F468006

General Info

Members Datasets Scaffolds Average Seq Length
600 196 1200 134

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0381445|Ga0451576_0381445_256_705
Length 149
Sequence VTFEIFNPESLGAPRGWNHGMLAPAGGRVLFVAGQIGLETGEPGGAPTASRGFAEQFGVALDHVLAVIRAAGGGPGDLARMTVFVTDLAAYRAARPALGEAWRARFGRHYPAMALVEVRGLVDAGALVEIEATAVLPPAREQARGGTKA

Samples

Sample ID Description Type Environment
1 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
122 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
123 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
128 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
131 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
136 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
137 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
140 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
193 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.83
Nodule 0
Rhizoplane 0.33
Rhizosphere 98.67
Stem 0
Stem Tuber 0
Unclassified 10

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451576_0381445 3300045051 Bacteria 1477
2 JGI25406J46586_10018103 3300003203 Bacteria 2899
3 rootH2_10223558 3300003320 Bacteria 2483
4 JGI26129J50193_1001872 3300003349 Bacteria 1460
5 Ga0065715_11068227 3300005293 Bacteria 528
6 Ga0065707_10215261 3300005295 Bacteria 1247
7 Ga0065707_10271891 3300005295 Bacteria 1069
8 Ga0065707_10412389 3300005295 Unclassified 840
9 Ga0070658_11642092 3300005327 Bacteria 557
10 Ga0070690_100076059 3300005330 Bacteria 2189
11 Ga0068869_100428785 3300005334 Bacteria 1092
12 Ga0068869_100466499 3300005334 Unclassified 1049
13 Ga0070680_100002304 3300005336 Bacteria 14109
14 Ga0070680_100019286 3300005336 Bacteria 5404
15 Ga0070680_100343730 3300005336 Bacteria 1268
16 Ga0070680_100367514 3300005336 Bacteria 1224
17 Ga0070660_100010714 3300005339 Bacteria 6487
18 Ga0070691_10060825 3300005341 Bacteria 1816
19 Ga0070691_10129083 3300005341 Unclassified 1279
20 Ga0070691_10954390 3300005341 Bacteria 532
21 Ga0070668_101151616 3300005347 Bacteria 701
22 Ga0070669_100884959 3300005353 Bacteria 762
23 Ga0070688_100304537 3300005365 Bacteria 1153
24 Ga0070703_10023008 3300005406 Bacteria 1832
25 Ga0070701_10091232 3300005438 Bacteria 1670
26 Ga0070701_10383838 3300005438 Bacteria 886
27 Ga0070705_100009456 3300005440 Bacteria 4848
28 Ga0070705_100126527 3300005440 Bacteria 1660
29 Ga0070705_101068419 3300005440 Bacteria 659
30 Ga0070700_100270789 3300005441 Bacteria 1227
31 Ga0070694_100003675 3300005444 Bacteria 9152
32 Ga0070694_100004428 3300005444 Bacteria 8449
33 Ga0070694_100013693 3300005444 Bacteria 5069
34 Ga0070694_100029975 3300005444 Bacteria 3555
35 Ga0070694_100235080 3300005444 Bacteria 1380
36 Ga0070708_100023978 3300005445 Bacteria 5195
37 Ga0070708_100032116 3300005445 Bacteria 4551
38 Ga0070708_100036362 3300005445 Bacteria 4295
39 Ga0070708_100103869 3300005445 Bacteria 2605
40 Ga0070708_100323245 3300005445 Bacteria 1453
41 Ga0070708_101247045 3300005445 Bacteria 695
42 Ga0070681_10621142 3300005458 Bacteria 995
43 Ga0070706_100008264 3300005467 Bacteria 9706
44 Ga0070706_100169944 3300005467 Bacteria 2035
45 Ga0070706_100250267 3300005467 Bacteria 1654
46 Ga0070706_100327005 3300005467 Bacteria 1430
47 Ga0070706_100690965 3300005467 Bacteria 946
48 Ga0070706_100984537 3300005467 Bacteria 778
49 Ga0070706_101392707 3300005467 Bacteria 642
50 Ga0070707_100024295 3300005468 Bacteria 5738
51 Ga0070707_100065134 3300005468 Bacteria 3500
52 Ga0070707_100091828 3300005468 Bacteria 2939
53 Ga0070707_100134190 3300005468 Bacteria 2408
54 Ga0070707_100150653 3300005468 Bacteria 2265
55 Ga0070707_100296181 3300005468 Bacteria 1572
56 Ga0070707_100457203 3300005468 Bacteria 1237
57 Ga0070698_100282421 3300005471 Bacteria 1591
58 Ga0070698_100304661 3300005471 Bacteria 1524
59 Ga0070698_100305223 3300005471 Bacteria 1522
60 Ga0070698_100801160 3300005471 Bacteria 886
61 Ga0070699_100005397 3300005518 Bacteria 11213
62 Ga0070699_100049208 3300005518 Bacteria 3648
63 Ga0070699_100084184 3300005518 Bacteria 2775
64 Ga0070699_100272967 3300005518 Bacteria 1514
65 Ga0070699_100292173 3300005518 Bacteria 1461
66 Ga0070699_100464299 3300005518 Bacteria 1148
67 Ga0070679_100000007 3300005530 Bacteria 195373
68 Ga0070679_100134649 3300005530 Bacteria 2452
69 Ga0070697_100019106 3300005536 Bacteria 5409
70 Ga0070697_100145134 3300005536 Bacteria 1997
71 Ga0070697_100189362 3300005536 Bacteria 1746
72 Ga0070697_100644845 3300005536 Bacteria 932
73 Ga0070697_100887978 3300005536 Bacteria 791
74 Ga0068853_100179770 3300005539 Bacteria 1918
75 Ga0070686_100192150 3300005544 Bacteria 1458
76 Ga0070686_100349323 3300005544 Bacteria 1111
77 Ga0070695_100002162 3300005545 Bacteria 11264
78 Ga0070695_100029057 3300005545 Bacteria 3433
79 Ga0070695_100042721 3300005545 Bacteria 2879
80 Ga0070695_100043033 3300005545 Bacteria 2870
81 Ga0070695_100440074 3300005545 Bacteria 997
82 Ga0070696_100000167 3300005546 Bacteria 37261
83 Ga0070696_100076025 3300005546 Bacteria 2370
84 Ga0070696_100098613 3300005546 Bacteria 2090
85 Ga0070696_100122376 3300005546 Bacteria 1884
86 Ga0070693_100457255 3300005547 Bacteria 897
87 Ga0070704_100003146 3300005549 Bacteria 9418
88 Ga0070704_100020602 3300005549 Bacteria 4256
89 Ga0070704_100024333 3300005549 Bacteria 3972
90 Ga0070704_100036039 3300005549 Bacteria 3367
91 Ga0070704_100188316 3300005549 Archaea 1657
92 Ga0070704_100682017 3300005549 Unclassified 910
93 Ga0070704_101089223 3300005549 Bacteria 725
94 Ga0070664_102261999 3300005564 Bacteria 516
95 Ga0070702_100075386 3300005615 Bacteria 2004
96 Ga0068859_100055090 3300005617 Bacteria 4001
97 Ga0068859_100080793 3300005617 Bacteria 3292
