F467970

General Info

Members Datasets Scaffolds Average Seq Length
600 255 1200 179

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10024898|Ga0105240_100248982
Length 173
Sequence MTFVLSESIDVLRRTPATLAALLDGIPERLARGNEGPETFTPFDVVGHFIDGEETDWMPRARIILSDNKDKRFVPYDRFRHRARNADRTLDSLLEEFARLRAKNLAEEGQLDLTGVHPTFGEVTLRQLLAAWVAHDLGHIAQISRVMAKQYRDEVGPWTPFLPVLTDHDKPRS

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
178 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
183 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
193 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
194 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
195 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
229 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
230 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
236 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
246 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 0.83
Rhizosphere 98.67
Stem 0
Stem Tuber 0
Unclassified 17.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10024898 3300009093 Bacteria 7878
2 JGI26143J51219_1003555 3300003502 Bacteria 726
3 Ga0065715_10103442 3300005293 Unclassified 3034
4 Ga0065715_10154952 3300005293 Bacteria 1687
5 Ga0065707_10134712 3300005295 Bacteria 1838
6 Ga0070690_100339199 3300005330 Bacteria 1088
7 Ga0070670_100519477 3300005331 Bacteria 1060
8 Ga0068869_100000791 3300005334 Bacteria 18060
9 Ga0068869_100000886 3300005334 Bacteria 17252
10 Ga0070666_10543047 3300005335 Unclassified 845
11 Ga0070680_100020488 3300005336 Bacteria 5248
12 Ga0070680_100950333 3300005336 Unclassified 742
13 Ga0070682_100005921 3300005337 Bacteria 6837
14 Ga0070660_100081605 3300005339 Bacteria 2539
15 Ga0070689_100036466 3300005340 Bacteria 3761
16 Ga0070689_100284636 3300005340 Bacteria 1372
17 Ga0070691_10007186 3300005341 Bacteria 5099
18 Ga0070691_10045326 3300005341 Bacteria 2087
19 Ga0070687_100026203 3300005343 Bacteria 2805
20 Ga0070687_100031519 3300005343 Bacteria 2601
21 Ga0070692_10072400 3300005345 Bacteria 1839
22 Ga0070692_10151821 3300005345 Unclassified 1320
23 Ga0070668_100129842 3300005347 Bacteria 2022
24 Ga0070668_100301112 3300005347 Bacteria 1345
25 Ga0070669_100009033 3300005353 Bacteria 7107
26 Ga0070675_100023659 3300005354 Bacteria 4914
27 Ga0070673_100041560 3300005364 Bacteria 3538
28 Ga0070673_100208631 3300005364 Bacteria 1686
29 Ga0070673_100246098 3300005364 Bacteria 1556
30 Ga0070688_100144254 3300005365 Bacteria 1621
31 Ga0070667_100095820 3300005367 Bacteria 2559
32 Ga0070667_100365661 3300005367 Bacteria 1308
33 Ga0070703_10001064 3300005406 Bacteria 8557
34 Ga0070703_10115450 3300005406 Bacteria 967
35 Ga0070709_10405458 3300005434 Bacteria 1019
36 Ga0070713_101041397 3300005436 Unclassified 790
37 Ga0070701_10011927 3300005438 Bacteria 3904
38 Ga0070701_10178047 3300005438 Bacteria 1243
39 Ga0070701_10480927 3300005438 Unclassified 803
40 Ga0070705_100001373 3300005440 Bacteria 12951
41 Ga0070705_100041026 3300005440 Bacteria 2636
42 Ga0070705_100111717 3300005440 Bacteria 1747
43 Ga0070705_100469001 3300005440 Bacteria 949
44 Ga0070705_100784875 3300005440 Bacteria 756
45 Ga0070705_100825588 3300005440 Bacteria 740
46 Ga0070700_100129408 3300005441 Bacteria 1701
47 Ga0070700_100148735 3300005441 Bacteria 1599
48 Ga0070700_101005247 3300005441 Unclassified 686
49 Ga0070694_100003308 3300005444 Bacteria 9643
50 Ga0070694_100012352 3300005444 Bacteria 5306
51 Ga0070694_100062638 3300005444 Bacteria 2542
52 Ga0070694_100079458 3300005444 Bacteria 2277
53 Ga0070694_100095834 3300005444 Bacteria 2090
54 Ga0070694_100117975 3300005444 Bacteria 1900
55 Ga0070694_100226400 3300005444 Bacteria 1405
56 Ga0070694_100236002 3300005444 Bacteria 1378
57 Ga0070694_100237329 3300005444 Bacteria 1374
58 Ga0070694_100712995 3300005444 Unclassified 817
59 Ga0070694_101375234 3300005444 Bacteria 595
60 Ga0070708_100004253 3300005445 Bacteria 11247
61 Ga0070708_100017298 3300005445 Bacteria 6010
62 Ga0070708_100028351 3300005445 Bacteria 4818
63 Ga0070708_100038095 3300005445 Bacteria 4198
64 Ga0070708_100082910 3300005445 Bacteria 2905
65 Ga0070708_100130361 3300005445 Bacteria 2327
66 Ga0070663_100090749 3300005455 Bacteria 2263
67 Ga0070663_100140861 3300005455 Bacteria 1841
68 Ga0070662_100000878 3300005457 Bacteria 18363
69 Ga0070662_100015529 3300005457 Bacteria 5103
70 Ga0070662_100338762 3300005457 Bacteria 1230
71 Ga0070681_10024679 3300005458 Bacteria 6049
72 Ga0070681_10436811 3300005458 Bacteria 1221
73 Ga0068867_100000171 3300005459 Bacteria 42278
74 Ga0068867_100547694 3300005459 Bacteria 1002
75 Ga0070706_100023325 3300005467 Bacteria 5700
76 Ga0070706_100036208 3300005467 Bacteria 4558
77 Ga0070706_100537765 3300005467 Unclassified 1087
78 Ga0070706_100885636 3300005467 Bacteria 825
79 Ga0070707_100081851 3300005468 Bacteria 3117
80 Ga0070707_100317362 3300005468 Unclassified 1514
81 Ga0070698_100013458 3300005471 Bacteria 8659
82 Ga0070699_100009420 3300005518 Bacteria 8462
83 Ga0070699_100027591 3300005518 Bacteria 4896
84 Ga0070699_100108426 3300005518 Bacteria 2437
85 Ga0070699_100210286 3300005518 Unclassified 1731
86 Ga0070699_100498382 3300005518 Bacteria 1106
87 Ga0070699_100710243 3300005518 Bacteria 919
88 Ga0070679_100116329 3300005530 Bacteria 2658
89 Ga0070697_100007655 3300005536 Bacteria 8409
90 Ga0070697_100012896 3300005536 Bacteria 6548
91 Ga0070697_100016877 3300005536 Bacteria 5741
92 Ga0070697_100021720 3300005536 Bacteria 5087
93 Ga0070697_100023860 3300005536 Bacteria 4867
94 Ga0070697_100201782 3300005536 Bacteria 1691
95 Ga0070697_100379078 3300005536 Unclassified 1225
96 Ga0070697_100704476 3300005536 Unclassified 891
97 Ga0068853_100251361 3300005539 Bacteria 1622
