Ga0501083_0000169 | 3300049744 | Bacteria | 42763 |
| 490 | Ga0501083_0021463 | 3300049744 | Bacteria | 4488 |
| 491 | Ga0501035_0038173 | 3300049822 | Bacteria | 4348 |
| 492 | Ga0501035_0041624 | 3300049822 | Bacteria | 4148 |
| 493 | Ga0501044_0001927 | 3300049823 | Bacteria | 24016 |
| 494 | Ga0501044_0011059 | 3300049823 | Bacteria | 9788 |
| 495 | Ga0501044_0035771 | 3300049823 | Bacteria | 5198 |
| 496 | Ga0501044_0086055 | 3300049823 | Bacteria | 3176 |
| 497 | Ga0501044_0246812 | 3300049823 | Bacteria | 1728 |
| 498 | Ga0501045_0019511 | 3300049824 | Bacteria | 4835 |
| 499 | nmdc:mga00v17_146268_c1 | 3300050491 | Bacteria | 1517 |
| 500 | nmdc:mga00v17_52075_c1 | 3300050491 | Bacteria | 2490 |
| 501 | nmdc:mga00v17_80920_c1 | 3300050491 | Bacteria | 2028 |
| 502 | nmdc:mga00v17_98747_c1 | 3300050491 | Bacteria | 1841 |
| 503 | nmdc:mga0yw44_47999_c1 | 3300050492 | Bacteria | 2573 |
| 504 | nmdc:mga05p37_123326_c1 | 3300050507 | Bacteria | 3182 |
| 505 | nmdc:mga05p37_442473_c1 | 3300050507 | Bacteria | 1507 |
| 506 | nmdc:mga06r32_14178_c1 | 3300050510 | Bacteria | 7229 |
| 507 | nmdc:mga06r32_70588_c1 | 3300050510 | Bacteria | 3378 |
| 508 | nmdc:mga0rr50_3408_c1 | 3300050513 | Bacteria | 9144 |
| 509 | nmdc:mga0a205_20264_c1 | 3300050515 | Bacteria | 6272 |
| 510 | Ga0495655_0007293 | 3300053083 | Bacteria | 2048 |
| 511 | Ga0500651_0000276 | 3300053093 | Bacteria | 30396 |
| 512 | Ga0500559_0001167 | 3300053136 | Bacteria | 15763 |
| 513 | Ga0500559_0001470 | 3300053136 | Bacteria | 13319 |
| 514 | Ga0500568_0000486 | 3300053139 | Bacteria | 29334 |
| 515 | Ga0500573_0012318 | 3300053140 | Bacteria | 4802 |
| 516 | Ga0500573_0043186 | 3300053140 | Bacteria | 2602 |
| 517 | Ga0500573_0067987 | 3300053140 | Bacteria | 2035 |
| 518 | Ga0500573_0077127 | 3300053140 | Bacteria | 1896 |
| 519 | Ga0500577_0036313 | 3300053142 | Bacteria | 1763 |
| 520 | Ga0500590_006894 | 3300053148 | Bacteria | 5568 |
| 521 | Ga0500616_0097619 | 3300053153 | Bacteria | 1442 |
| 522 | Ga0501082_0026260 | 3300060353 | Bacteria | 5018 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014968 | Ga0157379_10175685 | Ga0157379_101756852 | 269 |
| 2 | 3300046459 | Ga0495629_0270951 | Ga0495629_0270951_189_1148 | 283 |
| 3 | 3300006051 | Ga0075364_10027145 | Ga0075364_100271453 | 288 |
| 4 | 3300049569 | Ga0501032_0257573 | Ga0501032_0257573_38_1072 | 294 |
| 5 | 3300037312 | Ga0395899_0046187 | Ga0395899_0046187_1420_2472 | 296 |
| 6 | 3300037466 | Ga0395898_0024868 | Ga0395898_0024868_3454_4506 | 296 |
| 7 | iso_pu_bacteria | 8055172936 | 8055179897 | 296 |
| 8 | iso_pu_bacteria | 2873314349 | 2873318796 | 297 |
| 9 | iso_pu_bacteria | 2891395885 | 2891403429 | 297 |
| 10 | iso_pu_bacteria | 2891554331 | 2891556820 | 297 |
| 11 | 3300026035 | Ga0207703_10295505 | Ga0207703_102955051 | 298 |
| 12 | 3300031824 | Ga0307413_10148854 | Ga0307413_101488542 | 298 |
| 13 | 3300006051 | Ga0075364_10118356 | Ga0075364_101183562 | 299 |
| 14 | 3300048920 | Ga0496117_0039719 | Ga0496117_0039719_1039_2067 | 299 |
| 15 | 3300048921 | Ga0496118_0039338 | Ga0496118_0039338_19_1047 | 299 |
| 16 | 3300048922 | Ga0496119_0002666 | Ga0496119_0002666_5399_6427 | 299 |
| 17 | 3300048923 | Ga0496120_0000251 | Ga0496120_0000251_59021_60049 | 299 |
| 18 | 3300049574 | Ga0501038_0078890 | Ga0501038_0078890_296_1351 | 299 |
| 19 | 3300050491 | nmdc:mga00v17_52075_c1 | nmdc:mga00v17_52075_c1_543_1583 | 299 |
| 20 | 3300006051 | Ga0075364_10117831 | Ga0075364_101178312 | 300 |
| 21 | 3300031548 | Ga0307408_100194299 | Ga0307408_1001942991 | 300 |
| 22 | 3300032126 | Ga0307415_100046662 | Ga0307415_1000466621 | 300 |
| 23 | 3300049573 | Ga0501037_0022906 | Ga0501037_0022906_3338_4369 | 300 |
| 24 | 3300049579 | Ga0501043_0169928 | Ga0501043_0169928_120_1151 | 300 |
| 25 | iso_pu_bacteria | 2856741275 | 2856744054 | 300 |
| 26 | iso_pu_bacteria | 2891562705 | 2891568053 | 300 |
| 27 | 3300031911 | Ga0307412_10065676 | Ga0307412_100656762 | 301 |
| 28 | 3300032002 | Ga0307416_100205366 | Ga0307416_1002053662 | 301 |
| 29 | 3300053142 | Ga0500577_0036313 | Ga0500577_0036313_214_1188 | 301 |
| 30 | 3300048929 | Ga0496126_0004072 | Ga0496126_0004072_2128_3159 | 302 |
| 31 | 3300049580 | Ga0501046_0008013 | Ga0501046_0008013_1201_2232 | 302 |
| 32 | 3300049581 | Ga0501047_0124689 | Ga0501047_0124689_601_1632 | 302 |
| 33 | 3300049823 | Ga0501044_0011059 | Ga0501044_0011059_7158_8189 | 302 |
| 34 | 3300005353 | Ga0070669_100004417 | Ga0070669_1000044172 | 303 |
| 35 | 3300005367 | Ga0070667_100000171 | Ga0070667_1000001718 | 303 |
| 36 | 3300005548 | Ga0070665_100015519 | Ga0070665_1000155192 | 303 |
| 37 | 3300005617 | Ga0068859_100058958 | Ga0068859_1000589583 | 303 |
| 38 | 3300005618 | Ga0068864_100103970 | Ga0068864_1001039702 | 303 |
| 39 | 3300005841 | Ga0068863_100005765 | Ga0068863_1000057658 | 303 |
| 40 | 3300005843 | Ga0068860_100000112 | Ga0068860_100000112103 | 303 |
| 41 | 3300005844 | Ga0068862_100000012 | Ga0068862_10000001274 | 303 |
| 42 | 3300006931 | Ga0097620_100058953 | Ga0097620_1000589533 | 303 |
| 43 | 3300009101 | Ga0105247_10000007 | Ga0105247_1000000797 | 303 |
| 44 | 3300009177 | Ga0105248_10000254 | Ga0105248_1000025413 | 303 |
| 45 | 3300009553 | Ga0105249_10000001 | Ga0105249_10000001388 | 303 |
| 46 | 3300013306 | Ga0163162_10090637 | Ga0163162_100906373 | 303 |
| 47 | 3300014325 | Ga0163163_10002073 | Ga0163163_100020733 | 303 |
| 48 | 3300014968 | Ga0157379_10372486 | Ga0157379_103724861 | 303 |
| 49 | 3300025900 | Ga0207710_10000013 | Ga0207710_1000001397 | 303 |
| 50 | 3300025923 | Ga0207681_10009151 | Ga0207681_100091512 | 303 |
| 51 | 3300025941 | Ga0207711_10000509 | Ga0207711_100005097 | 303 |
| 52 | 3300025961 | Ga0207712_10000006 | Ga0207712_10000006103 | 303 |
| 53 | 3300025986 | Ga0207658_10000249 | Ga0207658_100002498 | 303 |
| 54 | 3300026035 | Ga0207703_10055241 | Ga0207703_100552411 | 303 |