98 Ga0068859_100468110 3300005617 Bacteria 1356
99 Ga0068859_100926117 3300005617 Bacteria 955
100 Ga0068866_10723804 3300005718 Bacteria 685
101 Ga0068861_100100335 3300005719 Bacteria 2301
102 Ga0068861_100191021 3300005719 Bacteria 1712
103 Ga0068863_100820796 3300005841 Bacteria 928
104 Ga0068858_100759983 3300005842 Bacteria 945
105 Ga0068860_100145854 3300005843 Archaea 2277
106 Ga0068862_100048842 3300005844 Bacteria 3613
107 Ga0068862_100053274 3300005844 Bacteria 3463
108 Ga0081455_10234149 3300005937 Bacteria 1353
109 Ga0081455_10280677 3300005937 Bacteria 1203
110 Ga0081539_10000266 3300005985 Bacteria 119926
111 Ga0075363_100697651 3300006048 Bacteria 613
112 Ga0075432_10087621 3300006058 Bacteria 1136
113 Ga0070716_100251655 3300006173 Bacteria 1204
114 Ga0070716_100321171 3300006173 Bacteria 1085
115 Ga0075366_10580475 3300006195 Bacteria 695
116 Ga0075428_100000159 3300006844 Bacteria 61724
117 Ga0075428_100021332 3300006844 Bacteria 7172
118 Ga0075428_100134058 3300006844 Bacteria 2693
119 Ga0075428_100150637 3300006844 Bacteria 2527
120 Ga0075428_100198524 3300006844 Bacteria 2169
121 Ga0075428_100307570 3300006844 Bacteria 1704
122 Ga0075428_100552534 3300006844 Bacteria 1231
123 Ga0075428_100998257 3300006844 Unclassified 886
124 Ga0075428_101696017 3300006844 Bacteria 659
125 Ga0075430_100000022 3300006846 Bacteria 81752
126 Ga0075430_100000109 3300006846 Bacteria 49248
127 Ga0075430_100123576 3300006846 Bacteria 2157
128 Ga0075430_100232067 3300006846 Bacteria 1530
129 Ga0075430_100507793 3300006846 Unclassified 995
130 Ga0075430_100557645 3300006846 Unclassified 945
131 Ga0075430_101161488 3300006846 Bacteria 636
132 Ga0075431_100003363 3300006847 Bacteria 15503
133 Ga0075431_100006550 3300006847 Bacteria 11568
134 Ga0075431_100013613 3300006847 Bacteria 8220
135 Ga0075431_100098058 3300006847 Bacteria 3026
136 Ga0075431_100281740 3300006847 Bacteria 1683
137 Ga0075431_100503928 3300006847 Bacteria 1201
138 Ga0075431_100636323 3300006847 Bacteria 1048
139 Ga0075433_10000099 3300006852 Bacteria 41634
140 Ga0075433_10007920 3300006852 Bacteria 8454
141 Ga0075433_10012685 3300006852 Bacteria 6819
142 Ga0075433_10029924 3300006852 Bacteria 4643
143 Ga0075433_10033104 3300006852 Bacteria 4429
144 Ga0075433_10171694 3300006852 Bacteria 1929
145 Ga0075433_10252739 3300006852 Bacteria 1564
146 Ga0075433_10280513 3300006852 Bacteria 1476
147 Ga0075433_10343122 3300006852 Bacteria 1320
148 Ga0075433_10413870 3300006852 Bacteria 1189
149 Ga0075433_10489125 3300006852 Bacteria 1083
150 Ga0075433_11262204 3300006852 Unclassified 640
151 Ga0075433_11933269 3300006852 Unclassified 506
152 Ga0075434_100003252 3300006871 Bacteria 14513
153 Ga0075434_100044965 3300006871 Bacteria 4380
154 Ga0075434_100058530 3300006871 Bacteria 3830
155 Ga0075434_100113201 3300006871 Bacteria 2725
156 Ga0075434_100265563 3300006871 Bacteria 1735
157 Ga0075434_100604139 3300006871 Bacteria 1116
158 Ga0075434_100810902 3300006871 Bacteria 952
159 Ga0075434_101091242 3300006871 Bacteria 811
160 Ga0075434_101189446 3300006871 Bacteria 774
161 Ga0075434_101524126 3300006871 Bacteria 677
162 Ga0075429_100000072 3300006880 Bacteria 50828
163 Ga0075429_100005479 3300006880 Bacteria 10932
164 Ga0075429_100037361 3300006880 Bacteria 4227
165 Ga0075429_100050167 3300006880 Bacteria 3631
166 Ga0075429_100147598 3300006880 Bacteria 2058
167 Ga0075429_100362529 3300006880 Bacteria 1269
168 Ga0075429_100430364 3300006880 Bacteria 1156
169 Ga0075429_100501351 3300006880 Bacteria 1064
170 Ga0075429_101016457 3300006880 Bacteria 725
171 Ga0068865_101020115 3300006881 Unclassified 725
172 Ga0075436_100002534 3300006914 Bacteria 12573
173 Ga0075436_100028598 3300006914 Bacteria 3834
174 Ga0075436_100080065 3300006914 Bacteria 2263
175 Ga0075436_100235224 3300006914 Bacteria 1302
176 Ga0075436_100245342 3300006914 Bacteria 1274
177 Ga0075436_100756156 3300006914 Bacteria 722
178 Ga0097620_100055090 3300006931 Bacteria 4001
179 Ga0097620_100080797 3300006931 Bacteria 3292
180 Ga0097620_100468062 3300006931 Bacteria 1356
181 Ga0097620_100926106 3300006931 Bacteria 955
182 Ga0075435_100002792 3300007076 Bacteria 11669
183 Ga0075435_100014335 3300007076 Bacteria 5921
184 Ga0075435_100487122 3300007076 Unclassified 1065
185 Ga0075435_100506703 3300007076 Bacteria 1044
186 Ga0075435_100607701 3300007076 Bacteria 948
187 Ga0075435_100618522 3300007076 Unclassified 940
188 Ga0075435_100754649 3300007076 Bacteria 846
189 Ga0075435_101957021 3300007076 Bacteria 515
190 Ga0099794_10004513 3300007265 Bacteria 5482
191 Ga0099794_10098027 3300007265 Bacteria 1461
192 Ga0099794_10105163 3300007265 Unclassified 1411
193 Ga0099794_10112980 3300007265 Unclassified 1362
194 Ga0099794_10165307 3300007265 Bacteria 1126
195 Ga0099794_10341591 3300007265 Bacteria 778
196 Ga0099795_10203528 3300007788 Unclassified 836
197 Ga0105251_10090342 3300009011 Bacteria 1407
198 Ga0111539_10000304 3300009094 Bacteria 59789
199 Ga0111539_10054899 3300009094 Bacteria 4738
200 Ga0111539_10258815 3300009094 Bacteria 2026
201 Ga0111539_11587214 3300009094 Bacteria 759
202 Ga0114129_10002074 3300009147 Bacteria 27554
203 Ga0114129_10003289 3300009147 Bacteria 22695
204 Ga0114129_10007967 3300009147 Bacteria 15083
205 Ga0114129_10015873 3300009147 Bacteria 10710
206 Ga0114129_10024647 3300009147 Bacteria 8526
207 Ga0114129_10040530 3300009147 Bacteria 6565
208 Ga0114129_10047957 3300009147 Bacteria 6001
209 Ga0114129_10058710 3300009147 Bacteria 5381
210 Ga0114129_10070363 3300009147 Bacteria 4879
211 Ga0114129_10183870 3300009147 Bacteria 2842
212 Ga0114129_10327205 3300009147 Bacteria 2036
213 Ga0114129_10455020 3300009147 Bacteria 1678
214 Ga0114129_10502961 3300009147 Bacteria 1583