98 Ga0070672_100057559 3300005543 Unclassified 3051
99 Ga0070686_100277311 3300005544 Bacteria 1235
100 Ga0070686_100656152 3300005544 Bacteria 832
101 Ga0070695_100019151 3300005545 Bacteria 4164
102 Ga0070695_100028807 3300005545 Bacteria 3448
103 Ga0070695_100029602 3300005545 Bacteria 3402
104 Ga0070695_100073912 3300005545 Bacteria 2239
105 Ga0070695_100085964 3300005545 Bacteria 2089
106 Ga0070695_100167134 3300005545 Bacteria 1549
107 Ga0070695_100177681 3300005545 Bacteria 1506
108 Ga0070695_100249289 3300005545 Bacteria 1292
109 Ga0070695_100397197 3300005545 Unclassified 1044
110 Ga0070695_101125137 3300005545 Bacteria 643
111 Ga0070696_100001336 3300005546 Bacteria 16079
112 Ga0070696_100003885 3300005546 Bacteria 9981
113 Ga0070696_100007854 3300005546 Bacteria 7121
114 Ga0070696_100009444 3300005546 Bacteria 6532
115 Ga0070696_100012214 3300005546 Bacteria 5755
116 Ga0070696_100062536 3300005546 Unclassified 2606
117 Ga0070696_100277992 3300005546 Bacteria 1275
118 Ga0070696_100380363 3300005546 Bacteria 1100
119 Ga0070693_100032464 3300005547 Bacteria 2872
120 Ga0070665_101237430 3300005548 Unclassified 757
121 Ga0070704_100015065 3300005549 Bacteria 4846
122 Ga0070704_100016019 3300005549 Bacteria 4726
123 Ga0070704_100017638 3300005549 Bacteria 4545
124 Ga0070704_100019593 3300005549 Bacteria 4349
125 Ga0070704_100041505 3300005549 Bacteria 3176
126 Ga0070704_100156321 3300005549 Bacteria 1799
127 Ga0070704_100175543 3300005549 Bacteria 1709
128 Ga0070704_100195791 3300005549 Bacteria 1628
129 Ga0070704_100250488 3300005549 Bacteria 1454
130 Ga0070704_100274573 3300005549 Unclassified 1394
131 Ga0070704_100283739 3300005549 Bacteria 1373
132 Ga0070704_100305966 3300005549 Bacteria 1326
133 Ga0070704_100453471 3300005549 Bacteria 1105
134 Ga0068855_100124198 3300005563 Bacteria 2953
135 Ga0068855_100698295 3300005563 Bacteria 1086
136 Ga0070664_100048875 3300005564 Bacteria 3576
137 Ga0070664_100687004 3300005564 Bacteria 953
138 Ga0068857_100037061 3300005577 Bacteria 4319
139 Ga0068857_100051049 3300005577 Bacteria 3668
140 Ga0068854_100001104 3300005578 Bacteria 16244
141 Ga0068854_100368049 3300005578 Unclassified 1181
142 Ga0068856_100015981 3300005614 Bacteria 7255
143 Ga0070702_100070935 3300005615 Bacteria 2058
144 Ga0068852_100139684 3300005616 Bacteria 2240
145 Ga0068852_100916297 3300005616 Unclassified 894
146 Ga0068859_100112431 3300005617 Bacteria 2786
147 Ga0068859_100196814 3300005617 Bacteria 2100
148 Ga0068859_100947755 3300005617 Bacteria 944
149 Ga0068859_101167377 3300005617 Bacteria 848
150 Ga0068864_100018910 3300005618 Bacteria 5760
151 Ga0068864_100702075 3300005618 Unclassified 988
152 Ga0068864_101026106 3300005618 Unclassified 819
153 Ga0068861_100047728 3300005719 Bacteria 3234
154 Ga0068861_100081696 3300005719 Bacteria 2531
155 Ga0068861_100121676 3300005719 Bacteria 2106
156 Ga0068861_100240048 3300005719 Bacteria 1541
157 Ga0068851_10129101 3300005834 Bacteria 1365
158 Ga0068870_10027502 3300005840 Bacteria 2845
159 Ga0068863_100027678 3300005841 Bacteria 5409
160 Ga0068863_100390551 3300005841 Bacteria 1360
161 Ga0068863_100402409 3300005841 Bacteria 1339
162 Ga0068858_100041708 3300005842 Bacteria 4255
163 Ga0068858_100634066 3300005842 Unclassified 1038
164 Ga0068858_101041153 3300005842 Bacteria 803
165 Ga0068860_100045943 3300005843 Bacteria 4165
166 Ga0068860_100349170 3300005843 Bacteria 1456
167 Ga0068860_100433470 3300005843 Bacteria 1305
168 Ga0068862_100090054 3300005844 Unclassified 2670
169 Ga0068862_100151738 3300005844 Bacteria 2063
170 Ga0068862_100713251 3300005844 Bacteria 972
171 Ga0068862_100799717 3300005844 Unclassified 921
172 Ga0070715_10106206 3300006163 Bacteria 1317
173 Ga0070715_10184603 3300006163 Bacteria 1048
174 Ga0070716_100162068 3300006173 Unclassified 1450
175 Ga0097621_100158066 3300006237 Bacteria 1947
176 Ga0068871_100016529 3300006358 Bacteria 5562
177 Ga0068871_100675165 3300006358 Bacteria 945
178 Ga0075428_100009427 3300006844 Bacteria 10835
179 Ga0075428_100654885 3300006844 Bacteria 1120
180 Ga0075428_100804732 3300006844 Bacteria 999
181 Ga0075428_100947548 3300006844 Bacteria 912
182 Ga0075430_100037651 3300006846 Bacteria 4100
183 Ga0075430_100059157 3300006846 Bacteria 3221
184 Ga0075430_100456405 3300006846 Bacteria 1054
185 Ga0075431_100009772 3300006847 Bacteria 9633
186 Ga0075431_100042365 3300006847 Unclassified 4695
187 Ga0075431_100071550 3300006847 Unclassified 3578
188 Ga0075431_100316159 3300006847 Unclassified 1575
189 Ga0075431_100318448 3300006847 Unclassified 1569
190 Ga0075431_100471189 3300006847 Bacteria 1249
191 Ga0075431_100871179 3300006847 Bacteria 871
192 Ga0075431_101248009 3300006847 Unclassified 705
193 Ga0075433_10037427 3300006852 Bacteria 4186
194 Ga0075433_10040357 3300006852 Bacteria 4040
195 Ga0075433_10062541 3300006852 Bacteria 3260
196 Ga0075433_10124616 3300006852 Bacteria 2288
197 Ga0075433_10178394 3300006852 Unclassified 1890
198 Ga0075433_10211679 3300006852 Bacteria 1722
199 Ga0075434_100002849 3300006871 Bacteria 15333
200 Ga0075434_100053683 3300006871 Bacteria 4004
201 Ga0075434_100180678 3300006871 Bacteria 2130
202 Ga0075434_100201186 3300006871 Bacteria 2012
203 Ga0075434_100233215 3300006871 Bacteria 1860
204 Ga0075434_100255431 3300006871 Unclassified 1771
205 Ga0075434_100283421 3300006871 Unclassified 1676
206 Ga0075434_100358538 3300006871 Unclassified 1479
207 Ga0075429_100005412 3300006880 Bacteria 10989
208 Ga0075429_100012922 3300006880 Bacteria 7244
209 Ga0075429_100100069 3300006880 Bacteria 2530
210 Ga0075429_100193699 3300006880 Unclassified 1781
211 Ga0075429_100220324 3300006880 Bacteria 1662
212 Ga0075429_100398522 3300006880 Bacteria 1205
213 Ga0075429_100558050 3300006880 Bacteria 1004
214 Ga0075436_100012535 3300006914 Bacteria 5810
215 Ga0075436_100089416 3300006914 Bacteria 2140
216 Ga0075436_100361067 3300006914 Bacteria 1048
217 Ga0075436_100525015 3300006914 Bacteria 868
218 Ga0097620_100112437 3300006931 Bacteria 2786
219 Ga0097620_100196799 3300006931 Bacteria 2100
220 Ga0097620_100947802 3300006931 Bacteria 944
221 Ga0097620_101167537 3300006931 Bacteria 848
222 Ga0075435_100007365 3300007076 Bacteria 7836
223 Ga0075435_100025003 3300007076 Bacteria 4644
224 Ga0075435_100026161 3300007076 Bacteria 4549
225 Ga0075435_100041180 3300007076 Bacteria 3692
226 Ga0075435_100463523 3300007076 Bacteria 1093
227 Ga0075435_100559263 3300007076 Bacteria 991
228 Ga0099794_10000156 3300007265 Bacteria 25242
229 Ga0099794_10026650 3300007265 Bacteria 2674
230 Ga0099794_10092723 3300007265 Bacteria 1500
231 Ga0105240_10136485 3300009093 Bacteria 2937
232 Ga0111539_10054068 3300009094 Bacteria 4778
233 Ga0111539_10307033 3300009094 Unclassified 1846
234 Ga0111539_10369001 3300009094 Bacteria 1671
235 Ga0105245_10016116 3300009098 Bacteria 6512
236 Ga0105245_10265489 3300009098 Bacteria 1672
237 Ga0105245_10324675 3300009098 Bacteria 1517
238 Ga0105247_10082477 3300009101 Bacteria 2029
239 Ga0114129_10003441 3300009147 Bacteria 22256
240 Ga0114129_10037587 3300009147 Bacteria 6835
241 Ga0114129_10055526 3300009147 Bacteria 5550
242 Ga0114129_10110016 3300009147 Bacteria 3803
243 Ga0114129_10156300 3300009147 Bacteria 3118
244 Ga0114129_10281429 3300009147 Bacteria 2222
245 Ga0114129_10331265 3300009147 Bacteria 2021
246 Ga0114129_10632899 3300009147 Bacteria 1382
247 Ga0114129_10946157 3300009147 Bacteria 1088
248 Ga0105243_10005995 3300009148 Bacteria 9411
249 Ga0105243_10829249 3300009148 Bacteria 914
250 Ga0105241_10038631 3300009174 Bacteria 3599
251 Ga0105241_10088954 3300009174 Bacteria 2432
252 Ga0105242_10002775 3300009176 Bacteria 13709
253 Ga0105242_10038676 3300009176 Bacteria 3837
254 Ga0105248_10001202 3300009177 Bacteria 28938
255 Ga0105248_10034290 3300009177 Bacteria 5674
256 Ga0105248_10156834 3300009177 Bacteria 2568
257 Ga0105248_10789563 3300009177 Bacteria 1072
258 Ga0105249_10022879 3300009553 Bacteria 5602
259 Ga0105249_10152838 3300009553 Bacteria 2223
260 Ga0105249_10365067 3300009553 Bacteria 1466
261 Ga0105239_10008514 3300010375 Bacteria 11660
262 Ga0105246_10004486 3300011119 Bacteria 8492
263 Ga0105246_10235131 3300011119 Unclassified 1445
264 Ga0157373_10007387 3300013100 Bacteria 8177
265 Ga0157371_10200966 3300013102 Bacteria 1429
266 Ga0157371_10208821 3300013102 Bacteria 1401
267 Ga0157370_10315130 3300013104 Bacteria 1443
268 Ga0163162_10003870 3300013306 Bacteria 14365
269 Ga0157372_10022363 3300013307 Bacteria 6840
270 Ga0157372_10107133 3300013307 Bacteria 3197
271 Ga0157372_10361889 3300013307 Bacteria 1690
272 Ga0157375_10388460 3300013308 Bacteria 1562
273 Ga0157375_10657301 3300013308 Bacteria 1204
274 Ga0163163_10182749 3300014325 Unclassified 2144
275 Ga0163163_10981167 3300014325 Bacteria 908
276 Ga0157380_10101295 3300014326 Unclassified 2399
277 Ga0157380_10286159 3300014326 Bacteria 1511
278 Ga0157380_10411958 3300014326 Bacteria 1286
279 Ga0157380_11110589 3300014326 Bacteria 830
280 Ga0157377_10023364 3300014745 Bacteria 3275
281 Ga0157379_10215086 3300014968 Bacteria 1741
282 Ga0157379_10689769 3300014968 Unclassified 958
283 Ga0157376_10029573 3300014969 Bacteria 4365
284 Ga0157376_10124201 3300014969 Bacteria 2292
285 Ga0157376_10214913 3300014969 Bacteria 1777
286 Ga0163161_11416241 3300017792 Bacteria 607
287 Ga0213875_10016085 3300021388 Bacteria 3628
288 Ga0207653_10000041 3300025885 Bacteria 96988
289 Ga0207653_10004278 3300025885 Bacteria 4484
290 Ga0207653_10062045 3300025885 Bacteria 1263
291 Ga0207642_10001895 3300025899 Bacteria 6449
292 Ga0207680_10057716 3300025903 Bacteria 2350
293 Ga0207647_10177995 3300025904 Bacteria 1236
294 Ga0207685_10077365 3300025905 Bacteria 1366
295 Ga0207699_10278530 3300025906 Bacteria 1161
296 Ga0207699_10280835 3300025906 Bacteria 1157
297 Ga0207645_10001303 3300025907 Bacteria 20535
298 Ga0207643_10031301 3300025908 Bacteria 2965
299 Ga0207643_10032139 3300025908 Bacteria 2929
300 Ga0207684_10004982 3300025910 Bacteria 12379
301 Ga0207684_10042665 3300025910 Bacteria 3846
302 Ga0207684_10718964 3300025910 Bacteria 848
303 Ga0207707_10023297 3300025912 Bacteria 5418
304 Ga0207707_10501079 3300025912 Bacteria 1036
305 Ga0207695_10142339 3300025913 Bacteria 2345
306 Ga0207695_10297371 3300025913 Unclassified 1506
307 Ga0207663_10486460 3300025916 Bacteria 957
308 Ga0207660_10013918 3300025917 Bacteria 5279
309 Ga0207660_10025709 3300025917 Bacteria 4000
310 Ga0207660_10970358 3300025917 Unclassified 693
311 Ga0207662_10105355 3300025918 Bacteria 1752
312 Ga0207657_10106554 3300025919 Bacteria 2319
313 Ga0207652_10154684 3300025921 Bacteria 2054
314 Ga0207646_10014336 3300025922 Bacteria 7532
315 Ga0207646_10029781 3300025922 Bacteria 4956
316 Ga0207646_10057186 3300025922 Unclassified 3485
317 Ga0207646_10063402 3300025922 Bacteria 3299
318 Ga0207646_10104965 3300025922 Bacteria 2534
319 Ga0207646_10280972 3300025922 Bacteria 1504
320 Ga0207646_10288884 3300025922 Bacteria 1482
321 Ga0207646_10717657 3300025922 Bacteria 893
322 Ga0207681_10083142 3300025923 Bacteria 2265
323 Ga0207681_10151854 3300025923 Bacteria 1736
324 Ga0207681_10180970 3300025923 Unclassified 1606
325 Ga0207659_10335391 3300025926 Bacteria 1251
326 Ga0207687_10012796 3300025927 Bacteria 5483
327 Ga0207687_10268063 3300025927 Bacteria 1364
328 Ga0207644_11129816 3300025931 Bacteria 658
329 Ga0207706_10000168 3300025933 Bacteria 72574
330 Ga0207706_10005609 3300025933 Bacteria 11692
331 Ga0207706_10210861 3300025933 Bacteria 1703
332 Ga0207686_10000196 3300025934 Bacteria 46701
333 Ga0207686_10194358 3300025934 Unclassified 1449
334 Ga0207709_11083937 3300025935 Bacteria 657
335 Ga0207670_10981060 3300025936 Unclassified 710
336 Ga0207669_10003269 3300025937 Bacteria 7009
337 Ga0207691_10145484 3300025940 Bacteria 2086
338 Ga0207691_10658345 3300025940 Bacteria 884
339 Ga0207711_10007772 3300025941 Bacteria 8959
340 Ga0207711_10041545 3300025941 Bacteria 3916
341 Ga0207711_10276193 3300025941 Unclassified 1547
342 Ga0207689_10000439 3300025942 Bacteria 38980
343 Ga0207689_10001543 3300025942 Bacteria 21885
344 Ga0207689_10291362 3300025942 Bacteria 1352
345 Ga0207679_10005639 3300025945 Bacteria 7850
346 Ga0207679_10228258 3300025945 Unclassified 1570
347 Ga0207679_10599985 3300025945 Unclassified 992
348 Ga0207667_10029591 3300025949 Bacteria 5938
349 Ga0207651_10198102 3300025960 Bacteria 1607
350 Ga0207651_10239734 3300025960 Bacteria 1477
351 Ga0207712_10034193 3300025961 Bacteria 3443
352 Ga0207668_10583190 3300025972 Bacteria 972
353 Ga0207640_10079063 3300025981 Bacteria 2241
354 Ga0207658_10208073 3300025986 Bacteria 1638
355 Ga0207658_10442053 3300025986 Bacteria 1150
356 Ga0207677_10035604 3300026023 Bacteria 3235
357 Ga0207703_10055333 3300026035 Bacteria 3228
358 Ga0207639_10222377 3300026041 Bacteria 1631
359 Ga0207678_10129945 3300026067 Bacteria 2148
360 Ga0207678_10258726 3300026067 Bacteria 1492
361 Ga0207708_10061157 3300026075 Bacteria 2875
362 Ga0207708_10138640 3300026075 Bacteria 1906
363 Ga0207708_10159687 3300026075 Bacteria 1779
364 Ga0207702_11553542 3300026078 Bacteria 655
365 Ga0207641_10226355 3300026088 Unclassified 1736
366 Ga0207641_10649201 3300026088 Unclassified 1036
367 Ga0207648_10000028 3300026089 Bacteria 130116
368 Ga0207676_10056622 3300026095 Bacteria 3083
369 Ga0207676_10257043 3300026095 Unclassified 1575
370 Ga0207676_10425202 3300026095 Bacteria 1247
371 Ga0207676_10963272 3300026095 Bacteria 839
372 Ga0207674_10000210 3300026116 Bacteria 72127
373 Ga0207674_10027057 3300026116 Bacteria 6076
374 Ga0207675_100002196 3300026118 Bacteria 19385
375 Ga0207675_100328685 3300026118 Bacteria 1494
376 Ga0207675_100441097 3300026118 Unclassified 1289
377 Ga0207675_100592246 3300026118 Unclassified 1111
378 Ga0207675_100711875 3300026118 Bacteria 1013
379 Ga0207675_100775340 3300026118 Bacteria 971
380 Ga0207698_10809043 3300026142 Bacteria 940
381 Ga0209967_1005369 3300027364 Bacteria 1718
382 Ga0209984_1021614 3300027424 Bacteria 883
383 Ga0210000_1010319 3300027462 Bacteria 1381
384 Ga0209968_1004873 3300027526 Bacteria 2011
385 Ga0209983_1001699 3300027665 Unclassified 4865
386 Ga0209588_1000564 3300027671 Bacteria 9520
387 Ga0209588_1003330 3300027671 Bacteria 4450
388 Ga0207428_10131045 3300027907 Bacteria 1918
389 Ga0268265_10103587 3300028380 Bacteria 2305
390 Ga0268264_10023855 3300028381 Bacteria 4990
391 Ga0268264_10044438 3300028381 Bacteria 3685
392 Ga0268264_10242161 3300028381 Unclassified 1671
393 Ga0307408_100206460 3300031548 Bacteria 1594
394 Ga0307408_100813575 3300031548 Unclassified 849
395 Ga0307405_10489220 3300031731 Unclassified 984
396 Ga0307405_11092497 3300031731 Unclassified 685
397 Ga0307413_10010914 3300031824 Bacteria 4436
398 Ga0307413_10298504 3300031824 Bacteria 1220
399 Ga0307410_10072772 3300031852 Bacteria 2388
400 Ga0307410_10081749 3300031852 Bacteria 2271
401 Ga0307410_10119181 3300031852 Bacteria 1922
402 Ga0307410_10321125 3300031852 Bacteria 1228
403 Ga0307406_10016198 3300031901 Bacteria 4327
404 Ga0307406_10017110 3300031901 Bacteria 4221
405 Ga0307406_10346570 3300031901 Bacteria 1159
406 Ga0307406_10743334 3300031901 Unclassified 823
407 Ga0307407_10012704 3300031903 Bacteria 4059
408 Ga0307412_10077178 3300031911 Bacteria 2291
409 Ga0307412_10674089 3300031911 Bacteria 885
410 Ga0307409_100074241 3300031995 Bacteria 2717
411 Ga0307409_100451460 3300031995 Unclassified 1241
412 Ga0307416_100230480 3300032002 Bacteria 1785
413 Ga0307416_100339421 3300032002 Bacteria 1514
414 Ga0307416_101220604 3300032002 Bacteria 858
415 Ga0307414_10015835 3300032004 Bacteria 4565
416 Ga0307414_10016437 3300032004 Bacteria 4497
417 Ga0307414_10016774 3300032004 Bacteria 4464
418 Ga0307411_10015473 3300032005 Bacteria 4286
419 Ga0307415_100175977 3300032126 Bacteria 1674
420 Ga0307415_100182729 3300032126 Bacteria 1647
421 Ga0307415_100716339 3300032126 Unclassified 905
422 Ga0373944_0209121 3300035089 Unclassified 709
423 Ga0373937_0157132 3300036401 Bacteria 2132
424 Ga0373937_0313580 3300036401 Bacteria 1484
425 Ga0395900_0666796 3300037418 Bacteria 976
426 Ga0436364_1467729 3300037853 Bacteria 17417
427 Ga0439464_0033434 3300042439 Bacteria 1448
428 Ga0451577_0000580 3300042876 Bacteria 58982
429 Ga0451577_0037173 3300042876 Bacteria 4383
430 Ga0451577_0052910 3300042876 Bacteria 3626
431 Ga0453683_0066162 3300044673 Bacteria 2259
432 Ga0453683_0075507 3300044673 Unclassified 2110
433 Ga0453684_0001612 3300044712 Bacteria 61939
434 Ga0453684_0451178 3300044712 Bacteria 1431
435 Ga0451576_0018799 3300045051 Bacteria 7555
436 Ga0451576_0060356 3300045051 Bacteria 3956
437 Ga0451576_0075506 3300045051 Bacteria 3507
438 Ga0451576_0193633 3300045051 Bacteria 2123
439 Ga0451576_0535411 3300045051 Bacteria 1230
440 Ga0495603_0195035 3300046455 Bacteria 1171
441 Ga0495629_0172972 3300046459 Bacteria 1498
442 Ga0495638_0037046 3300046460 Unclassified 3104
443 Ga0495641_0030819 3300046461 Bacteria 2567
444 Ga0495580_0026799 3300046472 Bacteria 4198
445 Ga0495582_0029348 3300046473 Bacteria 3019
446 Ga0495639_0141616 3300046475 Unclassified 1156
447 Ga0495664_0014081 3300046477 Bacteria 4531
448 Ga0495594_0009643 3300046499 Bacteria 4992
449 Ga0495618_0004800 3300046514 Bacteria 8262
450 Ga0495628_0158912 3300046516 Bacteria 1718
451 Ga0495628_0384139 3300046516 Unclassified 1028
452 Ga0495630_0011081 3300046517 Bacteria 6521
453 Ga0495666_0004297 3300046526 Bacteria 7191
454 Ga0495665_0031564 3300046531 Bacteria 2835
455 Ga0495640_0041784 3300046533 Bacteria 3202
456 Ga0495586_0009385 3300046535 Bacteria 5206
457 Ga0495586_0381615 3300046535 Unclassified 810
458 Ga0495633_0407672 3300046558 Unclassified 615
459 Ga0495634_0028803 3300046642 Bacteria 3851
460 Ga0495634_0191800 3300046642 Bacteria 1274
461 Ga0495635_0374377 3300046663 Unclassified 948
462 Ga0495659_0057148 3300046664 Bacteria 1433
463 Ga0495647_0009229 3300046681 Bacteria 3335
464 Ga0495658_0010361 3300046683 Unclassified 4662
465 Ga0495658_0297935 3300046683 Unclassified 1020
466 Ga0495613_0007510 3300046689 Bacteria 8118
467 Ga0495670_0235264 3300046691 Unclassified 975
468 Ga0495581_0644596 3300047315 Unclassified 612
469 Ga0495674_0017942 3300047319 Bacteria 6589
470 Ga0495676_0370817 3300047321 Unclassified 954
471 Ga0495680_0066031 3300047322 Bacteria 2770
472 Ga0495684_0018992 3300047471 Bacteria 5292
473 Ga0496100_0125818 3300048903 Bacteria 1799
474 Ga0496102_0204224 3300048905 Bacteria 1863
475 Ga0496102_0567919 3300048905 Bacteria 1057
476 Ga0496105_0231120 3300048908 Unclassified 1503
477 Ga0496114_0201125 3300048917 Bacteria 1745
478 Ga0501031_0135496 3300049568 Bacteria 1609
479 Ga0501031_0209081 3300049568 Unclassified 1272
480 Ga0501036_0033361 3300049572 Bacteria 4354
481 Ga0501036_0071885 3300049572 Bacteria 2925
482 Ga0501036_0089924 3300049572 Bacteria 2594
483 Ga0501036_0598164 3300049572 Unclassified 915
484 Ga0501037_0263197 3300049573 Unclassified 1205
485 Ga0501038_0118963 3300049574 Bacteria 2181
486 Ga0501039_0019420 3300049575 Bacteria 5210
487 Ga0501039_0039923 3300049575 Bacteria 3624
488 Ga0501040_0035424 3300049576 Bacteria 3385
489 Ga0501040_0046484 3300049576 Bacteria 2963
490 Ga0501040_0051972 3300049576 Bacteria 2804
491 Ga0501040_0107363 3300049576 Bacteria 1951
492 Ga0501041_0023957 3300049577 Bacteria 3662
493 Ga0501041_0061041 3300049577 Bacteria 2307
494 Ga0501042_0045561 3300049578 Bacteria 3126
495 Ga0501042_0068422 3300049578 Bacteria 2539
496 Ga0501042_0070728 3300049578 Bacteria 2496
497 Ga0501042_0508373 3300049578 Bacteria 875
498 Ga0501043_0303704 3300049579 Bacteria 1219
499 Ga0501046_0169077 3300049580 Unclassified 1641
500 Ga0501046_0247132 3300049580 Unclassified 1314
501 Ga0501067_0022543 3300049583 Bacteria 3485
502 Ga0501068_0345368 3300049584 Unclassified 956
503 Ga0501070_0317633 3300049586 Unclassified 1267
504 Ga0501070_0518728 3300049586 Unclassified 956
505 Ga0501071_0013768 3300049587 Bacteria 5518
506 Ga0501071_0517977 3300049587 Unclassified 915
507 Ga0501072_0157732 3300049588 Bacteria 1810
508 Ga0501072_0219276 3300049588 Bacteria 1516
509 Ga0501074_0070214 3300049590 Unclassified 2518
510 Ga0501075_0000437 3300049591 Bacteria 24619
511 Ga0501075_0662364 3300049591 Unclassified 796
512 Ga0501076_0013756 3300049592 Bacteria 6072
513 Ga0501076_0013816 3300049592 Bacteria 6060
514 Ga0501076_0208537 3300049592 Unclassified 1596
515 Ga0501076_0307254 3300049592 Unclassified 1300
516 Ga0501077_0036620 3300049593 Bacteria 3126
517 Ga0501079_0007877 3300049741 Bacteria 8071
518 Ga0501079_0008930 3300049741 Bacteria 7591
519 Ga0501079_0109380 3300049741 Bacteria 2146
520 Ga0501079_0258370 3300049741 Unclassified 1361
521 Ga0501079_0260858 3300049741 Unclassified 1354
522 Ga0501079_1313524 3300049741 Unclassified 569
523 Ga0501080_0267600 3300049742 Bacteria 1556
524 Ga0501081_0035241 3300049743 Bacteria 3406
525 Ga0501081_0216430 3300049743 Bacteria 1392
526 Ga0501083_0058641 3300049744 Bacteria 2576
527 Ga0501279_025349 3300049775 Unclassified 862
528 Ga0501035_0342967 3300049822 Bacteria 1251
529 Ga0501045_0004430 3300049824 Bacteria 9690
530 Ga0501045_0012574 3300049824 Bacteria 5961
531 Ga0501045_0035121 3300049824 Bacteria 3640
532 Ga0501045_0037097 3300049824 Bacteria 3542
533 Ga0501045_0075168 3300049824 Bacteria 2488
534 nmdc:mga05p37_1223945_c1 3300050507 Unclassified 773
535 nmdc:mga05p37_157557_c1 3300050507 Bacteria 2774
536 nmdc:mga05p37_188474_c1 3300050507 Bacteria 2506
537 nmdc:mga05p37_20102_c1 3300050507 Bacteria 8080
538 nmdc:mga05p37_28921_c1 3300050507 Bacteria 6761
539 nmdc:mga05p37_44367_c1 3300050507 Bacteria 5470
540 nmdc:mga05p37_547760_c1 3300050507 Unclassified 1318
541 nmdc:mga05p37_57164_c1 3300050507 Bacteria 4804
542 nmdc:mga05p37_828505_c1 3300050507 Bacteria 1008
543 nmdc:mga09592_10362_c1 3300050508 Bacteria 7585
544 nmdc:mga09592_142012_c2 3300050508 Bacteria 1207
545 nmdc:mga09592_178957_c1 3300050508 Bacteria 1834
546 nmdc:mga09592_184079_c1 3300050508 Unclassified 1807
547 nmdc:mga09592_233656_c1 3300050508 Bacteria 1593
548 nmdc:mga09592_299638_c1 3300050508 Unclassified 1394
549 nmdc:mga0qj67_75334_c1 3300050509 Bacteria 2697
550 nmdc:mga06r32_1196995_c1 3300050510 Bacteria 706
551 nmdc:mga06r32_171382_c1 3300050510 Bacteria 2154
552 nmdc:mga06r32_39954_c1 3300050510 Bacteria 4453
553 nmdc:mga06r32_587527_c1 3300050510 Bacteria 1085
554 nmdc:mga06r32_967170_c1 3300050510 Unclassified 805
555 nmdc:mga08y16_132490_c1 3300050511 Bacteria 2591
556 nmdc:mga08y16_368409_c1 3300050511 Bacteria 1474
557 nmdc:mga08y16_544023_c1 3300050511 Bacteria 1176
558 nmdc:mga0n895_131154_c1 3300050512 Bacteria 2531
559 nmdc:mga0n895_133736_c1 3300050512 Bacteria 2506
560 nmdc:mga0n895_161813_c1 3300050512 Bacteria 2270
561 nmdc:mga0n895_200496_c1 3300050512 Bacteria 2027
562 nmdc:mga0n895_303811_c1 3300050512 Unclassified 1617
563 nmdc:mga0n895_3636_c1 3300050512 Bacteria 12464
564 nmdc:mga0n895_367175_c1 3300050512 Bacteria 1457
565 nmdc:mga0n895_4637_c1 3300050512 Bacteria 11333
566 nmdc:mga0n895_658319_c1 3300050512 Bacteria 1046
567 nmdc:mga0rr50_124580_c1 3300050513 Unclassified 2056
568 nmdc:mga0rr50_213512_c1 3300050513 Bacteria 1591
569 nmdc:mga0rr50_313286_c1 3300050513 Bacteria 1315
570 nmdc:mga0rr50_508646_c1 3300050513 Bacteria 1024
571 nmdc:mga0rr50_5214_c1 3300050513 Bacteria 7730
572 nmdc:mga0rr50_543997_c1 3300050513 Bacteria 989
573 nmdc:mga08x19_16436_c1 3300050514 Unclassified 4515
574 nmdc:mga08x19_359927_c1 3300050514 Bacteria 1017
575 nmdc:mga08x19_633046_c1 3300050514 Bacteria 758
576 nmdc:mga08x19_90058_c1 3300050514 Bacteria 2024
577 nmdc:mga08x19_93645_c1 3300050514 Bacteria 1986
578 nmdc:mga0a205_113995_c1 3300050515 Bacteria 2602
579 nmdc:mga0a205_171286_c1 3300050515 Bacteria 2067
580 nmdc:mga0a205_29906_c1 3300050515 Bacteria 5213
581 nmdc:mga0a205_343447_c1 3300050515 Bacteria 1361
582 nmdc:mga0a205_43622_c2 3300050515 Bacteria 3293
583 nmdc:mga0a205_5302_c1 3300050515 Bacteria 11608
584 nmdc:mga0a205_6967_c1 3300050515 Bacteria 10225
585 nmdc:mga0a205_724857_c1 3300050515 Bacteria 844
586 Ga0495619_0155892 3300053085 Bacteria 1576
587 Ga0495619_0162122 3300053085 Unclassified 1545
588 Ga0500627_0129006 3300053158 Bacteria 1142
589 Ga0501084_0009913 3300054114 Bacteria 7874
590 Ga0501084_0103097 3300054114 Bacteria 2396
591 Ga0501084_0482810 3300054114 Unclassified 1047
592 Ga0501084_0517744 3300054114 Bacteria 1008
593 Ga0590071_001271 3300059421 Bacteria 6787
594 Ga0590074_004650 3300059423 Bacteria 2267
595 Ga0590075_032358 3300059424 Unclassified 1327
596 Ga0501082_0095917 3300060353 Bacteria 2564
597 Ga0501082_0144411 3300060353 Bacteria 2065
598 Ga0501082_1336036 3300060353 Unclassified 626
599 Ga0530510_0012597 3300061734 Bacteria 5945
600 Ga0530510_0016846 3300061734 Bacteria 5176
601 Ga0105240_10024898
602 JGI26143J51219_1003555
603 Ga0065715_10103442
604 Ga0065715_10154952
605 Ga0065707_10134712
606 Ga0070690_100339199
607 Ga0070670_100519477
608 Ga0068869_100000791
609 Ga0068869_100000886
610 Ga0070666_10543047
611 Ga0070680_100020488
612 Ga0070680_100950333
613 Ga0070682_100005921
614 Ga0070660_100081605
615 Ga0070689_100036466
616 Ga0070689_100284636
617 Ga0070691_10007186
618 Ga0070691_10045326
619 Ga0070687_100026203
620 Ga0070687_100031519
621 Ga0070692_10072400
622 Ga0070692_10151821
623 Ga0070668_100129842
624 Ga0070668_100301112
625 Ga0070669_100009033
626 Ga0070675_100023659
627 Ga0070673_100041560
628 Ga0070673_100208631
629 Ga0070673_100246098
630 Ga0070688_100144254
631 Ga0070667_100095820
632 Ga0070667_100365661
633 Ga0070703_10001064
634 Ga0070703_10115450
635 Ga0070709_10405458
636 Ga0070713_101041397
637 Ga0070701_10011927
638 Ga0070701_10178047
639 Ga0070701_10480927
640 Ga0070705_100001373
641 Ga0070705_100041026
642 Ga0070705_100111717
643 Ga0070705_100469001
644 Ga0070705_100784875
645 Ga0070705_100825588
646 Ga0070700_100129408
647 Ga0070700_100148735
648 Ga0070700_101005247
649 Ga0070694_100003308
650 Ga0070694_100012352
651 Ga0070694_100062638
652 Ga0070694_100079458
653 Ga0070694_100095834
654 Ga0070694_100117975
655 Ga0070694_100226400
656 Ga0070694_100236002
657 Ga0070694_100237329
658 Ga0070694_100712995
659 Ga0070694_101375234
660 Ga0070708_100004253
661 Ga0070708_100017298
662 Ga0070708_100028351
663 Ga0070708_100038095
664 Ga0070708_100082910
665 Ga0070708_100130361
666 Ga0070663_100090749
667 Ga0070663_100140861
668 Ga0070662_100000878
669 Ga0070662_100015529
670 Ga0070662_100338762
671 Ga0070681_10024679
672 Ga0070681_10436811
673 Ga0068867_100000171
674 Ga0068867_100547694
675 Ga0070706_100023325
676 Ga0070706_100036208
677 Ga0070706_100537765
678 Ga0070706_100885636
679 Ga0070707_100081851
680 Ga0070707_100317362
681 Ga0070698_100013458
682 Ga0070699_100009420
683 Ga0070699_100027591
684 Ga0070699_100108426
685 Ga0070699_100210286
686 Ga0070699_100498382
687 Ga0070699_100710243
688 Ga0070679_100116329
689 Ga0070697_100007655
690 Ga0070697_100012896
691 Ga0070697_100016877
692 Ga0070697_100021720
693 Ga0070697_100023860
694 Ga0070697_100201782
695 Ga0070697_100379078
696 Ga0070697_100704476
697 Ga0068853_100251361
698 Ga0070672_100057559
699 Ga0070686_100277311
700 Ga0070686_100656152
701 Ga0070695_100019151
702 Ga0070695_100028807
703 Ga0070695_100029602
704 Ga0070695_100073912
705 Ga0070695_100085964
706 Ga0070695_100167134
707 Ga0070695_100177681
708 Ga0070695_100249289
709 Ga0070695_100397197
710 Ga0070695_101125137
711 Ga0070696_100001336
712 Ga0070696_100003885
713 Ga0070696_100007854
714 Ga0070696_100009444
715 Ga0070696_100012214
716 Ga0070696_100062536
717 Ga0070696_100277992
718 Ga0070696_100380363
719 Ga0070693_100032464
720 Ga0070665_101237430
721 Ga0070704_100015065
722 Ga0070704_100016019
723 Ga0070704_100017638
724 Ga0070704_100019593
725 Ga0070704_100041505
726 Ga0070704_100156321
727 Ga0070704_100175543
728 Ga0070704_100195791
729 Ga0070704_100250488
730 Ga0070704_100274573
731 Ga0070704_100283739
732 Ga0070704_100305966
733 Ga0070704_100453471
734 Ga0068855_100124198
735 Ga0068855_100698295
736 Ga0070664_100048875
737 Ga0070664_100687004
738 Ga0068857_100037061
739 Ga0068857_100051049
740 Ga0068854_100001104
741 Ga0068854_100368049
742 Ga0068856_100015981
743 Ga0070702_100070935
744 Ga0068852_100139684
745 Ga0068852_100916297
746 Ga0068859_100112431
747 Ga0068859_100196814
748 Ga0068859_100947755
749 Ga0068859_101167377
750 Ga0068864_100018910
751 Ga0068864_100702075
752 Ga0068864_101026106
753 Ga0068861_100047728
754 Ga0068861_100081696
755 Ga0068861_100121676
756 Ga0068861_100240048
757 Ga0068851_10129101
758 Ga0068870_10027502
759 Ga0068863_100027678
760 Ga0068863_100390551
761 Ga0068863_100402409
762 Ga0068858_100041708
763 Ga0068858_100634066
764 Ga0068858_101041153
765 Ga0068860_100045943
766 Ga0068860_100349170
767 Ga0068860_100433470
768 Ga0068862_100090054
769 Ga0068862_100151738
770 Ga0068862_100713251
771 Ga0068862_100799717
772 Ga0070715_10106206
773 Ga0070715_10184603
774 Ga0070716_100162068
775 Ga0097621_100158066
776 Ga0068871_100016529
777 Ga0068871_100675165
778 Ga0075428_100009427
779 Ga0075428_100654885
780 Ga0075428_100804732
781 Ga0075428_100947548
782 Ga0075430_100037651
783 Ga0075430_100059157
784 Ga0075430_100456405
785 Ga0075431_100009772
786 Ga0075431_100042365
787 Ga0075431_100071550
788 Ga0075431_100316159
789 Ga0075431_100318448
790 Ga0075431_100471189
791 Ga0075431_100871179
792 Ga0075431_101248009
793 Ga0075433_10037427
794 Ga0075433_10040357
795 Ga0075433_10062541
796 Ga0075433_10124616
797 Ga0075433_10178394
798 Ga0075433_10211679
799 Ga0075434_100002849
800 Ga0075434_100053683
801 Ga0075434_100180678
802 Ga0075434_100201186
803 Ga0075434_100233215
804 Ga0075434_100255431
805 Ga0075434_100283421
806 Ga0075434_100358538
807 Ga0075429_100005412
808 Ga0075429_100012922
809 Ga0075429_100100069
810 Ga0075429_100193699
811 Ga0075429_100220324
812 Ga0075429_100398522
813 Ga0075429_100558050
814 Ga0075436_100012535
815 Ga0075436_100089416
816 Ga0075436_100361067
817 Ga0075436_100525015
818 Ga0097620_100112437
819 Ga0097620_100196799
820 Ga0097620_100947802
821 Ga0097620_101167537
822 Ga0075435_100007365
823 Ga0075435_100025003
824 Ga0075435_100026161
825 Ga0075435_100041180
826 Ga0075435_100463523
827 Ga0075435_100559263
828 Ga0099794_10000156
829 Ga0099794_10026650
830 Ga0099794_10092723
831 Ga0105240_10136485
832 Ga0111539_10054068
833 Ga0111539_10307033
834 Ga0111539_10369001
835 Ga0105245_10016116
836 Ga0105245_10265489
837 Ga0105245_10324675
838 Ga0105247_10082477
839 Ga0114129_10003441
840 Ga0114129_10037587
841 Ga0114129_10055526
842 Ga0114129_10110016
843 Ga0114129_10156300
844 Ga0114129_10281429
845 Ga0114129_10331265
846 Ga0114129_10632899
847 Ga0114129_10946157
848 Ga0105243_10005995
849 Ga0105243_10829249
850 Ga0105241_10038631
851 Ga0105241_10088954
852 Ga0105242_10002775
853 Ga0105242_10038676
854 Ga0105248_10001202
855 Ga0105248_10034290
856 Ga0105248_10156834
857 Ga0105248_10789563
858 Ga0105249_10022879
859 Ga0105249_10152838
860 Ga0105249_10365067
861 Ga0105239_10008514
862 Ga0105246_10004486
863 Ga0105246_10235131
864 Ga0157373_10007387
865 Ga0157371_10200966
866 Ga0157371_10208821
867 Ga0157370_10315130
868 Ga0163162_10003870
869 Ga0157372_10022363
870 Ga0157372_10107133
871 Ga0157372_10361889
872 Ga0157375_10388460
873 Ga0157375_10657301
874 Ga0163163_10182749
875 Ga0163163_10981167
876 Ga0157380_10101295
877 Ga0157380_10286159
878 Ga0157380_10411958
879 Ga0157380_11110589
880 Ga0157377_10023364
881 Ga0157379_10215086
882 Ga0157379_10689769
883 Ga0157376_10029573
884 Ga0157376_10124201
885 Ga0157376_10214913
886 Ga0163161_11416241
887 Ga0213875_10016085
888 Ga0207653_10000041
889 Ga0207653_10004278
890 Ga0207653_10062045
891 Ga0207642_10001895
892 Ga0207680_10057716
893 Ga0207647_10177995
894 Ga0207685_10077365
895 Ga0207699_10278530
896 Ga0207699_10280835
897 Ga0207645_10001303
898 Ga0207643_10031301
899 Ga0207643_10032139
900 Ga0207684_10004982
901 Ga0207684_10042665
902 Ga0207684_10718964
903 Ga0207707_10023297
904 Ga0207707_10501079
905 Ga0207695_10142339
906 Ga0207695_10297371
907 Ga0207663_10486460
908 Ga0207660_10013918
909 Ga0207660_10025709
910 Ga0207660_10970358
911 Ga0207662_10105355
912 Ga0207657_10106554
913 Ga0207652_10154684
914 Ga0207646_10014336
915 Ga0207646_10029781
916 Ga0207646_10057186
917 Ga0207646_10063402
918 Ga0207646_10104965
919 Ga0207646_10280972
920 Ga0207646_10288884
921 Ga0207646_10717657
922 Ga0207681_10083142
923 Ga0207681_10151854
924 Ga0207681_10180970
925 Ga0207659_10335391
926 Ga0207687_10012796
927 Ga0207687_10268063
928 Ga0207644_11129816
929 Ga0207706_10000168
930 Ga0207706_10005609
931 Ga0207706_10210861
932 Ga0207686_10000196
933 Ga0207686_10194358
934 Ga0207709_11083937
935 Ga0207670_10981060
936 Ga0207669_10003269
937 Ga0207691_10145484
938 Ga0207691_10658345
939 Ga0207711_10007772
940 Ga0207711_10041545
941 Ga0207711_10276193
942 Ga0207689_10000439
943 Ga0207689_10001543
944 Ga0207689_10291362
945 Ga0207679_10005639
946 Ga0207679_10228258
947 Ga0207679_10599985
948 Ga0207667_10029591
949 Ga0207651_10198102
950 Ga0207651_10239734
951 Ga0207712_10034193
952 Ga0207668_10583190
953 Ga0207640_10079063
954 Ga0207658_10208073
955 Ga0207658_10442053
956 Ga0207677_10035604
957 Ga0207703_10055333
958 Ga0207639_10222377
959 Ga0207678_10129945
960 Ga0207678_10258726
961 Ga0207708_10061157
962 Ga0207708_10138640
963 Ga0207708_10159687
964 Ga0207702_11553542
965 Ga0207641_10226355
966 Ga0207641_10649201
967 Ga0207648_10000028
968 Ga0207676_10056622
969 Ga0207676_10257043
970 Ga0207676_10425202
971 Ga0207676_10963272
972 Ga0207674_10000210
973 Ga0207674_10027057
974 Ga0207675_100002196
975 Ga0207675_100328685
976 Ga0207675_100441097
977 Ga0207675_100592246
978 Ga0207675_100711875
979 Ga0207675_100775340
980 Ga0207698_10809043
981 Ga0209967_1005369
982 Ga0209984_1021614
983 Ga0210000_1010319
984 Ga0209968_1004873
985 Ga0209983_1001699
986 Ga0209588_1000564
987 Ga0209588_1003330
988 Ga0207428_10131045
989 Ga0268265_10103587
990 Ga0268264_10023855
991 Ga0268264_10044438
992 Ga0268264_10242161
993 Ga0307408_100206460
994 Ga0307408_100813575
995 Ga0307405_10489220
996 Ga0307405_11092497
997 Ga0307413_10010914
998 Ga0307413_10298504
999 Ga0307410_10072772
1000 Ga0307410_10081749
1001 Ga0307410_10119181
1002 Ga0307410_10321125
1003 Ga0307406_10016198
1004 Ga0307406_10017110
1005 Ga0307406_10346570
1006 Ga0307406_10743334
1007 Ga0307407_10012704
1008 Ga0307412_10077178
1009 Ga0307412_10674089
1010 Ga0307409_100074241
1011 Ga0307409_100451460
1012 Ga0307416_100230480
1013 Ga0307416_100339421
1014 Ga0307416_101220604
1015 Ga0307414_10015835
1016 Ga0307414_10016437
1017 Ga0307414_10016774
1018 Ga0307411_10015473
1019 Ga0307415_100175977
1020 Ga0307415_100182729
1021 Ga0307415_100716339
1022 Ga0373944_0209121
1023 Ga0373937_0157132
1024 Ga0373937_0313580
1025 Ga0395900_0666796
1026 Ga0436364_1467729
1027 Ga0439464_0033434
1028 Ga0451577_0000580
1029 Ga0451577_0037173
1030 Ga0451577_0052910
1031 Ga0453683_0066162
1032 Ga0453683_0075507
1033 Ga0453684_0001612
1034 Ga0453684_0451178
1035 Ga0451576_0018799
1036 Ga0451576_0060356
1037 Ga0451576_0075506
1038 Ga0451576_0193633
1039 Ga0451576_0535411
1040 Ga0495603_0195035
1041 Ga0495629_0172972
1042 Ga0495638_0037046
1043 Ga0495641_0030819
1044 Ga0495580_0026799
1045 Ga0495582_0029348
1046 Ga0495639_0141616
1047 Ga0495664_0014081
1048 Ga0495594_0009643
1049 Ga0495618_0004800
1050 Ga0495628_0158912
1051 Ga0495628_0384139
1052 Ga0495630_0011081
1053 Ga0495666_0004297
1054 Ga0495665_0031564
1055 Ga0495640_0041784
1056 Ga0495586_0009385
1057 Ga0495586_0381615
1058 Ga0495633_0407672
1059 Ga0495634_0028803
1060 Ga0495634_0191800
1061 Ga0495635_0374377
1062 Ga0495659_0057148
1063 Ga0495647_0009229
1064 Ga0495658_0010361
1065 Ga0495658_0297935
1066 Ga0495613_0007510
1067 Ga0495670_0235264
1068 Ga0495581_0644596
1069 Ga0495674_0017942
1070 Ga0495676_0370817
1071 Ga0495680_0066031
1072 Ga0495684_0018992
1073 Ga0496100_0125818
1074 Ga0496102_0204224
1075 Ga0496102_0567919
1076 Ga0496105_0231120
1077 Ga0496114_0201125
1078 Ga0501031_0135496
1079 Ga0501031_0209081
1080 Ga0501036_0033361
1081 Ga0501036_0071885
1082 Ga0501036_0089924
1083 Ga0501036_0598164
1084 Ga0501037_0263197
1085 Ga0501038_0118963
1086 Ga0501039_0019420
1087 Ga0501039_0039923
1088 Ga0501040_0035424
1089 Ga0501040_0046484
1090 Ga0501040_0051972
1091 Ga0501040_0107363
1092 Ga0501041_0023957
1093 Ga0501041_0061041
1094 Ga0501042_0045561
1095 Ga0501042_0068422
1096 Ga0501042_0070728
1097 Ga0501042_0508373
1098 Ga0501043_0303704
1099 Ga0501046_0169077
1100 Ga0501046_0247132
1101 Ga0501067_0022543
1102 Ga0501068_0345368
1103 Ga0501070_0317633
1104 Ga0501070_0518728
1105 Ga0501071_0013768
1106 Ga0501071_0517977
1107 Ga0501072_0157732
1108 Ga0501072_0219276
1109 Ga0501074_0070214
1110 Ga0501075_0000437
1111 Ga0501075_0662364
1112 Ga0501076_0013756
1113 Ga0501076_0013816
1114 Ga0501076_0208537
1115 Ga0501076_0307254
1116 Ga0501077_0036620
1117 Ga0501079_0007877
1118 Ga0501079_0008930
1119 Ga0501079_0109380
1120 Ga0501079_0258370
1121 Ga0501079_0260858
1122 Ga0501079_1313524
1123 Ga0501080_0267600
1124 Ga0501081_0035241
1125 Ga0501081_0216430
1126 Ga0501083_0058641
1127 Ga0501279_025349
1128 Ga0501035_0342967
1129 Ga0501045_0004430
1130 Ga0501045_0012574
1131 Ga0501045_0035121
1132 Ga0501045_0037097
1133 Ga0501045_0075168
1134 nmdc:mga05p37_1223945_c1
1135 nmdc:mga05p37_157557_c1
1136 nmdc:mga05p37_188474_c1
1137 nmdc:mga05p37_20102_c1
1138 nmdc:mga05p37_28921_c1
1139 nmdc:mga05p37_44367_c1
1140 nmdc:mga05p37_547760_c1
1141 nmdc:mga05p37_57164_c1
1142 nmdc:mga05p37_828505_c1
1143 nmdc:mga09592_10362_c1
1144 nmdc:mga09592_142012_c2
1145 nmdc:mga09592_178957_c1
1146 nmdc:mga09592_184079_c1
1147 nmdc:mga09592_233656_c1
1148 nmdc:mga09592_299638_c1
1149 nmdc:mga0qj67_75334_c1
1150 nmdc:mga06r32_1196995_c1
1151 nmdc:mga06r32_171382_c1
1152 nmdc:mga06r32_39954_c1
1153 nmdc:mga06r32_587527_c1
1154 nmdc:mga06r32_967170_c1
1155 nmdc:mga08y16_132490_c1
1156 nmdc:mga08y16_368409_c1
1157 nmdc:mga08y16_544023_c1
1158 nmdc:mga0n895_131154_c1
1159 nmdc:mga0n895_133736_c1
1160 nmdc:mga0n895_161813_c1
1161 nmdc:mga0n895_200496_c1
1162 nmdc:mga0n895_303811_c1
1163 nmdc:mga0n895_3636_c1
1164 nmdc:mga0n895_367175_c1
1165 nmdc:mga0n895_4637_c1
1166 nmdc:mga0n895_658319_c1
1167 nmdc:mga0rr50_124580_c1
1168 nmdc:mga0rr50_213512_c1
1169 nmdc:mga0rr50_313286_c1
1170 nmdc:mga0rr50_508646_c1
1171 nmdc:mga0rr50_5214_c1
1172 nmdc:mga0rr50_543997_c1
1173 nmdc:mga08x19_16436_c1
1174 nmdc:mga08x19_359927_c1
1175 nmdc:mga08x19_633046_c1
1176 nmdc:mga08x19_90058_c1
1177 nmdc:mga08x19_93645_c1
1178 nmdc:mga0a205_113995_c1
1179 nmdc:mga0a205_171286_c1
1180 nmdc:mga0a205_29906_c1
1181 nmdc:mga0a205_343447_c1
1182 nmdc:mga0a205_43622_c2
1183 nmdc:mga0a205_5302_c1
1184 nmdc:mga0a205_6967_c1
1185 nmdc:mga0a205_724857_c1
1186 Ga0495619_0155892
1187 Ga0495619_0162122
1188 Ga0500627_0129006
1189 Ga0501084_0009913
1190 Ga0501084_0103097
1191 Ga0501084_0482810
1192 Ga0501084_0517744
1193 Ga0590071_001271
1194 Ga0590074_004650
1195 Ga0590075_032358
1196 Ga0501082_0095917
1197 Ga0501082_0144411
1198 Ga0501082_1336036
1199 Ga0530510_0012597
1200 Ga0530510_0016846

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

12

143

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.9235 1 174
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.9053 1 174
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8717 1 174
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8594 1 174
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8012 2 157
ID Description Score Start End Superfamily
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9398 1 169 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8769 1 169 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7939 2 156 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.742 2 156 1.20.120.450
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7382 1 159 1.20.120.450
ID Description Score Start End GO Terms
AF-W0RCT1-F1-model_v4 DinB-like domain protein 0.994 1 172
AF-A0A521HEZ7-F1-model_v4 DinB family protein 0.9935 1 174
AF-A0A7D7ZS88-F1-model_v4 DinB family protein 0.9895 1 173
AF-A0A521HEZ7-F1-model_v4 DinB family protein 0.9878 1 174
AF-A0A2D6AME1-F1-model_v4 DinB-like domain-containing protein 0.9873 1 172

Map