| 55 | 3300026088 | Ga0207641_10003056 | Ga0207641_100030569 | 303 |
| 56 | 3300028380 | Ga0268265_10000016 | Ga0268265_1000001699 | 303 |
| 57 | 3300028381 | Ga0268264_10000026 | Ga0268264_10000026101 | 303 |
| 58 | 3300031824 | Ga0307413_10098340 | Ga0307413_100983402 | 303 |
| 59 | 3300031852 | Ga0307410_10026634 | Ga0307410_100266342 | 303 |
| 60 | 3300037471 | Ga0395905_0024297 | Ga0395905_0024297_4558_5634 | 303 |
| 61 | 3300038443 | Ga0395901_0118429 | Ga0395901_0118429_1383_2459 | 303 |
| 62 | 3300048904 | Ga0496101_0003626 | Ga0496101_0003626_5223_6272 | 303 |
| 63 | 3300048905 | Ga0496102_0000124 | Ga0496102_0000124_98128_99177 | 303 |
| 64 | 3300048906 | Ga0496103_0000560 | Ga0496103_0000560_12942_13991 | 303 |
| 65 | 3300048917 | Ga0496114_0080325 | Ga0496114_0080325_1353_2402 | 303 |
| 66 | 3300048919 | Ga0496116_0001159 | Ga0496116_0001159_6176_7225 | 303 |
| 67 | 3300048920 | Ga0496117_0000496 | Ga0496117_0000496_28478_29527 | 303 |
| 68 | 3300048921 | Ga0496118_0001104 | Ga0496118_0001104_25360_26409 | 303 |
| 69 | 3300048922 | Ga0496119_0027851 | Ga0496119_0027851_2102_3151 | 303 |
| 70 | 3300048923 | Ga0496120_0003803 | Ga0496120_0003803_7787_8836 | 303 |
| 71 | 3300048924 | Ga0496121_0011170 | Ga0496121_0011170_8577_9626 | 303 |
| 72 | 3300048927 | Ga0496124_0009186 | Ga0496124_0009186_8976_10025 | 303 |
| 73 | 3300048928 | Ga0496125_0077443 | Ga0496125_0077443_634_1683 | 303 |
| 74 | 3300048929 | Ga0496126_0005977 | Ga0496126_0005977_390_1439 | 303 |
| 75 | 3300041451 | Ga0451791_0114968 | Ga0451791_0114968_10_960 | 304 |
| 76 | 3300044684 | Ga0466966_0142334 | Ga0466966_0142334_289_1374 | 304 |
| 77 | 3300031903 | Ga0307407_10016558 | Ga0307407_100165582 | 306 |
| 78 | 3300048915 | Ga0496112_0113901 | Ga0496112_0113901_678_1727 | 306 |
| 79 | 3300049823 | Ga0501044_0246812 | Ga0501044_0246812_83_1126 | 307 |
| 80 | 3300005328 | Ga0070676_10049956 | Ga0070676_100499562 | 308 |
| 81 | 3300005333 | Ga0070677_10017792 | Ga0070677_100177922 | 308 |
| 82 | 3300005335 | Ga0070666_10129362 | Ga0070666_101293622 | 308 |
| 83 | 3300005353 | Ga0070669_100035663 | Ga0070669_1000356632 | 308 |
| 84 | 3300005356 | Ga0070674_100101092 | Ga0070674_1001010922 | 308 |
| 85 | 3300005456 | Ga0070678_100019103 | Ga0070678_1000191032 | 308 |
| 86 | 3300005543 | Ga0070672_100053330 | Ga0070672_1000533302 | 308 |
| 87 | 3300005548 | Ga0070665_100285127 | Ga0070665_1002851272 | 308 |
| 88 | 3300009011 | Ga0105251_10005785 | Ga0105251_100057852 | 308 |
| 89 | 3300009036 | Ga0105244_10018175 | Ga0105244_100181752 | 308 |
| 90 | 3300011119 | Ga0105246_10011546 | Ga0105246_100115462 | 308 |
| 91 | 3300025315 | Ga0207697_10008491 | Ga0207697_100084912 | 308 |
| 92 | 3300025728 | Ga0207655_1016308 | Ga0207655_10163082 | 308 |
| 93 | 3300025893 | Ga0207682_10018946 | Ga0207682_100189462 | 308 |
| 94 | 3300025903 | Ga0207680_10129552 | Ga0207680_101295522 | 308 |
| 95 | 3300025907 | Ga0207645_10036080 | Ga0207645_100360803 | 308 |
| 96 | 3300025940 | Ga0207691_10000351 | Ga0207691_1000035113 | 308 |
| 97 | 3300026121 | Ga0207683_10044700 | Ga0207683_100447002 | 308 |
| 98 | 3300028379 | Ga0268266_10198610 | Ga0268266_101986102 | 308 |
| 99 | 3300048907 | Ga0496104_0071163 | Ga0496104_0071163_1320_2369 | 308 |
| 100 | 3300048912 | Ga0496109_0140679 | Ga0496109_0140679_317_1366 | 308 |
| 101 | 3300048915 | Ga0496112_0100994 | Ga0496112_0100994_596_1645 | 308 |
| 102 | 3300005355 | Ga0070671_100034188 | Ga0070671_1000341882 | 310 |
| 103 | 3300037418 | Ga0395900_0009801 | Ga0395900_0009801_5853_6905 | 310 |
| 104 | 3300037471 | Ga0395905_0069267 | Ga0395905_0069267_357_1409 | 310 |
| 105 | 3300038443 | Ga0395901_0034596 | Ga0395901_0034596_2653_3684 | 310 |
| 106 | 3300046674 | Ga0495588_0111639 | Ga0495588_0111639_309_1358 | 310 |
| 107 | 3300049581 | Ga0501047_0088730 | Ga0501047_0088730_1816_2901 | 310 |
| 108 | 3300053139 | Ga0500568_0000486 | Ga0500568_0000486_27783_28832 | 310 |
| 109 | 3300053140 | Ga0500573_0043186 | Ga0500573_0043186_693_1703 | 310 |
| 110 | 3300006844 | Ga0075428_100007778 | Ga0075428_1000077782 | 311 |
| 111 | 3300006847 | Ga0075431_100129219 | Ga0075431_1001292192 | 311 |
| 112 | 3300009147 | Ga0114129_10011065 | Ga0114129_100110653 | 311 |
| 113 | 3300031456 | Ga0307513_10007035 | Ga0307513_1000703512 | 311 |
| 114 | 3300037466 | Ga0395898_0134822 | Ga0395898_0134822_56_1105 | 311 |
| 115 | 3300037471 | Ga0395905_0275678 | Ga0395905_0275678_480_1529 | 311 |
| 116 | 3300042125 | Ga0450923_019257 | Ga0450923_019257_265_1266 | 311 |
| 117 | 3300050510 | nmdc:mga06r32_14178_c1 | nmdc:mga06r32_14178_c1_1432_2472 | 311 |
| 118 | 3300053093 | Ga0500651_0000276 | Ga0500651_0000276_16330_17358 | 311 |
| 119 | 3300006186 | Ga0075369_10012953 | Ga0075369_100129533 | 312 |
| 120 | 3300009098 | Ga0105245_10016291 | Ga0105245_100162916 | 312 |
| 121 | 3300009177 | Ga0105248_10013313 | Ga0105248_100133134 | 312 |
| 122 | 3300025927 | Ga0207687_10008999 | Ga0207687_100089992 | 312 |
| 123 | 3300025941 | Ga0207711_10043235 | Ga0207711_100432354 | 312 |
| 124 | 3300046463 | Ga0495653_0060228 | Ga0495653_0060228_487_1536 | 312 |
| 125 | 3300046473 | Ga0495582_0178898 | Ga0495582_0178898_32_1081 | 312 |
| 126 | 3300046476 | Ga0495662_0007098 | Ga0495662_0007098_1409_2458 | 312 |
| 127 | 3300046477 | Ga0495664_0003644 | Ga0495664_0003644_537_1586 | 312 |
| 128 | 3300046531 | Ga0495665_0003196 | Ga0495665_0003196_5601_6650 | 312 |
| 129 | 3300046535 | Ga0495586_0004820 | Ga0495586_0004820_547_1596 | 312 |
| 130 | 3300046536 | Ga0495587_0004288 | Ga0495587_0004288_1451_2500 | 312 |
| 131 | 3300046543 | Ga0495645_0005930 | Ga0495645_0005930_4342_5391 | 312 |
| 132 | 3300046559 | Ga0495667_0002366 | Ga0495667_0002366_3009_4058 | 312 |
| 133 | 3300046663 | Ga0495635_0226374 | Ga0495635_0226374_118_1167 | 312 |