215 Ga0114129_10533058 3300009147 Bacteria 1529
216 Ga0114129_11014322 3300009147 Bacteria 1044
217 Ga0114129_11104119 3300009147 Bacteria 993
218 Ga0114129_11138525 3300009147 Bacteria 975
219 Ga0114129_11462507 3300009147 Bacteria 841
220 Ga0114129_13364534 3300009147 Bacteria 515
221 Ga0105243_10429406 3300009148 Bacteria 1235
222 Ga0105243_10472014 3300009148 Bacteria 1182
223 Ga0105241_10645888 3300009174 Bacteria 960
224 Ga0105248_10054366 3300009177 Bacteria 4490
225 Ga0105248_11790242 3300009177 Bacteria 696
226 Ga0105249_10012603 3300009553 Bacteria 7455
227 Ga0105249_10186232 3300009553 Bacteria 2023
228 Ga0105249_11142520 3300009553 Unclassified 849
229 Ga0105249_12148035 3300009553 Unclassified 631
230 Ga0099796_10161086 3300010159 Bacteria 889
231 Ga0099796_10397759 3300010159 Unclassified 603
232 Ga0163162_10242263 3300013306 Bacteria 1934
233 Ga0157372_10234484 3300013307 Bacteria 2128
234 Ga0157380_11772093 3300014326 Bacteria 676
235 Ga0182008_10034814 3300014497 Bacteria 2524
236 Ga0157377_10721452 3300014745 Bacteria 726
237 Ga0157379_10814169 3300014968 Bacteria 882
238 Ga0207653_10000067 3300025885 Bacteria 79276
239 Ga0207642_10159354 3300025899 Bacteria 1210
240 Ga0207642_10380019 3300025899 Bacteria 840
241 Ga0207684_10037332 3300025910 Bacteria 4122
242 Ga0207684_10111441 3300025910 Bacteria 2342
243 Ga0207684_10169946 3300025910 Bacteria 1879
244 Ga0207684_10183190 3300025910 Bacteria 1806
245 Ga0207684_10930472 3300025910 Bacteria 730
246 Ga0207707_10219823 3300025912 Bacteria 1654
247 Ga0207660_10004701 3300025917 Bacteria 8887
248 Ga0207660_10021061 3300025917 Bacteria 4381
249 Ga0207660_10103602 3300025917 Bacteria 2129
250 Ga0207662_10048756 3300025918 Bacteria 2510
251 Ga0207657_10015494 3300025919 Bacteria 7385
252 Ga0207652_10000001 3300025921 Bacteria 1006643
253 Ga0207652_10112596 3300025921 Bacteria 2415
254 Ga0207646_10009742 3300025922 Bacteria 9465
255 Ga0207646_10054934 3300025922 Bacteria 3562
256 Ga0207646_10097558 3300025922 Bacteria 2633
257 Ga0207646_10212583 3300025922 Bacteria 1747
258 Ga0207646_11113956 3300025922 Bacteria 694
259 Ga0207646_11512048 3300025922 Bacteria 581
260 Ga0207681_10817230 3300025923 Bacteria 779
261 Ga0207706_10169706 3300025933 Bacteria 1917
262 Ga0207670_10139277 3300025936 Bacteria 1787
263 Ga0207704_11651477 3300025938 Unclassified 551
264 Ga0207665_10198501 3300025939 Bacteria 1461
265 Ga0207665_10332003 3300025939 Bacteria 1144
266 Ga0207711_10013396 3300025941 Bacteria 6813
267 Ga0207711_11548807 3300025941 Bacteria 606
268 Ga0207711_11627445 3300025941 Unclassified 589
269 Ga0207689_11458291 3300025942 Unclassified 572
270 Ga0207679_11286574 3300025945 Bacteria 671
271 Ga0207651_11092015 3300025960 Bacteria 715
272 Ga0207712_10025095 3300025961 Bacteria 3957
273 Ga0207712_10094414 3300025961 Bacteria 2209
274 Ga0207712_11377384 3300025961 Unclassified 631
275 Ga0207703_10574869 3300026035 Bacteria 1064
276 Ga0207639_12219858 3300026041 Bacteria 510
277 Ga0207648_10459440 3300026089 Bacteria 1160
278 Ga0207675_100167316 3300026118 Bacteria 2100
279 Ga0209996_1001928 3300027395 Bacteria 2550
280 Ga0210000_1002113 3300027462 Bacteria 2818
281 Ga0209995_1009639 3300027471 Bacteria 1563
282 Ga0209968_1000361 3300027526 Bacteria 7527
283 Ga0209999_1003528 3300027543 Bacteria 2802
284 Ga0209982_1029332 3300027552 Bacteria 863
285 Ga0209983_1000741 3300027665 Bacteria 7078
286 Ga0209588_1008222 3300027671 Bacteria 3087
287 Ga0209971_1000896 3300027682 Bacteria 7673
288 Ga0209966_1000175 3300027695 Bacteria 26253
289 Ga0209998_10000034 3300027717 Bacteria 57626
290 Ga0209974_10002298 3300027876 Bacteria 6942
291 Ga0207428_10000009 3300027907 Bacteria 410565
292 Ga0268265_10074641 3300028380 Bacteria 2654
293 Ga0268264_10708773 3300028381 Bacteria 1000
294 Ga0265330_10271398 3300031235 Bacteria 715
295 Ga0307408_100007927 3300031548 Bacteria 7023
296 Ga0307405_10044165 3300031731 Bacteria 2724
297 Ga0307413_10816119 3300031824 Bacteria 785
298 Ga0307412_10204747 3300031911 Bacteria 1501
299 Ga0307416_100005944 3300032002 Bacteria 7584
300 Ga0307411_10055400 3300032005 Bacteria 2608
301 Ga0307415_100142375 3300032126 Bacteria 1833
302 Ga0373930_0011016 3300034816 Bacteria 1626
303 Ga0373948_0144658 3300034817 Bacteria 590
304 Ga0373940_0048759 3300035088 Bacteria 1184
305 Ga0373949_0103279 3300035090 Bacteria 783
306 Ga0373932_0006663 3300035112 Bacteria 2737
307 Ga0373932_0122004 3300035112 Bacteria 870
308 Ga0373942_0039217 3300035207 Bacteria 1287
309 Ga0373942_0111069 3300035207 Bacteria 848
310 Ga0373962_0001325 3300035242 Bacteria 5826
311 Ga0373931_0038512 3300035691 Bacteria 2501
312 Ga0373931_1165322 3300035691 Bacteria 527
313 Ga0395899_0061213 3300037312 Bacteria 2772
314 Ga0395899_0089954 3300037312 Bacteria 2226
315 Ga0395899_0132270 3300037312 Bacteria 1780
316 Ga0395899_0264387 3300037312 Bacteria 1175
317 Ga0395899_0777719 3300037312 Bacteria 593
318 Ga0395900_0054566 3300037418 Bacteria 4114
319 Ga0395900_0066796 3300037418 Bacteria 3695
320 Ga0395900_0126298 3300037418 Bacteria 2623
321 Ga0395900_0173142 3300037418 Bacteria 2196
322 Ga0395900_0233568 3300037418 Bacteria 1848
323 Ga0395900_0242010 3300037418 Bacteria 1809
324 Ga0395900_0482824 3300037418 Bacteria 1191
325 Ga0395900_0863919 3300037418 Bacteria 830
326 Ga0395900_0955004 3300037418 Bacteria 778
327 Ga0395900_1067921 3300037418 Unclassified 725
328 Ga0395898_0003914 3300037466 Bacteria 16440
329 Ga0395898_0018875 3300037466 Bacteria 7026
330 Ga0395898_0070563 3300037466 Bacteria 3377
331 Ga0395898_0086770 3300037466 Bacteria 3015
332 Ga0395898_0224131 3300037466 Bacteria 1793
333 Ga0395898_0551745 3300037466 Bacteria 1094
334 Ga0395898_0912264 3300037466 Bacteria 816