| 134 | 3300046809 | Ga0495600_0002402 | Ga0495600_0002402_8968_10017 | 312 |
| 135 | 3300047317 | Ga0495604_0122374 | Ga0495604_0122374_735_1784 | 312 |
| 136 | 3300047322 | Ga0495680_0065264 | Ga0495680_0065264_620_1669 | 312 |
| 137 | 3300048911 | Ga0496108_0080023 | Ga0496108_0080023_1713_2714 | 312 |
| 138 | 3300048928 | Ga0496125_0158536 | Ga0496125_0158536_103_1104 | 312 |
| 139 | 3300053148 | Ga0500590_006894 | Ga0500590_006894_1380_2408 | 312 |
| 140 | 3300005339 | Ga0070660_100018825 | Ga0070660_1000188255 | 313 |
| 141 | 3300005365 | Ga0070688_100179838 | Ga0070688_1001798381 | 313 |
| 142 | 3300005366 | Ga0070659_100007511 | Ga0070659_1000075116 | 313 |
| 143 | 3300005367 | Ga0070667_100051906 | Ga0070667_1000519062 | 313 |
| 144 | 3300005435 | Ga0070714_100188262 | Ga0070714_1001882622 | 313 |
| 145 | 3300005466 | Ga0070685_10011134 | Ga0070685_100111342 | 313 |
| 146 | 3300005539 | Ga0068853_100006224 | Ga0068853_1000062244 | 313 |
| 147 | 3300005577 | Ga0068857_100002565 | Ga0068857_1000025656 | 313 |
| 148 | 3300005578 | Ga0068854_100141509 | Ga0068854_1001415092 | 313 |
| 149 | 3300005616 | Ga0068852_100057605 | Ga0068852_1000576053 | 313 |
| 150 | 3300005834 | Ga0068851_10000015 | Ga0068851_10000015124 | 313 |
| 151 | 3300005842 | Ga0068858_100000123 | Ga0068858_10000012372 | 313 |
| 152 | 3300009093 | Ga0105240_10094892 | Ga0105240_100948922 | 313 |
| 153 | 3300009545 | Ga0105237_10000308 | Ga0105237_1000030817 | 313 |
| 154 | 3300009551 | Ga0105238_10005665 | Ga0105238_100056659 | 313 |
| 155 | 3300010375 | Ga0105239_10127634 | Ga0105239_101276342 | 313 |
| 156 | 3300010375 | Ga0105239_10254192 | Ga0105239_102541922 | 313 |
| 157 | 3300025254 | Ga0209148_1000902 | Ga0209148_10009024 | 313 |
| 158 | 3300025321 | Ga0207656_10000001 | Ga0207656_10000001760 | 313 |
| 159 | 3300025909 | Ga0207705_10015369 | Ga0207705_100153694 | 313 |
| 160 | 3300025913 | Ga0207695_10003491 | Ga0207695_100034914 | 313 |
| 161 | 3300025914 | Ga0207671_10000001 | Ga0207671_10000001759 | 313 |
| 162 | 3300025919 | Ga0207657_10008363 | Ga0207657_100083634 | 313 |
| 163 | 3300025924 | Ga0207694_10000052 | Ga0207694_1000005234 | 313 |
| 164 | 3300025932 | Ga0207690_10002420 | Ga0207690_100024205 | 313 |
| 165 | 3300025941 | Ga0207711_10186820 | Ga0207711_101868202 | 313 |
| 166 | 3300025949 | Ga0207667_10128997 | Ga0207667_101289972 | 313 |
| 167 | 3300025986 | Ga0207658_10051660 | Ga0207658_100516602 | 313 |
| 168 | 3300026035 | Ga0207703_10001488 | Ga0207703_100014884 | 313 |
| 169 | 3300026041 | Ga0207639_10003999 | Ga0207639_100039992 | 313 |
| 170 | 3300026088 | Ga0207641_10082851 | Ga0207641_100828512 | 313 |
| 171 | 3300026116 | Ga0207674_10008539 | Ga0207674_100085394 | 313 |
| 172 | 3300032004 | Ga0307414_10203678 | Ga0307414_102036782 | 313 |
| 173 | 3300046471 | Ga0495650_0000555 | Ga0495650_0000555_31051_32079 | 313 |
| 174 | 3300048916 | Ga0496113_0311917 | Ga0496113_0311917_70_1119 | 313 |
| 175 | 3300048923 | Ga0496120_0007793 | Ga0496120_0007793_4518_5546 | 313 |
| 176 | 3300038443 | Ga0395901_0029621 | Ga0395901_0029621_413_1489 | 314 |
| 177 | 3300048903 | Ga0496100_0004281 | Ga0496100_0004281_6448_7449 | 314 |
| 178 | 3300048904 | Ga0496101_0018777 | Ga0496101_0018777_288_1289 | 314 |
| 179 | 3300005347 | Ga0070668_100136729 | Ga0070668_1001367292 | 315 |
| 180 | 3300005355 | Ga0070671_100000270 | Ga0070671_10000027023 | 315 |
| 181 | 3300025931 | Ga0207644_10027589 | Ga0207644_100275892 | 315 |
| 182 | 3300025986 | Ga0207658_10082184 | Ga0207658_100821842 | 315 |
| 183 | 3300031548 | Ga0307408_100289864 | Ga0307408_1002898642 | 315 |
| 184 | 3300031731 | Ga0307405_10112633 | Ga0307405_101126331 | 315 |
| 185 | 3300037418 | Ga0395900_0063338 | Ga0395900_0063338_1601_2650 | 315 |
| 186 | 3300038443 | Ga0395901_0305936 | Ga0395901_0305936_523_1572 | 315 |
| 187 | 3300031824 | Ga0307413_10290291 | Ga0307413_102902912 | 316 |
| 188 | 3300031995 | Ga0307409_100042115 | Ga0307409_1000421152 | 316 |
| 189 | 3300032126 | Ga0307415_100008200 | Ga0307415_1000082001 | 316 |
| 190 | 3300042007 | Ga0439449_0014819 | Ga0439449_0014819_1151_2200 | 316 |
| 191 | 3300053083 | Ga0495655_0007293 | Ga0495655_0007293_12_1031 | 316 |
| 192 | 3300031911 | Ga0307412_10179950 | Ga0307412_101799501 | 317 |
| 193 | 3300041453 | Ga0451797_1153456 | Ga0451797_1153456_841_1884 | 317 |
| 194 | 3300049574 | Ga0501038_0031943 | Ga0501038_0031943_2391_3428 | 317 |
| 195 | 3300003762 | Ga0055542_1003624 | Ga0055542_10036242 | 318 |
| 196 | 3300031548 | Ga0307408_100116354 | Ga0307408_1001163542 | 318 |
| 197 | 3300031731 | Ga0307405_10094216 | Ga0307405_100942162 | 318 |
| 198 | 3300031852 | Ga0307410_10176092 | Ga0307410_101760922 | 318 |
| 199 | 3300031911 | Ga0307412_10001498 | Ga0307412_100014987 | 318 |
| 200 | 3300037418 | Ga0395900_0381546 | Ga0395900_0381546_75_1178 | 318 |
| 201 | 3300037466 | Ga0395898_0013573 | Ga0395898_0013573_2905_4008 | 318 |
| 202 | 3300037466 | Ga0395898_0328683 | Ga0395898_0328683_311_1414 | 318 |
| 203 | 3300044658 | Ga0466972_0052051 | Ga0466972_0052051_824_1927 | 318 |
| 204 | 3300044765 | Ga0466970_0071612 | Ga0466970_0071612_140_1243 | 318 |
| 205 | 3300049569 | Ga0501032_0001293 | Ga0501032_0001293_14675_15751 | 318 |
| 206 | 3300049571 | Ga0501034_0000080 | Ga0501034_0000080_121178_122254 | 318 |
| 207 | 3300049579 | Ga0501043_0233953 | Ga0501043_0233953_121_1197 | 318 |
| 208 | 3300005548 | Ga0070665_100001599 | Ga0070665_1000015995 | 319 |
| 209 | 3300009098 | Ga0105245_10260496 | Ga0105245_102604962 | 319 |
| 210 | 3300009551 | Ga0105238_10321801 | Ga0105238_103218012 | 319 |
| 211 | 3300025735 | Ga0207713_1026361 | Ga0207713_10263612 | 319 |
| 212 | 3300030521 | Ga0307511_10000634 | Ga0307511_1000063414 | 319 |
| 213 | 3300046473 | Ga0495582_0044712 | Ga0495582_0044712_211_1260 | 319 |
| 214 | 3300046475 | Ga0495639_0013473 | Ga0495639_0013473_1078_2127 | 319 |