335 Ga0395905_0053514 3300037471 Bacteria 3777
336 Ga0395905_0089829 3300037471 Bacteria 2879
337 Ga0395905_0185671 3300037471 Bacteria 1951
338 Ga0395905_0187857 3300037471 Bacteria 1939
339 Ga0395905_0234245 3300037471 Bacteria 1716
340 Ga0395905_0234987 3300037471 Bacteria 1713
341 Ga0395905_0335534 3300037471 Bacteria 1402
342 Ga0395905_0549804 3300037471 Bacteria 1056
343 Ga0395905_0580353 3300037471 Bacteria 1022
344 Ga0395905_0621195 3300037471 Bacteria 982
345 Ga0395905_0684003 3300037471 Bacteria 928
346 Ga0395905_0741009 3300037471 Unclassified 885
347 Ga0395901_0002219 3300038443 Bacteria 19813
348 Ga0395901_0007837 3300038443 Bacteria 10780
349 Ga0395901_0015295 3300038443 Bacteria 7808
350 Ga0395901_0023405 3300038443 Bacteria 6332
351 Ga0395901_0108539 3300038443 Bacteria 2913
352 Ga0395901_0114651 3300038443 Bacteria 2830
353 Ga0395901_0372156 3300038443 Bacteria 1471
354 Ga0395901_0762653 3300038443 Bacteria 959
355 Ga0395901_0970221 3300038443 Bacteria 827
356 Ga0450892_034928 3300042130 Bacteria 538
357 Ga0450889_024535 3300042144 Unclassified 683
358 Ga0439460_0044104 3300042461 Bacteria 1319
359 Ga0451577_0636708 3300042876 Bacteria 967
360 Ga0451577_1163025 3300042876 Bacteria 689
361 Ga0451577_1750521 3300042876 Bacteria 546
362 Ga0439440_0170342 3300042993 Bacteria 633
363 Ga0466968_0687624 3300044735 Bacteria 522
364 Ga0451576_0063178 3300045051 Bacteria 3859
365 Ga0451576_0201392 3300045051 Bacteria 2079
366 Ga0451576_0214831 3300045051 Bacteria 2008
367 Ga0451576_0279835 3300045051 Bacteria 1744
368 Ga0451576_0404403 3300045051 Bacteria 1431
369 Ga0451576_1254370 3300045051 Bacteria 773
370 Ga0451576_1497861 3300045051 Bacteria 701
371 Ga0466967_1640873 3300045976 Bacteria 640
372 Ga0495590_0219319 3300046457 Bacteria 702
373 Ga0495580_0211288 3300046472 Bacteria 1335
374 Ga0495621_0005895 3300046539 Bacteria 3548
375 Ga0495659_0019177 3300046664 Bacteria 2287
376 Ga0495659_0081187 3300046664 Bacteria 1231
377 Ga0495659_0228550 3300046664 Bacteria 770
378 Ga0495669_0444401 3300046684 Bacteria 629
379 Ga0495670_0326045 3300046691 Bacteria 825
380 Ga0495636_0040042 3300047318 Bacteria 1942
381 Ga0495636_0132686 3300047318 Bacteria 1109
382 Ga0495636_0140899 3300047318 Bacteria 1077
383 Ga0496102_0024076 3300048905 Bacteria 5412
384 Ga0496106_0142329 3300048909 Bacteria 1887
385 Ga0501031_0037955 3300049568 Bacteria 3144
386 Ga0501031_0195839 3300049568 Unclassified 1319
387 Ga0501031_0748624 3300049568 Bacteria 627
388 Ga0501032_0079180 3300049569 Bacteria 2188
389 Ga0501032_0096468 3300049569 Unclassified 1960
390 Ga0501032_0890282 3300049569 Bacteria 561
391 Ga0501033_0027536 3300049570 Bacteria 4274
392 Ga0501034_0695011 3300049571 Unclassified 916
393 Ga0501034_0701281 3300049571 Bacteria 911
394 Ga0501036_0013929 3300049572 Bacteria 6687
395 Ga0501036_0128467 3300049572 Bacteria 2140
396 Ga0501036_0193899 3300049572 Unclassified 1709
397 Ga0501036_0242739 3300049572 Bacteria 1511
398 Ga0501037_0067069 3300049573 Bacteria 2613
399 Ga0501037_0109905 3300049573 Unclassified 1986
400 Ga0501037_0637716 3300049573 Bacteria 713
401 Ga0501038_0027875 3300049574 Bacteria 5020
402 Ga0501038_0071187 3300049574 Bacteria 2950
403 Ga0501039_0024264 3300049575 Bacteria 4656
404 Ga0501039_0152672 3300049575 Bacteria 1814
405 Ga0501039_0624126 3300049575 Unclassified 844
406 Ga0501040_0000550 3300049576 Bacteria 22724
407 Ga0501040_0003565 3300049576 Bacteria 10064
408 Ga0501040_0011345 3300049576 Bacteria 5832
409 Ga0501040_0029293 3300049576 Unclassified 3716
410 Ga0501040_0081758 3300049576 Bacteria 2239
411 Ga0501040_0152079 3300049576 Bacteria 1633
412 Ga0501040_0617609 3300049576 Unclassified 783
413 Ga0501041_0002745 3300049577 Bacteria 10052
414 Ga0501041_0211413 3300049577 Bacteria 1217
415 Ga0501042_0001774 3300049578 Bacteria 12904
416 Ga0501042_0058538 3300049578 Bacteria 2751
417 Ga0501042_0533718 3300049578 Unclassified 853
418 Ga0501042_0919407 3300049578 Bacteria 637
419 Ga0501043_0142018 3300049579 Bacteria 1880
420 Ga0501043_0287908 3300049579 Bacteria 1258
421 Ga0501043_0322216 3300049579 Bacteria 1178
422 Ga0501046_0001798 3300049580 Bacteria 20444
423 Ga0501046_0016783 3300049580 Bacteria 6121
424 Ga0501046_0407125 3300049580 Unclassified 982
425 Ga0501046_0670084 3300049580 Unclassified 732
426 Ga0501046_1034647 3300049580 Bacteria 569
427 Ga0501047_0069185 3300049581 Bacteria 3400
428 Ga0501048_0002269 3300049582 Bacteria 14669
429 Ga0501048_0008185 3300049582 Bacteria 7909
430 Ga0501048_0147509 3300049582 Unclassified 1664
431 Ga0501048_0148780 3300049582 Bacteria 1656
432 Ga0501048_0284919 3300049582 Bacteria 1175
433 Ga0501048_1231176 3300049582 Unclassified 538
434 Ga0501068_0030699 3300049584 Bacteria 3190
435 Ga0501068_0312501 3300049584 Bacteria 1007
436 Ga0501068_0369465 3300049584 Bacteria 923
437 Ga0501068_0464110 3300049584 Bacteria 820
438 Ga0501070_0313517 3300049586 Bacteria 1277
439 Ga0501070_0519187 3300049586 Bacteria 956
440 Ga0501070_0679904 3300049586 Unclassified 815
441 Ga0501071_0026341 3300049587 Bacteria 4080
442 Ga0501071_0078489 3300049587 Bacteria 2413
443 Ga0501071_0259383 3300049587 Bacteria 1313
444 Ga0501072_0003668 3300049588 Bacteria 11574
445 Ga0501072_0004093 3300049588 Bacteria 11036
446 Ga0501072_0016296 3300049588 Bacteria 5702
447 Ga0501072_0021661 3300049588 Bacteria 4985
448 Ga0501072_0036153 3300049588 Bacteria 3871
449 Ga0501072_0086280 3300049588 Bacteria 2491
450 Ga0501072_0154039 3300049588 Bacteria 1833
451 Ga0501072_0284337 3300049588 Bacteria 1315
452 Ga0501072_0806210 3300049588 Unclassified 735
453 Ga0501073_0121272 3300049589 Unclassified 1812
454 Ga0501074_0001059 3300049590 Bacteria 17947