| 215 | 3300046528 | Ga0495642_0033770 | Ga0495642_0033770_350_1399 | 319 |
| 216 | 3300046531 | Ga0495665_0043572 | Ga0495665_0043572_495_1544 | 319 |
| 217 | 3300046535 | Ga0495586_0029503 | Ga0495586_0029503_38_1087 | 319 |
| 218 | 3300046558 | Ga0495633_0049256 | Ga0495633_0049256_846_1895 | 319 |
| 219 | 3300046615 | Ga0495656_0014477 | Ga0495656_0014477_735_1784 | 319 |
| 220 | 3300046616 | Ga0495668_0108501 | Ga0495668_0108501_408_1457 | 319 |
| 221 | 3300046674 | Ga0495588_0000879 | Ga0495588_0000879_5786_6835 | 319 |
| 222 | 3300046691 | Ga0495670_0003138 | Ga0495670_0003138_1581_2630 | 319 |
| 223 | 3300047673 | Ga0495593_0057938 | Ga0495593_0057938_341_1390 | 319 |
| 224 | 3300048905 | Ga0496102_0033364 | Ga0496102_0033364_2707_3756 | 319 |
| 225 | 3300048918 | Ga0496115_0045709 | Ga0496115_0045709_1289_2338 | 319 |
| 226 | 3300048929 | Ga0496126_0034191 | Ga0496126_0034191_1198_2226 | 319 |
| 227 | 3300006038 | Ga0075365_10060028 | Ga0075365_100600282 | 320 |
| 228 | 3300044683 | Ga0466965_0000011 | Ga0466965_0000011_1432_2487 | 320 |
| 229 | 3300048906 | Ga0496103_0247709 | Ga0496103_0247709_15_1064 | 320 |
| 230 | 3300048909 | Ga0496106_0007029 | Ga0496106_0007029_1352_2401 | 320 |
| 231 | 3300048910 | Ga0496107_0107004 | Ga0496107_0107004_82_1131 | 320 |
| 232 | 3300049589 | Ga0501073_0000050 | Ga0501073_0000050_58932_59957 | 320 |
| 233 | 3300050491 | nmdc:mga00v17_146268_c1 | nmdc:mga00v17_146268_c1_189_1217 | 320 |
| 234 | 3300003578 | Ga0006562J51391_1008978 | Ga0006562J51391_10089782 | 321 |
| 235 | 3300006038 | Ga0075365_10000610 | Ga0075365_100006102 | 321 |
| 236 | 3300006051 | Ga0075364_10087169 | Ga0075364_100871692 | 321 |
| 237 | 3300006058 | Ga0075432_10005755 | Ga0075432_100057552 | 321 |
| 238 | 3300009148 | Ga0105243_10048520 | Ga0105243_100485202 | 321 |
| 239 | 3300011119 | Ga0105246_10001461 | Ga0105246_100014613 | 321 |
| 240 | 3300025303 | Ga0209051_1045631 | Ga0209051_10456312 | 321 |
| 241 | 3300031548 | Ga0307408_100004023 | Ga0307408_1000040237 | 321 |
| 242 | 3300031852 | Ga0307410_10005325 | Ga0307410_100053255 | 321 |
| 243 | 3300031903 | Ga0307407_10005168 | Ga0307407_100051682 | 321 |
| 244 | 3300031911 | Ga0307412_10129379 | Ga0307412_101293792 | 321 |
| 245 | 3300031995 | Ga0307409_100006663 | Ga0307409_1000066635 | 321 |
| 246 | 3300032004 | Ga0307414_10182003 | Ga0307414_101820032 | 321 |
| 247 | 3300037312 | Ga0395899_0004426 | Ga0395899_0004426_1409_2500 | 321 |
| 248 | 3300037466 | Ga0395898_0033510 | Ga0395898_0033510_2414_3505 | 321 |
| 249 | 3300038443 | Ga0395901_0008965 | Ga0395901_0008965_7456_8547 | 321 |
| 250 | 3300050491 | nmdc:mga00v17_98747_c1 | nmdc:mga00v17_98747_c1_653_1681 | 321 |
| 251 | 3300050492 | nmdc:mga0yw44_47999_c1 | nmdc:mga0yw44_47999_c1_574_1602 | 321 |
| 252 | 3300053136 | Ga0500559_0001470 | Ga0500559_0001470_12079_13107 | 321 |
| 253 | iso_pu_bacteria | 2995463766 | 2995471647 | 321 |
| 254 | 3300003203 | JGI25406J46586_10000539 | JGI25406J46586_100005392 | 322 |
| 255 | 3300005985 | Ga0081539_10000023 | Ga0081539_100000235 | 322 |
| 256 | 3300009984 | Ga0105029_102556 | Ga0105029_1025561 | 322 |
| 257 | 3300013102 | Ga0157371_10081061 | Ga0157371_100810612 | 322 |
| 258 | 3300013104 | Ga0157370_10008426 | Ga0157370_100084264 | 322 |
| 259 | 3300030522 | Ga0307512_10009369 | Ga0307512_100093695 | 322 |
| 260 | 3300031911 | Ga0307412_10057668 | Ga0307412_100576682 | 322 |
| 261 | 3300049568 | Ga0501031_0158903 | Ga0501031_0158903_127_1173 | 322 |
| 262 | 3300049570 | Ga0501033_0117495 | Ga0501033_0117495_314_1360 | 322 |
| 263 | 3300049571 | Ga0501034_0109064 | Ga0501034_0109064_602_1648 | 322 |
| 264 | 3300049574 | Ga0501038_0013882 | Ga0501038_0013882_2515_3561 | 322 |
| 265 | 3300053140 | Ga0500573_0012318 | Ga0500573_0012318_2921_3937 | 322 |
| 266 | 3300031731 | Ga0307405_10161040 | Ga0307405_101610402 | 323 |
| 267 | 3300031824 | Ga0307413_10028203 | Ga0307413_100282032 | 323 |
| 268 | 3300031903 | Ga0307407_10052360 | Ga0307407_100523602 | 323 |
| 269 | 3300031995 | Ga0307409_100224685 | Ga0307409_1002246852 | 323 |
| 270 | 3300041404 | Ga0439436_0009320 | Ga0439436_0009320_534_1583 | 323 |
| 271 | 3300041405 | Ga0439438_012500 | Ga0439438_012500_1502_2551 | 323 |
| 272 | 3300041406 | Ga0439439_0022988 | Ga0439439_0022988_182_1231 | 323 |
| 273 | 3300041411 | Ga0439466_0001958 | Ga0439466_0001958_2368_3417 | 323 |
| 274 | 3300041999 | Ga0439433_0000371 | Ga0439433_0000371_2516_3565 | 323 |
| 275 | 3300042002 | Ga0439442_001380 | Ga0439442_001380_69_1118 | 323 |
| 276 | 3300042007 | Ga0439449_0000723 | Ga0439449_0000723_7968_9017 | 323 |
| 277 | 3300042014 | Ga0439457_003890 | Ga0439457_003890_1349_2398 | 323 |
| 278 | 3300053136 | Ga0500559_0001167 | Ga0500559_0001167_45_1046 | 323 |
| 279 | 3300053153 | Ga0500616_0097619 | Ga0500616_0097619_207_1235 | 323 |
| 280 | 3300031911 | Ga0307412_10015965 | Ga0307412_100159652 | 324 |
| 281 | 3300046691 | Ga0495670_0122761 | Ga0495670_0122761_86_1117 | 324 |
| 282 | iso_pu_bacteria | 2585428094 | 2587862547 | 324 |
| 283 | iso_pu_bacteria | 2643221649 | 2644279287 | 324 |
| 284 | 3300009093 | Ga0105240_10001410 | Ga0105240_1000141018 | 325 |
| 285 | 3300009174 | Ga0105241_10001937 | Ga0105241_100019372 | 325 |
| 286 | 3300009545 | Ga0105237_10166143 | Ga0105237_101661432 | 325 |
| 287 | 3300025911 | Ga0207654_10000001 | Ga0207654_1000000143 | 325 |
| 288 | 3300025913 | Ga0207695_10004401 | Ga0207695_100044017 | 325 |
| 289 | 3300031548 | Ga0307408_100046033 | Ga0307408_1000460332 | 325 |
| 290 | 3300031731 | Ga0307405_10021445 | Ga0307405_100214452 | 325 |
| 291 | 3300031824 | Ga0307413_10333433 | Ga0307413_103334331 | 325 |
| 292 | 3300031911 | Ga0307412_10191545 | Ga0307412_101915452 | 325 |
| 293 | iso_pu_bacteria | 8047710418 | 8047717601 | 325 |
| 294 | 3300031727 | Ga0316576_10014452 | Ga0316576_100144523 | 326 |
| 295 | 3300031728 | Ga0316578_10021445 | Ga0316578_100214452 | 326 |
| 296 | 3300032168 | Ga0316593_10043060 | Ga0316593_100430601 | 326 |
| 297 | 3300035398 | Ga0316574_0050619 | Ga0316574_0050619_817_1896 | 326 |
| 298 | 3300049581 | Ga0501047_0051462 | Ga0501047_0051462_2022_3053 | 326 |
| 299 | 3300049822 | Ga0501035_0041624 | Ga0501035_0041624_1574_2605 | 326 |
| 300 | iso_pu_bacteria | 2558860280 | 2559422979 | 326 |
| 301 | iso_pu_bacteria | 2816332139 | 2816511182 | 326 |
| 302 | 3300006051 | Ga0075364_10016497 | Ga0075364_100164974 | 327 |
| 303 | 3300041494 | Ga0451837_0226511 | Ga0451837_0226511_428_1450 | 327 |
| 304 | 3300041512 | Ga0451853_2071353 | Ga0451853_2071353_1251_2273 | 327 |
| 305 | 3300050491 | nmdc:mga00v17_80920_c1 | nmdc:mga00v17_80920_c1_352_1380 | 327 |
| 306 | iso_pu_bacteria | 2558860280 | 2559427837 | 327 |
| 307 | iso_pu_bacteria | 2643221553 | 2643784914 | 327 |
| 308 | iso_pu_bacteria | 2643221724 | 2644680754 | 327 |
| 309 | iso_pu_bacteria | 2728369380 | 2730230828 | 327 |
| 310 | iso_pu_bacteria | 2747842429 | 2747954608 | 327 |
| 311 | iso_pu_bacteria | 2866612099 | 2866612347 | 327 |
| 312 | iso_pu_bacteria | 2891326441 | 2891332052 | 327 |
| 313 | iso_pu_bacteria | 2946041624 | 2946045399 | 327 |
| 314 | iso_pu_bacteria | 8054472261 | 8054475887 | 327 |
| 315 | iso_pu_bacteria | 8056060235 | 8056064885 | 327 |
| 316 | 3300009551 | Ga0105238_10130657 | Ga0105238_101306573 | 328 |
| 317 | 3300025924 | Ga0207694_10148740 | Ga0207694_101487402 | 328 |
| 318 | 3300026041 | Ga0207639_10078419 | Ga0207639_100784192 | 328 |
| 319 | 3300030521 | Ga0307511_10001437 | Ga0307511_1000143719 | 328 |
| 320 | 3300041512 | Ga0451853_3819697 | Ga0451853_3819697_215_1228 | 328 |
| 321 | 3300044735 | Ga0466968_0004574 | Ga0466968_0004574_3301_4332 | 328 |
| 322 | iso_pu_bacteria | 2537561592 | 2537897511 | 328 |
| 323 | iso_pu_bacteria | 2554235227 | 2555231302 | 328 |
| 324 | iso_pu_bacteria | 2643221546 | 2643752222 | 328 |
| 325 | iso_pu_bacteria | 2643221632 | 2644183517 | 328 |
| 326 | iso_pu_bacteria | 2654587600 | 2655032966 | 328 |
| 327 | iso_pu_bacteria | 2690315906 | 2691513617 | 328 |
| 328 | iso_pu_bacteria | 2775506735 | 2775656062 | 328 |
| 329 | iso_pu_bacteria | 2808606357 | 2808830872 | 328 |
| 330 | iso_pu_bacteria | 2808606360 | 2808852073 | 328 |
| 331 | iso_pu_bacteria | 2808606366 | 2808879628 | 328 |
| 332 | iso_pu_bacteria | 2808606370 | 2808890804 | 328 |
| 333 | iso_pu_bacteria | 2808606371 | 2808896082 | 328 |
| 334 | iso_pu_bacteria | 2811994871 | 2812321575 | 328 |
| 335 | iso_pu_bacteria | 2844849076 | 2844852445 | 328 |
| 336 | iso_pu_bacteria | 2857710386 | 2857712670 | 328 |
| 337 | iso_pu_bacteria | 2857733635 | 2857734578 | 328 |
| 338 | iso_pu_bacteria | 2857740372 | 2857743833 | 328 |
| 339 | iso_pu_bacteria | 2862993130 | 2862993993 | 328 |
| 340 | iso_pu_bacteria | 2904497146 | 2904501002 | 328 |
| 341 | iso_pu_bacteria | 2904776348 | 2904777985 | 328 |
| 342 | iso_pu_bacteria | 2906799679 | 2906802460 | 328 |
| 343 | iso_pu_bacteria | 2910809715 | 2910809732 | 328 |
| 344 | iso_pu_bacteria | 2919034639 | 2919038783 | 328 |
| 345 | iso_pu_bacteria | 2919051321 | 2919051593 | 328 |
| 346 | iso_pu_bacteria | 2919059106 | 2919062898 | 328 |
| 347 | iso_pu_bacteria | 2919391150 | 2919393302 | 328 |
| 348 | iso_pu_bacteria | 2919538618 | 2919542515 | 328 |
| 349 | iso_pu_bacteria | 2932426870 | 2932430449 | 328 |
| 350 | iso_pu_bacteria | 2933418574 | 2933422245 | 328 |
| 351 | iso_pu_bacteria | 2939598168 | 2939600183 | 328 |
| 352 | iso_pu_bacteria | 2939647034 | 2939651027 | 328 |
| 353 | iso_pu_bacteria | 2939674588 | 2939674609 | 328 |
| 354 | iso_pu_bacteria | 2945916053 | 2945919441 | 328 |
| 355 | iso_pu_bacteria | 2945920336 | 2945920445 | 328 |
| 356 | iso_pu_bacteria | 2945941187 | 2945943616 | 328 |
| 357 | iso_pu_bacteria | 2945956166 | 2945958204 | 328 |
| 358 | iso_pu_bacteria | 2946024296 | 2946025876 | 328 |
| 359 | iso_pu_bacteria | 2946033335 | 2946034534 | 328 |
| 360 | iso_pu_bacteria | 2946037020 | 2946039582 | 328 |
| 361 | iso_pu_bacteria | 2946059875 | 2946063166 | 328 |
| 362 | iso_pu_bacteria | 2953998280 | 2954000814 | 328 |
| 363 | iso_pu_bacteria | 2974302888 | 2974303084 | 328 |
| 364 | iso_pu_bacteria | 8004021418 | 8004024205 | 328 |
| 365 | iso_pu_bacteria | 8004025490 | 8004025964 | 328 |
| 366 | iso_pu_bacteria | 8054107350 | 8054111844 | 328 |
| 367 | 3300025904 | Ga0207647_10033044 | Ga0207647_100330442 | 329 |
| 368 | 3300026041 | Ga0207639_10159112 | Ga0207639_101591121 | 329 |
| 369 | 3300026142 | Ga0207698_10035213 | Ga0207698_100352132 | 329 |
| 370 | 3300031727 | Ga0316576_10012344 | Ga0316576_100123442 | 329 |
| 371 | 3300036712 | Ga0316584_0141092 | Ga0316584_0141092_145_1158 | 329 |
| 372 | 3300037068 | Ga0373925_0151698 | Ga0373925_0151698_542_1549 | 329 |
| 373 | 3300044658 | Ga0466972_0063211 | Ga0466972_0063211_581_1612 | 329 |
| 374 | 3300044684 | Ga0466966_0057963 | Ga0466966_0057963_1251_2258 | 329 |
| 375 | 3300044693 | Ga0466961_0014211 | Ga0466961_0014211_524_1531 | 329 |
| 376 | 3300045049 | Ga0466959_0001223 | Ga0466959_0001223_6740_7747 | 329 |
| 377 | iso_pu_bacteria | 2643221542 | 2643732779 | 329 |
| 378 | iso_pu_bacteria | 2643221630 | 2644171569 | 329 |
| 379 | iso_pu_bacteria | 2773857759 | 2774383166 | 329 |
| 380 | iso_pu_bacteria | 2808606447 | 2809228164 | 329 |
| 381 | iso_pu_bacteria | 2808606700 | 2810363607 | 329 |
| 382 | iso_pu_bacteria | 2852632344 | 2852634876 | 329 |
| 383 | iso_pu_bacteria | 2852663356 | 2852663846 | 329 |
| 384 | iso_pu_bacteria | 2905926851 | 2905926962 | 329 |
| 385 | iso_pu_bacteria | 2946003308 | 2946004184 | 329 |
| 386 | iso_pu_bacteria | 2977251589 | 2977253344 | 329 |
| 387 | iso_pu_bacteria | 8004182704 | 8004184264 | 329 |
| 388 | 3300002773 | JGI25152J39213_1000330 | JGI25152J39213_10003306 | 331 |