455 Ga0501074_0019059 3300049590 Bacteria 4982
456 Ga0501074_0134721 3300049590 Bacteria 1767
457 Ga0501074_0136261 3300049590 Bacteria 1756
458 Ga0501074_0388257 3300049590 Bacteria 990
459 Ga0501074_1094709 3300049590 Unclassified 560
460 Ga0501075_0001101 3300049591 Bacteria 17396
461 Ga0501075_0013293 3300049591 Bacteria 5873
462 Ga0501075_0050914 3300049591 Bacteria 3114
463 Ga0501075_0059355 3300049591 Bacteria 2881
464 Ga0501075_0111961 3300049591 Bacteria 2075
465 Ga0501075_0161584 3300049591 Bacteria 1709
466 Ga0501075_0476057 3300049591 Bacteria 952
467 Ga0501076_0002768 3300049592 Bacteria 12133
468 Ga0501076_0003999 3300049592 Bacteria 10417
469 Ga0501076_0031315 3300049592 Bacteria 4148
470 Ga0501076_0066158 3300049592 Bacteria 2884
471 Ga0501076_0077074 3300049592 Unclassified 2674
472 Ga0501076_0494818 3300049592 Bacteria 1008
473 Ga0501077_0026452 3300049593 Bacteria 3682
474 Ga0501077_0054791 3300049593 Bacteria 2532
475 Ga0501077_0087774 3300049593 Bacteria 1971
476 Ga0501077_0096785 3300049593 Unclassified 1870
477 Ga0501077_0494153 3300049593 Bacteria 784
478 Ga0501077_0661234 3300049593 Unclassified 671
479 Ga0501079_0000702 3300049741 Bacteria 22602
480 Ga0501079_0003732 3300049741 Bacteria 11235
481 Ga0501079_0021184 3300049741 Bacteria 4971
482 Ga0501079_0032926 3300049741 Bacteria 3986
483 Ga0501079_0272071 3300049741 Unclassified 1324
484 Ga0501079_0277743 3300049741 Bacteria 1310
485 Ga0501080_0006403 3300049742 Bacteria 10564
486 Ga0501080_0025608 3300049742 Bacteria 5478
487 Ga0501080_0446827 3300049742 Bacteria 1159
488 Ga0501081_0000477 3300049743 Bacteria 22287
489 Ga0501081_0002357 3300049743 Bacteria 11894
490 Ga0501081_0021362 3300049743 Bacteria 4319
491 Ga0501081_0056565 3300049743 Bacteria 2711
492 Ga0501081_0135910 3300049743 Unclassified 1760
493 Ga0501081_0149219 3300049743 Bacteria 1679
494 Ga0501081_0552034 3300049743 Bacteria 861
495 Ga0501081_0872143 3300049743 Bacteria 678
496 Ga0501083_0008658 3300049744 Bacteria 7179
497 Ga0501083_0030461 3300049744 Bacteria 3707
498 Ga0501035_0011689 3300049822 Bacteria 8136
499 Ga0501035_0109102 3300049822 Bacteria 2426
500 Ga0501035_0290594 3300049822 Bacteria 1380
501 Ga0501035_1345426 3300049822 Unclassified 549
502 Ga0501044_0966419 3300049823 Unclassified 724
503 Ga0501044_1582215 3300049823 Unclassified 520
504 Ga0501045_0000377 3300049824 Bacteria 26794
505 Ga0501045_0034024 3300049824 Bacteria 3697
506 Ga0501045_0039390 3300049824 Bacteria 3439
507 Ga0501045_0063069 3300049824 Bacteria 2719
508 Ga0501045_0158444 3300049824 Bacteria 1684
509 Ga0501045_0405774 3300049824 Unclassified 1014
510 nmdc:mga0k408_236441_c1 3300050493 Unclassified 1091
511 nmdc:mga05p37_117219_c1 3300050507 Bacteria 3273
512 nmdc:mga05p37_174747_c1 3300050507 Bacteria 2618
513 nmdc:mga05p37_236_c1 3300050507 Bacteria 56319
514 nmdc:mga05p37_24322_c1 3300050507 Bacteria 2846
515 nmdc:mga05p37_245521_c1 3300050507 Bacteria 2150
516 nmdc:mga05p37_25250_c1 3300050507 Bacteria 7226
517 nmdc:mga05p37_279700_c1 3300050507 Bacteria 1991
518 nmdc:mga05p37_3179_c1 3300050507 Bacteria 19103
519 nmdc:mga05p37_407546_c1 3300050507 Bacteria 1586
520 nmdc:mga05p37_592069_c1 3300050507 Bacteria 1253
521 nmdc:mga05p37_600161_c1 3300050507 Bacteria 1243
522 nmdc:mga05p37_646327_c1 3300050507 Bacteria 750
523 nmdc:mga05p37_72487_c1 3300050507 Bacteria 4238
524 nmdc:mga09592_10737_c1 3300050508 Bacteria 7453
525 nmdc:mga09592_165235_c1 3300050508 Bacteria 1913
526 nmdc:mga09592_17669_c1 3300050508 Bacteria 5846
527 nmdc:mga09592_494_c1 3300050508 Bacteria 29628
528 nmdc:mga09592_52040_c1 3300050508 Bacteria 3456
529 nmdc:mga09592_570782_c1 3300050508 Bacteria 971
530 nmdc:mga09592_573213_c1 3300050508 Unclassified 968
531 nmdc:mga09592_592151_c1 3300050508 Unclassified 951
532 nmdc:mga09592_725944_c1 3300050508 Bacteria 844
533 nmdc:mga09592_802840_c1 3300050508 Bacteria 796
534 nmdc:mga0qj67_2632_c1 3300050509 Bacteria 12859
535 nmdc:mga0qj67_4280_c1 3300050509 Bacteria 10346
536 nmdc:mga0qj67_54134_c1 3300050509 Bacteria 3177
537 nmdc:mga0qj67_579972_c1 3300050509 Unclassified 898
538 nmdc:mga0qj67_98_c1 3300050509 Bacteria 57947
539 nmdc:mga06r32_14207_c1 3300050510 Bacteria 7223
540 nmdc:mga06r32_16485_c1 3300050510 Bacteria 6734
541 nmdc:mga06r32_315_c1 3300050510 Bacteria 40418
542 nmdc:mga06r32_422821_c1 3300050510 Bacteria 1314
543 nmdc:mga06r32_5641_c1 3300050510 Bacteria 11260
544 nmdc:mga06r32_82165_c1 3300050510 Bacteria 3138
545 nmdc:mga08y16_1158292_c1 3300050511 Bacteria 746
546 nmdc:mga08y16_26629_c1 3300050511 Bacteria 6094
547 nmdc:mga0n895_174030_c1 3300050512 Bacteria 2184
548 nmdc:mga0n895_18892_c1 3300050512 Bacteria 6392
549 nmdc:mga0n895_28644_c1 3300050512 Bacteria 5301
550 nmdc:mga0n895_379716_c1 3300050512 Bacteria 1430
551 nmdc:mga0n895_47253_c1 3300050512 Bacteria 4208
552 nmdc:mga0n895_49099_c1 3300050512 Bacteria 4133
553 nmdc:mga0n895_69482_c1 3300050512 Bacteria 3490
554 nmdc:mga0n895_750773_c1 3300050512 Bacteria 969
555 nmdc:mga0n895_89909_c1 3300050512 Bacteria 3072
556 nmdc:mga0n895_975_c1 3300050512 Bacteria 20754
557 nmdc:mga0n895_982_c1 3300050512 Bacteria 20646
558 nmdc:mga0rr50_121096_c1 3300050513 Bacteria 2083
559 nmdc:mga0rr50_16912_c1 3300050513 Bacteria 4857
560 nmdc:mga0rr50_29863_c1 3300050513 Bacteria 3851
561 nmdc:mga0rr50_36090_c1 3300050513 Bacteria 3557
562 nmdc:mga0rr50_449528_c1 3300050513 Bacteria 1092
563 nmdc:mga0rr50_474_c1 3300050513 Bacteria 21305
564 nmdc:mga0rr50_5039_c1 3300050513 Bacteria 7828
565 nmdc:mga0rr50_94536_c1 3300050513 Unclassified 2335
566 nmdc:mga08x19_141030_c1 3300050514 Bacteria 1628
567 nmdc:mga08x19_1590_c1 3300050514 Bacteria 14083
568 nmdc:mga08x19_219415_c1 3300050514 Bacteria 1306