| 389 | 3300005841 | Ga0068863_100006409 | Ga0068863_1000064093 | 331 |
| 390 | 3300006058 | Ga0075432_10004853 | Ga0075432_100048532 | 331 |
| 391 | 3300009036 | Ga0105244_10001314 | Ga0105244_1000131412 | 331 |
| 392 | 3300009036 | Ga0105244_10005864 | Ga0105244_100058642 | 331 |
| 393 | 3300009147 | Ga0114129_10269814 | Ga0114129_102698142 | 331 |
| 394 | 3300025245 | Ga0207425_1003685 | Ga0207425_10036854 | 331 |
| 395 | 3300025258 | Ga0209129_1000301 | Ga0209129_10003016 | 331 |
| 396 | 3300025728 | Ga0207655_1003646 | Ga0207655_10036462 | 331 |
| 397 | 3300025728 | Ga0207655_1003750 | Ga0207655_10037503 | 331 |
| 398 | 3300025909 | Ga0207705_10011820 | Ga0207705_100118202 | 331 |
| 399 | 3300027907 | Ga0207428_10002680 | Ga0207428_1000268012 | 331 |
| 400 | 3300031548 | Ga0307408_100068909 | Ga0307408_1000689092 | 331 |
| 401 | 3300031548 | Ga0307408_100240134 | Ga0307408_1002401342 | 331 |
| 402 | 3300031649 | Ga0307514_10005422 | Ga0307514_1000542212 | 331 |
| 403 | 3300031728 | Ga0316578_10083712 | Ga0316578_100837122 | 331 |
| 404 | 3300031824 | Ga0307413_10196574 | Ga0307413_101965742 | 331 |
| 405 | 3300031852 | Ga0307410_10018983 | Ga0307410_100189832 | 331 |
| 406 | 3300031901 | Ga0307406_10077982 | Ga0307406_100779822 | 331 |
| 407 | 3300031911 | Ga0307412_10237948 | Ga0307412_102379482 | 331 |
| 408 | 3300031995 | Ga0307409_100003955 | Ga0307409_1000039552 | 331 |
| 409 | 3300031995 | Ga0307409_100162562 | Ga0307409_1001625622 | 331 |
| 410 | 3300032002 | Ga0307416_100011588 | Ga0307416_1000115883 | 331 |
| 411 | 3300032002 | Ga0307416_100131275 | Ga0307416_1001312752 | 331 |
| 412 | 3300035398 | Ga0316574_0009490 | Ga0316574_0009490_1422_2501 | 331 |
| 413 | 3300037418 | Ga0395900_0056980 | Ga0395900_0056980_2419_3468 | 331 |
| 414 | 3300037418 | Ga0395900_0085759 | Ga0395900_0085759_216_1253 | 331 |
| 415 | 3300038443 | Ga0395901_0046535 | Ga0395901_0046535_3224_4273 | 331 |
| 416 | 3300038443 | Ga0395901_0343834 | Ga0395901_0343834_278_1315 | 331 |
| 417 | 3300041404 | Ga0439436_0001513 | Ga0439436_0001513_1857_2918 | 331 |
| 418 | 3300041404 | Ga0439436_0019313 | Ga0439436_0019313_778_1824 | 331 |
| 419 | 3300041406 | Ga0439439_0015676 | Ga0439439_0015676_681_1742 | 331 |
| 420 | 3300041411 | Ga0439466_0055118 | Ga0439466_0055118_33_1082 | 331 |
| 421 | 3300042002 | Ga0439442_000062 | Ga0439442_000062_16831_17877 | 331 |
| 422 | 3300042002 | Ga0439442_000404 | Ga0439442_000404_8701_9750 | 331 |
| 423 | 3300042002 | Ga0439442_004729 | Ga0439442_004729_140_1219 | 331 |
| 424 | 3300042007 | Ga0439449_0004612 | Ga0439449_0004612_4003_5052 | 331 |
| 425 | 3300042007 | Ga0439449_0025924 | Ga0439449_0025924_63_1124 | 331 |
| 426 | 3300042010 | Ga0439452_004807 | Ga0439452_004807_469_1530 | 331 |
| 427 | 3300042014 | Ga0439457_005563 | Ga0439457_005563_1934_2995 | 331 |
| 428 | 3300042122 | Ga0450920_000019 | Ga0450920_000019_1609_2655 | 331 |
| 429 | 3300042146 | Ga0450907_000193 | Ga0450907_000193_15564_16610 | 331 |
| 430 | 3300042435 | Ga0439434_0000287 | Ga0439434_0000287_6113_7159 | 331 |
| 431 | 3300042531 | Ga0450918_000625 | Ga0450918_000625_922_1968 | 331 |
| 432 | 3300044658 | Ga0466972_0008191 | Ga0466972_0008191_1852_2856 | 331 |
| 433 | 3300044683 | Ga0466965_0000329 | Ga0466965_0000329_13855_14859 | 331 |
| 434 | 3300044765 | Ga0466970_0009705 | Ga0466970_0009705_2032_3036 | 331 |
| 435 | 3300044765 | Ga0466970_0104781 | Ga0466970_0104781_165_1187 | 331 |
| 436 | 3300044842 | Ga0466957_0014479 | Ga0466957_0014479_3481_4485 | 331 |
| 437 | 3300044901 | Ga0466960_0009929 | Ga0466960_0009929_2801_3805 | 331 |
| 438 | 3300045836 | Ga0466958_0084007 | Ga0466958_0084007_858_1895 | 331 |
| 439 | 3300046472 | Ga0495580_0016068 | Ga0495580_0016068_3932_5029 | 331 |
| 440 | 3300047472 | Ga0495686_0109092 | Ga0495686_0109092_553_1581 | 331 |
| 441 | 3300048903 | Ga0496100_0243843 | Ga0496100_0243843_122_1219 | 331 |
| 442 | 3300048905 | Ga0496102_0011832 | Ga0496102_0011832_1989_3086 | 331 |
| 443 | 3300048905 | Ga0496102_0194672 | Ga0496102_0194672_528_1577 | 331 |
| 444 | 3300048906 | Ga0496103_0034406 | Ga0496103_0034406_841_1890 | 331 |
| 445 | 3300048906 | Ga0496103_0102796 | Ga0496103_0102796_568_1665 | 331 |
| 446 | 3300048909 | Ga0496106_0127431 | Ga0496106_0127431_117_1166 | 331 |
| 447 | 3300048915 | Ga0496112_0004659 | Ga0496112_0004659_3093_4190 | 331 |
| 448 | 3300048925 | Ga0496122_0006826 | Ga0496122_0006826_8782_9813 | 331 |
| 449 | 3300048926 | Ga0496123_0000363 | Ga0496123_0000363_84129_85160 | 331 |
| 450 | 3300049541 | Ga0501325_000271 | Ga0501325_000271_970_2019 | 331 |
| 451 | 3300049568 | Ga0501031_0025027 | Ga0501031_0025027_542_1585 | 331 |
| 452 | 3300049568 | Ga0501031_0027643 | Ga0501031_0027643_2512_3543 | 331 |
| 453 | 3300049569 | Ga0501032_0062602 | Ga0501032_0062602_413_1441 | 331 |
| 454 | 3300049570 | Ga0501033_0010022 | Ga0501033_0010022_1478_2509 | 331 |
| 455 | 3300049570 | Ga0501033_0253927 | Ga0501033_0253927_98_1171 | 331 |
| 456 | 3300049571 | Ga0501034_0000527 | Ga0501034_0000527_53932_54951 | 331 |
| 457 | 3300049572 | Ga0501036_0012292 | Ga0501036_0012292_1464_2495 | 331 |
| 458 | 3300049573 | Ga0501037_0002373 | Ga0501037_0002373_173_1216 | 331 |
| 459 | 3300049573 | Ga0501037_0006609 | Ga0501037_0006609_2320_3411 | 331 |
| 460 | 3300049574 | Ga0501038_0018417 | Ga0501038_0018417_4477_5508 | 331 |
| 461 | 3300049575 | Ga0501039_0013723 | Ga0501039_0013723_4846_5889 | 331 |
| 462 | 3300049575 | Ga0501039_0014163 | Ga0501039_0014163_3782_4813 | 331 |
| 463 | 3300049578 | Ga0501042_0001396 | Ga0501042_0001396_2830_3903 | 331 |
| 464 | 3300049578 | Ga0501042_0153707 | Ga0501042_0153707_401_1432 | 331 |
| 465 | 3300049579 | Ga0501043_0074250 | Ga0501043_0074250_122_1150 | 331 |
| 466 | 3300049579 | Ga0501043_0145172 | Ga0501043_0145172_131_1180 | 331 |
| 467 | 3300049580 | Ga0501046_0008849 | Ga0501046_0008849_3736_4767 | 331 |
| 468 | 3300049580 | Ga0501046_0018440 | Ga0501046_0018440_962_2005 | 331 |
| 469 | 3300049581 | Ga0501047_0027561 | Ga0501047_0027561_1448_2479 | 331 |
| 470 | 3300049581 | Ga0501047_0030136 | Ga0501047_0030136_2155_3183 | 331 |
| 471 | 3300049581 | Ga0501047_0099507 | Ga0501047_0099507_197_1270 | 331 |
| 472 | 3300049582 | Ga0501048_0006285 | Ga0501048_0006285_2641_3672 | 331 |
| 473 | 3300049586 | Ga0501070_0137147 | Ga0501070_0137147_422_1465 | 331 |
| 474 | 3300049586 | Ga0501070_0217214 | Ga0501070_0217214_508_1539 | 331 |
| 475 | 3300049590 | Ga0501074_0052514 | Ga0501074_0052514_794_1825 | 331 |
| 476 | 3300049742 | Ga0501080_0131705 | Ga0501080_0131705_1115_2146 | 331 |
| 477 | 3300049744 | Ga0501083_0000169 | Ga0501083_0000169_10734_11807 | 331 |
| 478 | 3300049744 | Ga0501083_0021463 | Ga0501083_0021463_392_1465 | 331 |
| 479 | 3300049822 | Ga0501035_0038173 | Ga0501035_0038173_2458_3489 | 331 |
| 480 | 3300049823 | Ga0501044_0001927 | Ga0501044_0001927_2079_3107 | 331 |
| 481 | 3300049823 | Ga0501044_0035771 | Ga0501044_0035771_1055_2086 | 331 |
| 482 | 3300049823 | Ga0501044_0086055 | Ga0501044_0086055_1704_2777 | 331 |
| 483 | 3300049824 | Ga0501045_0019511 | Ga0501045_0019511_1464_2507 | 331 |
| 484 | 3300050507 | nmdc:mga05p37_123326_c1 | nmdc:mga05p37_123326_c1_1062_2111 | 331 |
| 485 | 3300053140 | Ga0500573_0067987 | Ga0500573_0067987_463_1491 | 331 |
| 486 | 3300053140 | Ga0500573_0077127 | Ga0500573_0077127_79_1110 | 331 |
| 487 | 3300060353 | Ga0501082_0026260 | Ga0501082_0026260_389_1432 | 331 |
| 488 | 3300003578 | Ga0006562J51391_1016731 | Ga0006562J51391_101673118 | 332 |
| 489 | 3300049574 | Ga0501038_0002633 | Ga0501038_0002633_13480_14520 | 332 |
| 490 | 3300001976 | JGI24752J21851_1001850 | JGI24752J21851_10018501 | 333 |
| 491 | 3300002738 | JGI25154J39366_1002102 | JGI25154J39366_10021023 | 333 |
| 492 | 3300005330 | Ga0070690_100185041 | Ga0070690_1001850411 | 333 |
| 493 | 3300005334 | Ga0068869_100031519 | Ga0068869_1000315192 | 333 |
| 494 | 3300005335 | Ga0070666_10057526 | Ga0070666_100575262 | 333 |
| 495 | 3300005336 | Ga0070680_100008025 | Ga0070680_1000080256 | 333 |
| 496 | 3300005339 | Ga0070660_100020378 | Ga0070660_1000203782 | 333 |
| 497 | 3300005341 | Ga0070691_10008519 | Ga0070691_100085193 | 333 |
| 498 | 3300005345 | Ga0070692_10043748 | Ga0070692_100437482 | 333 |
| 499 | 3300005354 | Ga0070675_100140882 | Ga0070675_1001408822 | 333 |
| 500 | 3300005436 | Ga0070713_100024840 | Ga0070713_1000248403 | 333 |
| 501 | 3300005437 | Ga0070710_10143002 | Ga0070710_101430022 | 333 |
| 502 | 3300005438 | Ga0070701_10044545 | Ga0070701_100445452 | 333 |
| 503 | 3300005456 | Ga0070678_100013147 | Ga0070678_1000131473 | 333 |
| 504 | 3300005458 | Ga0070681_10134479 | Ga0070681_101344792 | 333 |
| 505 | 3300005543 | Ga0070672_100139247 | Ga0070672_1001392472 | 333 |
| 506 | 3300005544 | Ga0070686_100118879 | Ga0070686_1001188792 | 333 |
| 507 | 3300005547 | Ga0070693_100000670 | Ga0070693_1000006702 | 333 |
| 508 | 3300005548 | Ga0070665_100012514 | Ga0070665_1000125143 | 333 |
| 509 | 3300005614 | Ga0068856_100002376 | Ga0068856_10000237613 | 333 |
| 510 | 3300005616 | Ga0068852_100002668 | Ga0068852_1000026684 | 333 |
| 511 | 3300005840 | Ga0068870_10000042 | Ga0068870_1000004231 | 333 |
| 512 | 3300005841 | Ga0068863_100002067 | Ga0068863_1000020675 | 333 |
| 513 | 3300005842 | Ga0068858_100023434 | Ga0068858_1000234342 | 333 |
| 514 | 3300006058 | Ga0075432_10099178 | Ga0075432_100991781 | 333 |
| 515 | 3300006175 | Ga0070712_100051862 | Ga0070712_1000518622 | 333 |
| 516 | 3300006237 | Ga0097621_100057040 | Ga0097621_1000570402 | 333 |
| 517 | 3300006852 | Ga0075433_10049803 | Ga0075433_100498033 | 333 |
| 518 | 3300007076 | Ga0075435_100023304 | Ga0075435_1000233042 | 333 |
| 519 | 3300009036 | Ga0105244_10013919 | Ga0105244_100139192 | 333 |
| 520 | 3300009093 | Ga0105240_10345484 | Ga0105240_103454842 | 333 |
| 521 | 3300009094 | Ga0111539_10080539 | Ga0111539_100805393 | 333 |
| 522 | 3300009098 | Ga0105245_10107137 | Ga0105245_101071372 | 333 |
| 523 | 3300009101 | Ga0105247_10020123 | Ga0105247_100201233 | 333 |
| 524 | 3300009147 | Ga0114129_10082833 | Ga0114129_100828333 | 333 |
| 525 | 3300009174 | Ga0105241_10028375 | Ga0105241_100283752 | 333 |
| 526 | 3300009176 | Ga0105242_10339933 | Ga0105242_103399332 | 333 |
| 527 | 3300009553 | Ga0105249_10323081 | Ga0105249_103230812 | 333 |
| 528 | 3300011119 | Ga0105246_10001123 | Ga0105246_100011232 | 333 |
| 529 | 3300013250 | Ga0171462_1004 | Ga0171462_1004546 | 333 |
| 530 | 3300013296 | Ga0157374_10031073 | Ga0157374_100310732 | 333 |
| 531 | 3300013306 | Ga0163162_10523489 | Ga0163162_105234891 | 333 |
| 532 | 3300014326 | Ga0157380_10091931 | Ga0157380_100919312 | 333 |
| 533 | 3300014745 | Ga0157377_10001575 | Ga0157377_100015752 | 333 |
| 534 | 3300017792 | Ga0163161_10242682 | Ga0163161_102426822 | 333 |
| 535 | 3300020070 | Ga0206356_11422413 | Ga0206356_114224133 | 333 |
| 536 | 3300025246 | Ga0209646_1000014 | Ga0209646_1000014302 | 333 |
| 537 | 3300025321 | Ga0207656_10005038 | Ga0207656_100050382 | 333 |
| 538 | 3300025901 | Ga0207688_10029131 | Ga0207688_100291313 | 333 |
| 539 | 3300025903 | Ga0207680_10103779 | Ga0207680_101037792 | 333 |
| 540 | 3300025907 | Ga0207645_10041558 | Ga0207645_100415582 | 333 |
| 541 | 3300025908 | Ga0207643_10000232 | Ga0207643_1000023231 | 333 |
| 542 | 3300025912 | Ga0207707_10095155 | Ga0207707_100951552 | 333 |
| 543 | 3300025914 | Ga0207671_10019773 | Ga0207671_100197735 | 333 |
| 544 | 3300025916 | Ga0207663_10030531 | Ga0207663_100305313 | 333 |
| 545 | 3300025918 | Ga0207662_10053216 | Ga0207662_100532162 | 333 |
| 546 | 3300025920 | Ga0207649_10066230 | Ga0207649_100662302 | 333 |
| 547 | 3300025925 | Ga0207650_10004300 | Ga0207650_100043006 | 333 |
| 548 | 3300025926 | Ga0207659_10030587 | Ga0207659_100305873 | 333 |