569 nmdc:mga08x19_330490_c1 3300050514 Bacteria 1062
570 nmdc:mga08x19_36158_c1 3300050514 Bacteria 3127
571 nmdc:mga08x19_473424_c1 3300050514 Unclassified 883
572 nmdc:mga08x19_769066_c1 3300050514 Bacteria 684
573 nmdc:mga0a205_10442_c1 3300050515 Bacteria 8530
574 nmdc:mga0a205_1200057_c1 3300050515 Bacteria 606
575 nmdc:mga0a205_226463_c1 3300050515 Bacteria 1754
576 nmdc:mga0a205_230155_c1 3300050515 Bacteria 1737
577 nmdc:mga0a205_2968_c1 3300050515 Bacteria 15047
578 nmdc:mga0a205_309007_c1 3300050515 Bacteria 1130
579 nmdc:mga0a205_313418_c1 3300050515 Bacteria 1441
580 nmdc:mga0a205_36948_c1 3300050515 Bacteria 4695
581 nmdc:mga0a205_511_c1 3300050515 Bacteria 30432
582 nmdc:mga0a205_61487_c1 3300050515 Bacteria 3628
583 nmdc:mga0a205_75095_c1 3300050515 Bacteria 3266
584 nmdc:mga0a205_774565_c1 3300050515 Bacteria 808
585 Ga0500611_131020 3300053727 Bacteria 676
586 Ga0500645_044635 3300053730 Unclassified 1303
587 Ga0501084_0003096 3300054114 Bacteria 13490
588 Ga0501084_0003187 3300054114 Bacteria 13274
589 Ga0501084_0017398 3300054114 Bacteria 5976
590 Ga0501084_0030169 3300054114 Bacteria 4535
591 Ga0501084_0041659 3300054114 Bacteria 3842
592 Ga0501084_0477406 3300054114 Unclassified 1054
593 Ga0501082_0000982 3300060353 Bacteria 25167
594 Ga0501082_0004461 3300060353 Bacteria 12221
595 Ga0501082_0009426 3300060353 Bacteria 8403
596 Ga0501082_0191485 3300060353 Bacteria 1779
597 Ga0530510_0002628 3300061734 Bacteria 12354
598 Ga0530510_0016281 3300061734 Bacteria 5259
599 Ga0530510_0068162 3300061734 Bacteria 2581
600 Ga0530510_0115458 3300061734 Unclassified 1968
601 Ga0451576_0381445
602 JGI25406J46586_10018103
603 rootH2_10223558
604 JGI26129J50193_1001872
605 Ga0065715_11068227
606 Ga0065707_10215261
607 Ga0065707_10271891
608 Ga0065707_10412389
609 Ga0070658_11642092
610 Ga0070690_100076059
611 Ga0068869_100428785
612 Ga0068869_100466499
613 Ga0070680_100002304
614 Ga0070680_100019286
615 Ga0070680_100343730
616 Ga0070680_100367514
617 Ga0070660_100010714
618 Ga0070691_10060825
619 Ga0070691_10129083
620 Ga0070691_10954390
621 Ga0070668_101151616
622 Ga0070669_100884959
623 Ga0070688_100304537
624 Ga0070703_10023008
625 Ga0070701_10091232
626 Ga0070701_10383838
627 Ga0070705_100009456
628 Ga0070705_100126527
629 Ga0070705_101068419
630 Ga0070700_100270789
631 Ga0070694_100003675
632 Ga0070694_100004428
633 Ga0070694_100013693
634 Ga0070694_100029975
635 Ga0070694_100235080
636 Ga0070708_100023978
637 Ga0070708_100032116
638 Ga0070708_100036362
639 Ga0070708_100103869
640 Ga0070708_100323245
641 Ga0070708_101247045
642 Ga0070681_10621142
643 Ga0070706_100008264
644 Ga0070706_100169944
645 Ga0070706_100250267
646 Ga0070706_100327005
647 Ga0070706_100690965
648 Ga0070706_100984537
649 Ga0070706_101392707
650 Ga0070707_100024295
651 Ga0070707_100065134
652 Ga0070707_100091828
653 Ga0070707_100134190
654 Ga0070707_100150653
655 Ga0070707_100296181
656 Ga0070707_100457203
657 Ga0070698_100282421
658 Ga0070698_100304661
659 Ga0070698_100305223
660 Ga0070698_100801160
661 Ga0070699_100005397
662 Ga0070699_100049208
663 Ga0070699_100084184
664 Ga0070699_100272967
665 Ga0070699_100292173
666 Ga0070699_100464299
667 Ga0070679_100000007
668 Ga0070679_100134649
669 Ga0070697_100019106
670 Ga0070697_100145134
671 Ga0070697_100189362
672 Ga0070697_100644845
673 Ga0070697_100887978
674 Ga0068853_100179770
675 Ga0070686_100192150
676 Ga0070686_100349323
677 Ga0070695_100002162
678 Ga0070695_100029057
679 Ga0070695_100042721
680 Ga0070695_100043033
681 Ga0070695_100440074
682 Ga0070696_100000167
683 Ga0070696_100076025
684 Ga0070696_100098613
685 Ga0070696_100122376
686 Ga0070693_100457255
687 Ga0070704_100003146
688 Ga0070704_100020602
689 Ga0070704_100024333
690 Ga0070704_100036039
691 Ga0070704_100188316
692 Ga0070704_100682017
693 Ga0070704_101089223
694 Ga0070664_102261999
695 Ga0070702_100075386
696 Ga0068859_100055090
697 Ga0068859_100080793
698 Ga0068859_100468110
699 Ga0068859_100926117
700 Ga0068866_10723804
701 Ga0068861_100100335
702 Ga0068861_100191021
703 Ga0068863_100820796
704 Ga0068858_100759983
705 Ga0068860_100145854
706 Ga0068862_100048842
707 Ga0068862_100053274
708 Ga0081455_10234149
709 Ga0081455_10280677
710 Ga0081539_10000266
711 Ga0075363_100697651
712 Ga0075432_10087621
713 Ga0070716_100251655
714 Ga0070716_100321171
715 Ga0075366_10580475
716 Ga0075428_100000159
717 Ga0075428_100021332
718 Ga0075428_100134058
719 Ga0075428_100150637
720 Ga0075428_100198524
721 Ga0075428_100307570
722 Ga0075428_100552534
723 Ga0075428_100998257
724 Ga0075428_101696017
725 Ga0075430_100000022
726 Ga0075430_100000109
727 Ga0075430_100123576
728 Ga0075430_100232067
729 Ga0075430_100507793
730 Ga0075430_100557645
731 Ga0075430_101161488
732 Ga0075431_100003363
733 Ga0075431_100006550
734 Ga0075431_100013613
735 Ga0075431_100098058
736 Ga0075431_100281740
737 Ga0075431_100503928
738 Ga0075431_100636323
739 Ga0075433_10000099
740 Ga0075433_10007920
741 Ga0075433_10012685
742 Ga0075433_10029924
743 Ga0075433_10033104
744 Ga0075433_10171694
745 Ga0075433_10252739
746 Ga0075433_10280513
747 Ga0075433_10343122
748 Ga0075433_10413870
749 Ga0075433_10489125
750 Ga0075433_11262204
751 Ga0075433_11933269
752 Ga0075434_100003252
753 Ga0075434_100044965
754 Ga0075434_100058530
755 Ga0075434_100113201
756 Ga0075434_100265563
757 Ga0075434_100604139
758 Ga0075434_100810902
759 Ga0075434_101091242
760 Ga0075434_101189446
761 Ga0075434_101524126
762 Ga0075429_100000072
763 Ga0075429_100005479
764 Ga0075429_100037361
765 Ga0075429_100050167
766 Ga0075429_100147598
767 Ga0075429_100362529
768 Ga0075429_100430364
769 Ga0075429_100501351
770 Ga0075429_101016457
771 Ga0068865_101020115
772 Ga0075436_100002534
773 Ga0075436_100028598
774 Ga0075436_100080065
775 Ga0075436_100235224
776 Ga0075436_100245342
777 Ga0075436_100756156
778 Ga0097620_100055090
779 Ga0097620_100080797
780 Ga0097620_100468062
781 Ga0097620_100926106
782 Ga0075435_100002792
783 Ga0075435_100014335
784 Ga0075435_100487122
785 Ga0075435_100506703
786 Ga0075435_100607701
787 Ga0075435_100618522
788 Ga0075435_100754649
789 Ga0075435_101957021
790 Ga0099794_10004513
791 Ga0099794_10098027
792 Ga0099794_10105163
793 Ga0099794_10112980
794 Ga0099794_10165307
795 Ga0099794_10341591
796 Ga0099795_10203528
797 Ga0105251_10090342
798 Ga0111539_10000304
799 Ga0111539_10054899
800 Ga0111539_10258815
801 Ga0111539_11587214
802 Ga0114129_10002074
803 Ga0114129_10003289
804 Ga0114129_10007967
805 Ga0114129_10015873
806 Ga0114129_10024647
807 Ga0114129_10040530
808 Ga0114129_10047957
809 Ga0114129_10058710
810 Ga0114129_10070363
811 Ga0114129_10183870
812 Ga0114129_10327205
813 Ga0114129_10455020
814 Ga0114129_10502961
815 Ga0114129_10533058
816 Ga0114129_11014322
817 Ga0114129_11104119
818 Ga0114129_11138525
819 Ga0114129_11462507
820 Ga0114129_13364534
821 Ga0105243_10429406
822 Ga0105243_10472014
823 Ga0105241_10645888
824 Ga0105248_10054366
825 Ga0105248_11790242
826 Ga0105249_10012603
827 Ga0105249_10186232
828 Ga0105249_11142520
829 Ga0105249_12148035
830 Ga0099796_10161086
831 Ga0099796_10397759
832 Ga0163162_10242263
833 Ga0157372_10234484
834 Ga0157380_11772093
835 Ga0182008_10034814
836 Ga0157377_10721452
837 Ga0157379_10814169
838 Ga0207653_10000067
839 Ga0207642_10159354
840 Ga0207642_10380019
841 Ga0207684_10037332
842 Ga0207684_10111441
843 Ga0207684_10169946
844 Ga0207684_10183190
845 Ga0207684_10930472
846 Ga0207707_10219823
847 Ga0207660_10004701
848 Ga0207660_10021061
849 Ga0207660_10103602
850 Ga0207662_10048756
851 Ga0207657_10015494
852 Ga0207652_10000001
853 Ga0207652_10112596
854 Ga0207646_10009742
855 Ga0207646_10054934
856 Ga0207646_10097558
857 Ga0207646_10212583
858 Ga0207646_11113956
859 Ga0207646_11512048
860 Ga0207681_10817230
861 Ga0207706_10169706
862 Ga0207670_10139277
863 Ga0207704_11651477
864 Ga0207665_10198501
865 Ga0207665_10332003
866 Ga0207711_10013396
867 Ga0207711_11548807
868 Ga0207711_11627445
869 Ga0207689_11458291
870 Ga0207679_11286574
871 Ga0207651_11092015
872 Ga0207712_10025095
873 Ga0207712_10094414
874 Ga0207712_11377384
875 Ga0207703_10574869
876 Ga0207639_12219858
877 Ga0207648_10459440
878 Ga0207675_100167316
879 Ga0209996_1001928
880 Ga0210000_1002113
881 Ga0209995_1009639
882 Ga0209968_1000361
883 Ga0209999_1003528
884 Ga0209982_1029332
885 Ga0209983_1000741
886 Ga0209588_1008222
887 Ga0209971_1000896
888 Ga0209966_1000175
889 Ga0209998_10000034
890 Ga0209974_10002298
891 Ga0207428_10000009
892 Ga0268265_10074641
893 Ga0268264_10708773
894 Ga0265330_10271398
895 Ga0307408_100007927
896 Ga0307405_10044165
897 Ga0307413_10816119
898 Ga0307412_10204747
899 Ga0307416_100005944
900 Ga0307411_10055400
901 Ga0307415_100142375
902 Ga0373930_0011016
903 Ga0373948_0144658
904 Ga0373940_0048759
905 Ga0373949_0103279
906 Ga0373932_0006663
907 Ga0373932_0122004
908 Ga0373942_0039217
909 Ga0373942_0111069
910 Ga0373962_0001325
911 Ga0373931_0038512
912 Ga0373931_1165322
913 Ga0395899_0061213
914 Ga0395899_0089954
915 Ga0395899_0132270
916 Ga0395899_0264387
917 Ga0395899_0777719
918 Ga0395900_0054566
919 Ga0395900_0066796
920 Ga0395900_0126298
921 Ga0395900_0173142
922 Ga0395900_0233568
923 Ga0395900_0242010
924 Ga0395900_0482824
925 Ga0395900_0863919
926 Ga0395900_0955004
927 Ga0395900_1067921
928 Ga0395898_0003914
929 Ga0395898_0018875
930 Ga0395898_0070563
931 Ga0395898_0086770
932 Ga0395898_0224131
933 Ga0395898_0551745
934 Ga0395898_0912264
935 Ga0395905_0053514
936 Ga0395905_0089829
937 Ga0395905_0185671
938 Ga0395905_0187857
939 Ga0395905_0234245
940 Ga0395905_0234987
941 Ga0395905_0335534
942 Ga0395905_0549804
943 Ga0395905_0580353
944 Ga0395905_0621195
945 Ga0395905_0684003
946 Ga0395905_0741009
947 Ga0395901_0002219
948 Ga0395901_0007837
949 Ga0395901_0015295
950 Ga0395901_0023405
951 Ga0395901_0108539
952 Ga0395901_0114651
953 Ga0395901_0372156
954 Ga0395901_0762653
955 Ga0395901_0970221
956 Ga0450892_034928
957 Ga0450889_024535
958 Ga0439460_0044104
959 Ga0451577_0636708
960 Ga0451577_1163025
961 Ga0451577_1750521
962 Ga0439440_0170342
963 Ga0466968_0687624
964 Ga0451576_0063178
965 Ga0451576_0201392
966 Ga0451576_0214831
967 Ga0451576_0279835
968 Ga0451576_0404403
969 Ga0451576_1254370
970 Ga0451576_1497861
971 Ga0466967_1640873
972 Ga0495590_0219319
973 Ga0495580_0211288
974 Ga0495621_0005895
975 Ga0495659_0019177
976 Ga0495659_0081187
977 Ga0495659_0228550
978 Ga0495669_0444401
979 Ga0495670_0326045
980 Ga0495636_0040042
981 Ga0495636_0132686
982 Ga0495636_0140899
983 Ga0496102_0024076
984 Ga0496106_0142329
985 Ga0501031_0037955
986 Ga0501031_0195839
987 Ga0501031_0748624
988 Ga0501032_0079180
989 Ga0501032_0096468
990 Ga0501032_0890282
991 Ga0501033_0027536
992 Ga0501034_0695011
993 Ga0501034_0701281
994 Ga0501036_0013929
995 Ga0501036_0128467
996 Ga0501036_0193899
997 Ga0501036_0242739
998 Ga0501037_0067069
999 Ga0501037_0109905
1000 Ga0501037_0637716
1001 Ga0501038_0027875
1002 Ga0501038_0071187
1003 Ga0501039_0024264
1004 Ga0501039_0152672
1005 Ga0501039_0624126
1006 Ga0501040_0000550
1007 Ga0501040_0003565
1008 Ga0501040_0011345
1009 Ga0501040_0029293
1010 Ga0501040_0081758
1011 Ga0501040_0152079
1012 Ga0501040_0617609
1013 Ga0501041_0002745
1014 Ga0501041_0211413
1015 Ga0501042_0001774
1016 Ga0501042_0058538
1017 Ga0501042_0533718
1018 Ga0501042_0919407
1019 Ga0501043_0142018
1020 Ga0501043_0287908
1021 Ga0501043_0322216
1022 Ga0501046_0001798
1023 Ga0501046_0016783
1024 Ga0501046_0407125
1025 Ga0501046_0670084
1026 Ga0501046_1034647
1027 Ga0501047_0069185
1028 Ga0501048_0002269
1029 Ga0501048_0008185
1030 Ga0501048_0147509
1031 Ga0501048_0148780
1032 Ga0501048_0284919
1033 Ga0501048_1231176
1034 Ga0501068_0030699
1035 Ga0501068_0312501
1036 Ga0501068_0369465
1037 Ga0501068_0464110
1038 Ga0501070_0313517
1039 Ga0501070_0519187
1040 Ga0501070_0679904
1041 Ga0501071_0026341
1042 Ga0501071_0078489
1043 Ga0501071_0259383
1044 Ga0501072_0003668
1045 Ga0501072_0004093
1046 Ga0501072_0016296
1047 Ga0501072_0021661
1048 Ga0501072_0036153
1049 Ga0501072_0086280
1050 Ga0501072_0154039
1051 Ga0501072_0284337
1052 Ga0501072_0806210
1053 Ga0501073_0121272
1054 Ga0501074_0001059
1055 Ga0501074_0019059
1056 Ga0501074_0134721
1057 Ga0501074_0136261
1058 Ga0501074_0388257
1059 Ga0501074_1094709
1060 Ga0501075_0001101
1061 Ga0501075_0013293
1062 Ga0501075_0050914
1063 Ga0501075_0059355
1064 Ga0501075_0111961
1065 Ga0501075_0161584
1066 Ga0501075_0476057
1067 Ga0501076_0002768
1068 Ga0501076_0003999
1069 Ga0501076_0031315
1070 Ga0501076_0066158
1071 Ga0501076_0077074
1072 Ga0501076_0494818
1073 Ga0501077_0026452
1074 Ga0501077_0054791
1075 Ga0501077_0087774
1076 Ga0501077_0096785
1077 Ga0501077_0494153
1078 Ga0501077_0661234
1079 Ga0501079_0000702
1080 Ga0501079_0003732
1081 Ga0501079_0021184
1082 Ga0501079_0032926
1083 Ga0501079_0272071
1084 Ga0501079_0277743
1085 Ga0501080_0006403
1086 Ga0501080_0025608
1087 Ga0501080_0446827
1088 Ga0501081_0000477
1089 Ga0501081_0002357
1090 Ga0501081_0021362
1091 Ga0501081_0056565
1092 Ga0501081_0135910
1093 Ga0501081_0149219
1094 Ga0501081_0552034
1095 Ga0501081_0872143
1096 Ga0501083_0008658
1097 Ga0501083_0030461
1098 Ga0501035_0011689
1099 Ga0501035_0109102
1100 Ga0501035_0290594
1101 Ga0501035_1345426
1102 Ga0501044_0966419
1103 Ga0501044_1582215
1104 Ga0501045_0000377
1105 Ga0501045_0034024
1106 Ga0501045_0039390
1107 Ga0501045_0063069
1108 Ga0501045_0158444
1109 Ga0501045_0405774
1110 nmdc:mga0k408_236441_c1
1111 nmdc:mga05p37_117219_c1
1112 nmdc:mga05p37_174747_c1
1113 nmdc:mga05p37_236_c1
1114 nmdc:mga05p37_24322_c1
1115 nmdc:mga05p37_245521_c1
1116 nmdc:mga05p37_25250_c1
1117 nmdc:mga05p37_279700_c1
1118 nmdc:mga05p37_3179_c1
1119 nmdc:mga05p37_407546_c1
1120 nmdc:mga05p37_592069_c1
1121 nmdc:mga05p37_600161_c1
1122 nmdc:mga05p37_646327_c1
1123 nmdc:mga05p37_72487_c1
1124 nmdc:mga09592_10737_c1
1125 nmdc:mga09592_165235_c1
1126 nmdc:mga09592_17669_c1
1127 nmdc:mga09592_494_c1
1128 nmdc:mga09592_52040_c1
1129 nmdc:mga09592_570782_c1
1130 nmdc:mga09592_573213_c1
1131 nmdc:mga09592_592151_c1
1132 nmdc:mga09592_725944_c1
1133 nmdc:mga09592_802840_c1
1134 nmdc:mga0qj67_2632_c1
1135 nmdc:mga0qj67_4280_c1
1136 nmdc:mga0qj67_54134_c1
1137 nmdc:mga0qj67_579972_c1
1138 nmdc:mga0qj67_98_c1
1139 nmdc:mga06r32_14207_c1
1140 nmdc:mga06r32_16485_c1
1141 nmdc:mga06r32_315_c1
1142 nmdc:mga06r32_422821_c1
1143 nmdc:mga06r32_5641_c1
1144 nmdc:mga06r32_82165_c1
1145 nmdc:mga08y16_1158292_c1
1146 nmdc:mga08y16_26629_c1
1147 nmdc:mga0n895_174030_c1
1148 nmdc:mga0n895_18892_c1
1149 nmdc:mga0n895_28644_c1
1150 nmdc:mga0n895_379716_c1
1151 nmdc:mga0n895_47253_c1
1152 nmdc:mga0n895_49099_c1
1153 nmdc:mga0n895_69482_c1
1154 nmdc:mga0n895_750773_c1
1155 nmdc:mga0n895_89909_c1
1156 nmdc:mga0n895_975_c1
1157 nmdc:mga0n895_982_c1
1158 nmdc:mga0rr50_121096_c1
1159 nmdc:mga0rr50_16912_c1
1160 nmdc:mga0rr50_29863_c1
1161 nmdc:mga0rr50_36090_c1
1162 nmdc:mga0rr50_449528_c1
1163 nmdc:mga0rr50_474_c1
1164 nmdc:mga0rr50_5039_c1
1165 nmdc:mga0rr50_94536_c1
1166 nmdc:mga08x19_141030_c1
1167 nmdc:mga08x19_1590_c1
1168 nmdc:mga08x19_219415_c1
1169 nmdc:mga08x19_330490_c1
1170 nmdc:mga08x19_36158_c1
1171 nmdc:mga08x19_473424_c1
1172 nmdc:mga08x19_769066_c1
1173 nmdc:mga0a205_10442_c1
1174 nmdc:mga0a205_1200057_c1
1175 nmdc:mga0a205_226463_c1
1176 nmdc:mga0a205_230155_c1
1177 nmdc:mga0a205_2968_c1
1178 nmdc:mga0a205_309007_c1
1179 nmdc:mga0a205_313418_c1
1180 nmdc:mga0a205_36948_c1
1181 nmdc:mga0a205_511_c1
1182 nmdc:mga0a205_61487_c1
1183 nmdc:mga0a205_75095_c1
1184 nmdc:mga0a205_774565_c1
1185 Ga0500611_131020
1186 Ga0500645_044635
1187 Ga0501084_0003096
1188 Ga0501084_0003187
1189 Ga0501084_0017398
1190 Ga0501084_0030169
1191 Ga0501084_0041659
1192 Ga0501084_0477406
1193 Ga0501082_0000982
1194 Ga0501082_0004461
1195 Ga0501082_0009426
1196 Ga0501082_0191485
1197 Ga0530510_0002628
1198 Ga0530510_0016281
1199 Ga0530510_0068162
1200 Ga0530510_0115458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

9

136

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8783 4 136
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8661 4 136
7cd2-assembly1.cif.gz_C crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. 0.8658 30 137
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.8588 20 136
5yu2-assembly1.cif.gz_B structure of ribonuclease yabj 0.8534 20 137
ID Description Score Start End Superfamily
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8499 20 136 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8426 20 136 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8321 18 136 3.30.1330.40
3k12B01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8239 27 136 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8194 27 136 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A1Q7D746-F1-model_v4 Enamine deaminase RidA 0.9918 1 137 GO:0005829
GO:0019239
AF-A0A1F7LHG5-F1-model_v4 Enamine deaminase RidA 0.9886 6 137 GO:0005829
GO:0019239
AF-A0A1F7MRG9-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9863 5 137 GO:0016491
AF-A0A3A0GBY7-F1-model_v4 RidA family protein 0.9844 5 136
AF-A0A535AZF8-F1-model_v4 RidA family protein 0.9841 4 137

Map