| 549 | 3300025928 | Ga0207700_10004672 | Ga0207700_100046722 | 333 |
| 550 | 3300025931 | Ga0207644_10013662 | Ga0207644_100136623 | 333 |
| 551 | 3300025934 | Ga0207686_10247751 | Ga0207686_102477512 | 333 |
| 552 | 3300025940 | Ga0207691_10114867 | Ga0207691_101148673 | 333 |
| 553 | 3300025941 | Ga0207711_10132717 | Ga0207711_101327172 | 333 |
| 554 | 3300025942 | Ga0207689_10001645 | Ga0207689_1000164513 | 333 |
| 555 | 3300025945 | Ga0207679_10005712 | Ga0207679_100057124 | 333 |
| 556 | 3300025981 | Ga0207640_10011755 | Ga0207640_100117553 | 333 |
| 557 | 3300026023 | Ga0207677_10018978 | Ga0207677_100189782 | 333 |
| 558 | 3300026067 | Ga0207678_10000474 | Ga0207678_1000047431 | 333 |
| 559 | 3300026075 | Ga0207708_10013253 | Ga0207708_100132533 | 333 |
| 560 | 3300026078 | Ga0207702_10006935 | Ga0207702_100069356 | 333 |
| 561 | 3300026078 | Ga0207702_10012603 | Ga0207702_100126032 | 333 |
| 562 | 3300026095 | Ga0207676_10004942 | Ga0207676_100049426 | 333 |
| 563 | 3300026116 | Ga0207674_10138128 | Ga0207674_101381281 | 333 |
| 564 | 3300026121 | Ga0207683_10037590 | Ga0207683_100375903 | 333 |
| 565 | 3300026142 | Ga0207698_10033840 | Ga0207698_100338402 | 333 |
| 566 | 3300027907 | Ga0207428_10011068 | Ga0207428_100110683 | 333 |
| 567 | 3300028379 | Ga0268266_10264309 | Ga0268266_102643092 | 333 |
| 568 | 3300031901 | Ga0307406_10000136 | Ga0307406_100001362 | 333 |
| 569 | 3300031901 | Ga0307406_10000222 | Ga0307406_1000022224 | 333 |
| 570 | 3300031901 | Ga0307406_10030755 | Ga0307406_100307552 | 333 |
| 571 | 3300032004 | Ga0307414_10203329 | Ga0307414_102033291 | 333 |
| 572 | 3300042005 | Ga0439448_0011579 | Ga0439448_0011579_1394_2395 | 333 |
| 573 | 3300042142 | Ga0450905_005650 | Ga0450905_005650_457_1458 | 333 |
| 574 | 3300042157 | Ga0439458_0022318 | Ga0439458_0022318_405_1406 | 333 |
| 575 | 3300042439 | Ga0439464_0026108 | Ga0439464_0026108_124_1125 | 333 |
| 576 | 3300046453 | Ga0495627_000642 | Ga0495627_000642_20974_22002 | 333 |
| 577 | 3300048906 | Ga0496103_0034371 | Ga0496103_0034371_2065_3066 | 333 |
| 578 | 3300048906 | Ga0496103_0052109 | Ga0496103_0052109_1004_2038 | 333 |
| 579 | 3300048907 | Ga0496104_0005550 | Ga0496104_0005550_1931_2932 | 333 |
| 580 | 3300048908 | Ga0496105_0065665 | Ga0496105_0065665_260_1294 | 333 |
| 581 | 3300048910 | Ga0496107_0035550 | Ga0496107_0035550_799_1800 | 333 |
| 582 | 3300048910 | Ga0496107_0041565 | Ga0496107_0041565_516_1550 | 333 |
| 583 | 3300048911 | Ga0496108_0068817 | Ga0496108_0068817_1259_2293 | 333 |
| 584 | 3300048911 | Ga0496108_0149580 | Ga0496108_0149580_187_1188 | 333 |
| 585 | 3300048912 | Ga0496109_0001855 | Ga0496109_0001855_9937_10938 | 333 |
| 586 | 3300048913 | Ga0496110_0005637 | Ga0496110_0005637_8210_9211 | 333 |
| 587 | 3300048913 | Ga0496110_0023571 | Ga0496110_0023571_2941_3975 | 333 |
| 588 | 3300048914 | Ga0496111_0001410 | Ga0496111_0001410_10357_11358 | 333 |
| 589 | 3300048914 | Ga0496111_0059797 | Ga0496111_0059797_941_1975 | 333 |
| 590 | 3300048916 | Ga0496113_0094358 | Ga0496113_0094358_1135_2136 | 333 |
| 591 | 3300048918 | Ga0496115_0011845 | Ga0496115_0011845_1233_2267 | 333 |
| 592 | 3300048920 | Ga0496117_0015229 | Ga0496117_0015229_3816_4844 | 333 |
| 593 | 3300048921 | Ga0496118_0019129 | Ga0496118_0019129_307_1335 | 333 |
| 594 | 3300048928 | Ga0496125_0011795 | Ga0496125_0011795_2048_3076 | 333 |
| 595 | 3300048929 | Ga0496126_0009535 | Ga0496126_0009535_4244_5272 | 333 |
| 596 | 3300048929 | Ga0496126_0036340 | Ga0496126_0036340_1636_2664 | 333 |
| 597 | 3300050507 | nmdc:mga05p37_442473_c1 | nmdc:mga05p37_442473_c1_199_1200 | 333 |
| 598 | 3300050510 | nmdc:mga06r32_70588_c1 | nmdc:mga06r32_70588_c1_1662_2663 | 333 |
| 599 | 3300050513 | nmdc:mga0rr50_3408_c1 | nmdc:mga0rr50_3408_c1_25_1026 | 333 |
| 600 | 3300050515 | nmdc:mga0a205_20264_c1 | nmdc:mga0a205_20264_c1_2539_3540 | 333 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8b4o-assembly1.cif.gz_B | cryo-em structure of cytochrome bd oxidase from c. glutamicum | 0.957 | 1 | 325 |
| 7nkz-assembly1.cif.gz_B | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.9565 | 1 | 328 |
| 7d5i-assembly1.cif.gz_B | structure of mycobacterium smegmatis bd complex in the apo-form. | 0.9514 | 1 | 333 |
| 7d5i-assembly1.cif.gz_B | structure of mycobacterium smegmatis bd complex in the apo-form. | 0.9486 | 1 | 333 |
| 8b4o-assembly1.cif.gz_B | cryo-em structure of cytochrome bd oxidase from c. glutamicum | 0.9401 | 1 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6U466_3_118_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.6665 | 166 | 264 | 1.20.120.290 |
| 2vpwG00 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.6518 | 16 | 267 | 1.20.1630.10 |
| af_Q9SSA5_113_219_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.6178 | 170 | 269 | 1.20.120.290 |
| af_Q9XI73_53_190_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.6162 | 150 | 268 | 1.20.120.290 |
| af_I1N5T2_121_227_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.6095 | 170 | 269 | 1.20.120.290 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1I4I5E2-F1-model_v4 | Cytochrome bd-I ubiquinol oxidase subunit 2 apoprotein | 0.9778 | 1 | 332 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0046872 GO:0070069 |
| AF-A0A3D1JH25-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II | 0.9773 | 1 | 326 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0046872 GO:0070069 |
| AF-A0A4Q2M8U1-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) | 0.9759 | 1 | 329 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0046872 GO:0070069 |
| AF-A0A2N3S2X2-F1-model_v4 | deleted | 0.9756 | 1 | 328 |
|
| AF-A0A840IDQ1-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) | 0.9752 | 1 | 331 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0046872 GO:0070069 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar