F467947

General Info

Members Datasets Scaffolds Average Seq Length
600 293 1200 366

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100012705|Ga0070682_1000127055
Length 408
Sequence LNSTINLPLHGGHAPPYLVKRMIRLSYAISKVIIDEYGQREFLKRLSDPLWFQAFGCVLGFDWHSSGVTTVVTGVLKQSIKENVHSISIAGGKGKRSLDTKNEIPLLAEKNYNLSSSKIDELLYASKIAAKIDNAALQDGYSLYHHVIFFDEYGNWAIVQQGMNSSNKMARRYHWISDNLKSFVIEPHVGIISENRNPNTLNMTSIDSNENQKICVDLVNSNINNLQSSVYKVLEITKKNASTKINTLDNWIVPQIDNTNNHAASTMESQGEYKSNNRVNMKSNSLREHYEMPRRLDWNIFRKAYDIQPKNYEQLISIPGIGPSSVRALSLIGEIIFGTSASWQDPVKYNFAHGGKDGVPYPVARKIYDKSISYLYSAIEGAEIQREERIDTLKKLAEFSNRMFDQKK

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
4 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
5 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
6 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
7 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
8 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
9 3300003380 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM Metagenome Rhizosphere
10 3300003383 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM Metagenome Rhizosphere
11 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
102 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
117 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
187 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
191 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
198 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
203 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
204 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
210 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
211 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
212 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
213 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
214 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
215 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
216 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
217 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
257 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
261 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
262 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
265 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
266 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
267 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
268 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
269 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
270 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
271 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
272 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
276 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
277 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.5
Rhizosphere 97.17
Stem 0
Stem Tuber 0
Unclassified 11.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_100012705 3300005337 Unclassified 4832
2 ARcpr5oldR_c000109 3300000041 Archaea 14978
3 ARcpr5oldR_c002704 3300000041 Bacteria 1614
4 ARSoilYngRDRAFT_c00260 3300000042 Archaea 8153
5 ARcpr5yngRDRAFT_c000111 3300000043 Archaea 12907
6 ARcpr5yngRDRAFT_c000730 3300000043 Archaea 4049
7 ARcpr5yngRDRAFT_c003463 3300000043 Archaea 1555
8 ARSoilOldRDRAFT_c000183 3300000044 Archaea 10231
9 ARSoilOldRDRAFT_c000693 3300000044 Archaea 3527
10 ARCol0yngRDRAFT_1000222 3300000652 Archaea 9498
11 ARCol0yngRDRAFT_1002699 3300000652 Archaea 1324
12 JGI24743J22301_10008872 3300001991 Bacteria 1772
13 JGI26145J50221_1000057 3300003371 Archaea 8317
14 JGI26144J50225_100385 3300003380 Archaea 1807
15 JGI26140J50224_100334 3300003383 Archaea 2307
16 JGI26141J51220_1000867 3300003503 Archaea 1766
17 JGI25405J52794_10006254 3300003911 Archaea 2173
18 Ga0065704_10088171 3300005289 Archaea 2906
19 Ga0065715_10101262 3300005293 Archaea 3209
20 Ga0070676_10001665 3300005328 Bacteria 11301
21 Ga0070676_10005601 3300005328 Bacteria 6691
22 Ga0070676_10008370 3300005328 Bacteria 5574
23 Ga0070676_10045000 3300005328 Archaea 2570
24 Ga0070683_100009138 3300005329 Bacteria 8459
25 Ga0070683_100181523 3300005329 Bacteria 1998
26 Ga0070683_100204269 3300005329 Bacteria 1877
27 Ga0070683_100206454 3300005329 Bacteria 1866
28 Ga0070683_100342801 3300005329 Bacteria 1423
29 Ga0070690_100055494 3300005330 Bacteria 2537
30 Ga0070670_100046989 3300005331 Archaea 3714
31 Ga0070670_100068630 3300005331 Archaea 3043
32 Ga0070670_100077862 3300005331 Bacteria 2849
33 Ga0070670_100228434 3300005331 Archaea 1619
34 Ga0068869_100032276 3300005334 Bacteria 3689
35 Ga0068869_100044028 3300005334 Archaea 3209
36 Ga0070680_100004972 3300005336 Bacteria 10013
37 Ga0070680_100012425 3300005336 Bacteria 6617
38 Ga0070680_100037210 3300005336 Archaea 3932
39 Ga0070680_100090223 3300005336 Bacteria 2537
40 Ga0070682_100003170 3300005337 Bacteria 9109
41 Ga0068868_100009832 3300005338 Bacteria 6904
42 Ga0068868_100013046 3300005338 Bacteria 6083
43 Ga0068868_100026035 3300005338 Bacteria 4455
44 Ga0068868_100036631 3300005338 Archaea 3799
45 Ga0068868_100077731 3300005338 Unclassified 2655
46 Ga0068868_100195764 3300005338 Bacteria 1683
47 Ga0070660_100289705 3300005339 Bacteria 1341
48 Ga0070687_100022336 3300005343 Archaea 2990
49 Ga0070687_100055011 3300005343 Bacteria 2076
50 Ga0070661_100006053 3300005344 Bacteria 8322
51 Ga0070692_10001465 3300005345 Bacteria 8592
52 Ga0070692_10024979 3300005345 Unclassified 2942
53 Ga0070692_10036685 3300005345 Unclassified 2489
54 Ga0070668_100018406 3300005347 Bacteria 5243
55 Ga0070669_100003750 3300005353 Bacteria 10976
56 Ga0070669_100116305 3300005353 Unclassified 2035
57 Ga0070669_100116841 3300005353 Archaea 2030
58 Ga0070675_100217372 3300005354 Bacteria 1663
59 Ga0070671_100193170 3300005355 Bacteria 1725
60 Ga0070673_100005868 3300005364 Bacteria 7918
61 Ga0070673_100015845 3300005364 Archaea 5308
62 Ga0070673_100451363 3300005364 Bacteria 1157
63 Ga0070688_100149894 3300005365 Bacteria 1593
64 Ga0070659_100031156 3300005366 Bacteria 4129
65 Ga0070667_100065702 3300005367 Bacteria 3080
66 Ga0070709_10002273 3300005434 Bacteria 10417
67 Ga0070709_10055909 3300005434 Bacteria 2493
68 Ga0070709_10103694 3300005434 Bacteria 1899
69 Ga0070709_10133149 3300005434 Archaea 1699
70 Ga0070714_100005548 3300005435 Archaea 9635
71 Ga0070714_100125293 3300005435 Archaea 2290
72 Ga0070710_10020449 3300005437 Archaea 3433
73 Ga0070710_10027390 3300005437 Archaea 3038
74 Ga0070701_10015023 3300005438 Bacteria 3564
75 Ga0070701_10021816 3300005438 Bacteria 3063
76 Ga0070711_100001043 3300005439 Archaea 14761
77 Ga0070711_100003625 3300005439 Archaea 9020
78 Ga0070711_100151157 3300005439 Archaea 1751
79 Ga0070705_100002808 3300005440 Archaea 8684
80 Ga0070705_100037280 3300005440 Unclassified 2741
81 Ga0070705_100092842 3300005440 Archaea 1885
82 Ga0070700_100007811 3300005441 Bacteria 5799
83 Ga0070700_100012632 3300005441 Bacteria 4721
84 Ga0070700_100047280 3300005441 Unclassified 2663
85 Ga0070694_100005882 3300005444 Bacteria 7438
86 Ga0070694_100007831 3300005444 Archaea 6520
87 Ga0070694_100101620 3300005444 Archaea 2035
88 Ga0070663_100064881 3300005455 Bacteria 2640
89 Ga0070663_100248396 3300005455 Bacteria 1407
90 Ga0070678_100046171 3300005456 Unclassified 3121
91 Ga0070678_100130942 3300005456 Bacteria 1993
92 Ga0070678_100251077 3300005456 Unclassified 1483
93 Ga0070662_100005746 3300005457 Bacteria 7948
94 Ga0070662_100006398 3300005457 Bacteria 7588
95 Ga0070662_100247067 3300005457 Bacteria 1433
96 Ga0070681_10006425 3300005458 Bacteria 11440
97 Ga0070681_10041806 3300005458 Archaea 4594
98 Ga0070681_10076328 3300005458 Bacteria 3310
99 Ga0070681_10289751 3300005458 Unclassified 1547
100 Ga0068867_100004379 3300005459 Bacteria 9938
101 Ga0068867_100027672 3300005459 Unclassified 4077
102 Ga0068867_100043059 3300005459 Archaea 3305
103 Ga0068867_100090003 3300005459 Unclassified 2327
104 Ga0070699_100020411 3300005518 Archaea 5715
105 Ga0070699_100172070 3300005518 Archaea 1919
106 Ga0070679_100006471 3300005530 Bacteria 10917
107 Ga0070679_100055048 3300005530 Bacteria 3961
108 Ga0070679_100103561 3300005530 Archaea 2832
109 Ga0070684_100000924 3300005535 Bacteria 20865
110 Ga0070684_100122988 3300005535 Archaea 2335
111 Ga0070697_100054026 3300005536 Bacteria 3265
112 Ga0070697_100086525 3300005536 Archaea 2586
113 Ga0070672_100110027 3300005543 Bacteria 2244
114 Ga0070672_100212540 3300005543 Bacteria 1620
115 Ga0070686_100084329 3300005544 Bacteria 2111
116 Ga0070695_100001159 3300005545 Bacteria 14462
117 Ga0070695_100035308 3300005545 Unclassified 3140
118 Ga0070695_100045033 3300005545 Bacteria 2811
119 Ga0070695_100108375 3300005545 Bacteria 1881
120 Ga0070696_100013333 3300005546 Bacteria 5514
121 Ga0070696_100015059 3300005546 Archaea 5192
122 Ga0070696_100038265 3300005546 Bacteria 3310
123 Ga0070696_100070279 3300005546 Archaea 2462
124 Ga0070693_100001135 3300005547 Bacteria 11938
125 Ga0070693_100021236 3300005547 Bacteria 3436
126 Ga0070693_100035784 3300005547 Bacteria 2757
127 Ga0070693_100044154 3300005547 Unclassified 2520
128 Ga0070693_100075325 3300005547 Bacteria 1998
129 Ga0070704_100175145 3300005549 Archaea 1710
130 Ga0070704_100187047 3300005549 Bacteria 1661
131 Ga0068855_100553461 3300005563 Bacteria 1245
132 Ga0070664_100002569 3300005564 Bacteria 14642
133 Ga0070664_100150375 3300005564 Bacteria 2055
134 Ga0070664_100224767 3300005564 Bacteria 1680
135 Ga0070664_100225989 3300005564 Unclassified 1676
136 Ga0070664_100227656 3300005564 Bacteria 1670
137 Ga0068857_100130507 3300005577 Bacteria 2266
138 Ga0068857_100238483 3300005577 Archaea 1664
139 Ga0068854_100024016 3300005578 Unclassified 4169
140 Ga0068854_100096687 3300005578 Unclassified 2207
141 Ga0068856_100037751 3300005614 Unclassified 4740
142 Ga0068856_100127961 3300005614 Bacteria 2543
143 Ga0070702_100014043 3300005615 Unclassified 4057
144 Ga0070702_100034229 3300005615 Unclassified 2799
145 Ga0068852_100000530 3300005616 Bacteria 25064
146 Ga0068852_100044235 3300005616 Bacteria 3780
147 Ga0068859_100310557 3300005617 Bacteria 1670
148 Ga0068864_100055439 3300005618 Unclassified 3422
149 Ga0068861_100002770 3300005719 Bacteria 11500
150 Ga0068861_100006935 3300005719 Bacteria 7738
151 Ga0068851_10005049 3300005834 Bacteria 5986
152 Ga0068870_10000132 3300005840 Archaea 25819
153 Ga0068870_10038986 3300005840 Archaea 2456
154 Ga0068863_100079412 3300005841 Bacteria 3107
155 Ga0068858_100053527 3300005842 Bacteria 3733
156 Ga0068860_100006087 3300005843 Bacteria 12139
157 Ga0068862_100028706 3300005844 Bacteria 4685
158 Ga0068862_100069556 3300005844 Archaea 3038
159 Ga0081455_10001665 3300005937 Bacteria 26930
160 Ga0081455_10021615 3300005937 Archaea 6030
161 Ga0081538_10118703 3300005981 Unclassified 1277
162 Ga0070717_10007182 3300006028 Archaea 8254
163 Ga0070717_10079926 3300006028 Archaea 2742
164 Ga0070715_10000311 3300006163 Archaea 12007
165 Ga0070715_10044853 3300006163 Archaea 1872
166 Ga0070716_100000468 3300006173 Archaea 16701
167 Ga0070716_100015014 3300006173 Unclassified 3974
168 Ga0070716_100018698 3300006173 Bacteria 3613
169 Ga0070716_100234185 3300006173 Archaea 1241
170 Ga0070712_100003414 3300006175 Archaea 9773
171 Ga0097621_100006445 3300006237 Unclassified 8334
172 Ga0097621_100010551 3300006237 Bacteria 6767
173 Ga0097621_100107612 3300006237 Bacteria 2353
174 Ga0068871_100016169 3300006358 Unclassified 5609
175 Ga0068871_100104170 3300006358 Unclassified 2380
176 Ga0075428_100004997 3300006844 Archaea 14734
177 Ga0075428_100031308 3300006844 Bacteria 5883
178 Ga0075428_100052559 3300006844 Archaea 4465
179 Ga0075428_100053001 3300006844 Unclassified 4444
180 Ga0075428_100205337 3300006844 Archaea 2129
181 Ga0075428_100269686 3300006844 Archaea 1831
182 Ga0075430_100000321 3300006846 Archaea 34144
183 Ga0075430_100119233 3300006846 Unclassified 2199
184 Ga0075430_100139437 3300006846 Archaea 2019
185 Ga0075430_100205954 3300006846 Archaea 1633
186 Ga0075431_100038695 3300006847 Archaea 4912
187 Ga0075431_100175788 3300006847 Unclassified 2199
188 Ga0075433_10002712 3300006852 Archaea 13525
189 Ga0075433_10022240 3300006852 Bacteria 5322
190 Ga0075433_10034365 3300006852 Bacteria 4354
191 Ga0075433_10034542 3300006852 Unclassified 4343
192 Ga0075434_100000451 3300006871 Bacteria 30624
193 Ga0075434_100003653 3300006871 Bacteria 13738
194 Ga0075434_100003830 3300006871 Archaea 13454
195 Ga0075434_100035483 3300006871 Bacteria 4930
196 Ga0075434_100182079 3300006871 Archaea 2121
197 Ga0075434_100256494 3300006871 Unclassified 1767
198 Ga0075429_100000235 3300006880 Archaea 37956
199 Ga0075429_100077255 3300006880 Bacteria 2901
200 Ga0075429_100108219 3300006880 Archaea 2429
201 Ga0075429_100130361 3300006880 Unclassified 2199
202 Ga0068865_100114412 3300006881 Bacteria 1995
203 Ga0068865_100250168 3300006881 Unclassified 1399
204 Ga0075436_100000305 3300006914 Bacteria 31481
205 Ga0075436_100006514 3300006914 Bacteria 7999
206 Ga0075436_100008242 3300006914 Archaea 7129
207 Ga0075436_100027989 3300006914 Unclassified 3879
208 Ga0075436_100036759 3300006914 Unclassified 3381
209 Ga0097620_100310558 3300006931 Bacteria 1670
210 Ga0075435_100000012 3300007076 Bacteria 108852
211 Ga0075435_100046142 3300007076 Archaea 3494
212 Ga0075435_100047204 3300007076 Bacteria 3457
213 Ga0111539_10000717 3300009094 Archaea 43068
214 Ga0111539_10001094 3300009094 Archaea 35846
215 Ga0111539_10014149 3300009094 Archaea 9965
216 Ga0111539_10031558 3300009094 Archaea 6435
217 Ga0105245_10036635 3300009098 Bacteria 4359
218 Ga0105245_10357104 3300009098 Unclassified 1449
219 Ga0114129_10000060 3300009147 Archaea 97673
220 Ga0114129_10020046 3300009147 Bacteria 9516
221 Ga0114129_10073261 3300009147 Unclassified 4771
222 Ga0114129_10115154 3300009147 Archaea 3706
223 Ga0114129_10249801 3300009147 Bacteria 2382
224 Ga0114129_10636465 3300009147 Archaea 1378
225 Ga0105243_10334487 3300009148 Bacteria 1385
226 Ga0105241_10053239 3300009174 Bacteria 3094
227 Ga0105242_10030803 3300009176 Bacteria 4285
228 Ga0105242_10158847 3300009176 Unclassified 1977
229 Ga0105248_10034290 3300009177 Bacteria 5674
230 Ga0105248_10133673 3300009177 Bacteria 2799
231 Ga0105249_10015205 3300009553 Bacteria 6810
232 Ga0105249_10062562 3300009553 Archaea 3417
233 Ga0105239_10121677 3300010375 Unclassified 2899
234 Ga0105239_10165631 3300010375 Bacteria 2471
235 Ga0105246_10012508 3300011119 Unclassified 5299
236 Ga0105246_10045304 3300011119 Archaea 2994
237 Ga0157337_1000409 3300012483 Archaea 1991
238 Ga0157345_1000537 3300012498 Archaea 3421
239 Ga0157371_10068382 3300013102 Bacteria 2514
240 Ga0157369_10202958 3300013105 Bacteria 2080
241 Ga0157374_10023590 3300013296 Archaea 5505
242 Ga0157374_10043646 3300013296 Unclassified 4143
243 Ga0157374_10062913 3300013296 Bacteria 3479
244 Ga0157378_10006292 3300013297 Bacteria 10398
245 Ga0157378_10015301 3300013297 Archaea 6720
246 Ga0157378_10021876 3300013297 Bacteria 5623
247 Ga0157378_10029836 3300013297 Archaea 4816
248 Ga0163162_10017015 3300013306 Bacteria 7114
249 Ga0163162_10185165 3300013306 Bacteria 2209
250 Ga0157372_10034252 3300013307 Unclassified 5582
251 Ga0157372_10269810 3300013307 Bacteria 1977
252 Ga0157372_10425685 3300013307 Unclassified 1547
253 Ga0157372_10641787 3300013307 Bacteria 1237
254 Ga0157375_10065600 3300013308 Archaea 3620
255 Ga0157375_10261521 3300013308 Bacteria 1892
256 Ga0157375_10290050 3300013308 Bacteria 1799
257 Ga0163163_10366983 3300014325 Bacteria 1497
258 Ga0157380_10005235 3300014326 Bacteria 9061
259 Ga0182008_10009111 3300014497 Archaea 5375
260 Ga0182008_10016842 3300014497 Archaea 3793
261 Ga0182008_10027903 3300014497 Bacteria 2856
262 Ga0157377_10000581 3300014745 Archaea 15234
263 Ga0157377_10020119 3300014745 Bacteria 3492
264 Ga0157376_10015644 3300014969 Unclassified 5737
265 Ga0157376_10103146 3300014969 Bacteria 2497
266 Ga0182007_10027820 3300015262 Archaea 1946
267 Ga0182005_1018093 3300015265 Bacteria 1948
268 Ga0206350_10214828 3300020080 Bacteria 1223
269 Ga0207697_10002927 3300025315 Bacteria 8640
270 Ga0207656_10020518 3300025321 Bacteria 2628
271 Ga0207692_10017156 3300025898 Archaea 3223
272 Ga0207692_10034099 3300025898 Bacteria 2462
273 Ga0207642_10039876 3300025899 Bacteria 2045
274 Ga0207688_10035095 3300025901 Bacteria 2778
275 Ga0207688_10141177 3300025901 Bacteria 1418
276 Ga0207647_10001264 3300025904 Archaea 19462
277 Ga0207685_10000161 3300025905 Archaea 10171
278 Ga0207699_10006288 3300025906 Archaea 5738
279 Ga0207699_10131728 3300025906 Archaea 1632
280 Ga0207645_10002001 3300025907 Bacteria 16371
281 Ga0207645_10005058 3300025907 Bacteria 9660
282 Ga0207645_10046409 3300025907 Archaea 2775
283 Ga0207643_10000469 3300025908 Archaea 26124
284 Ga0207643_10003727 3300025908 Archaea 8190
285 Ga0207643_10012883 3300025908 Unclassified 4521
286 Ga0207684_10091858 3300025910 Bacteria 2587
287 Ga0207707_10001467 3300025912 Bacteria 21819
288 Ga0207707_10009442 3300025912 Bacteria 8461
289 Ga0207707_10016298 3300025912 Bacteria 6483
290 Ga0207693_10006416 3300025915 Archaea 9747
291 Ga0207693_10023924 3300025915 Bacteria 4849
292 Ga0207693_10113064 3300025915 Bacteria 2130
293 Ga0207663_10001458 3300025916 Archaea 11005
294 Ga0207663_10002090 3300025916 Archaea 9523
295 Ga0207663_10057889 3300025916 Bacteria 2443
296 Ga0207663_10088279 3300025916 Bacteria 2050
297 Ga0207660_10005681 3300025917 Bacteria 8091
298 Ga0207662_10011220 3300025918 Bacteria 4962
299 Ga0207662_10016408 3300025918 Archaea 4179
300 Ga0207649_10009183 3300025920 Bacteria 5407
301 Ga0207649_10015132 3300025920 Bacteria 4331
302 Ga0207652_10010349 3300025921 Bacteria 7512
303 Ga0207652_10025869 3300025921 Bacteria 4883
304 Ga0207652_10144028 3300025921 Archaea 2132
305 Ga0207646_10316291 3300025922 Archaea 1411
306 Ga0207681_10004325 3300025923 Bacteria 8766
307 Ga0207681_10035919 3300025923 Archaea 3266
308 Ga0207681_10039025 3300025923 Unclassified 3150
309 Ga0207681_10178062 3300025923 Bacteria 1617
310 Ga0207650_10113794 3300025925 Bacteria 2098
311 Ga0207650_10199393 3300025925 Bacteria 1602
312 Ga0207687_10049521 3300025927 Bacteria 2921
313 Ga0207664_10145430 3300025929 Archaea 2009
314 Ga0207664_10152217 3300025929 Bacteria 1966
315 Ga0207644_10166153 3300025931 Bacteria 1719
316 Ga0207690_10125968 3300025932 Bacteria 1868
317 Ga0207690_10275274 3300025932 Bacteria 1309
318 Ga0207706_10003892 3300025933 Bacteria 14169
319 Ga0207706_10005128 3300025933 Bacteria 12226
320 Ga0207686_10096823 3300025934 Archaea 1962
321 Ga0207704_10008776 3300025938 Bacteria 4851
322 Ga0207704_10068854 3300025938 Bacteria 2233
323 Ga0207704_10221112 3300025938 Unclassified 1401
324 Ga0207665_10000515 3300025939 Bacteria 26165
325 Ga0207665_10003255 3300025939 Unclassified 10875
326 Ga0207665_10022878 3300025939 Archaea 4115
327 Ga0207665_10243146 3300025939 Bacteria 1327
328 Ga0207691_10023408 3300025940 Bacteria 5814
329 Ga0207691_10139827 3300025940 Bacteria 2134
330 Ga0207691_10221277 3300025940 Bacteria 1641
331 Ga0207711_10103813 3300025941 Bacteria 2517
332 Ga0207689_10013951 3300025942 Bacteria 6844
333 Ga0207689_10040527 3300025942 Unclassified 3855
334 Ga0207689_10056784 3300025942 Archaea 3221
335 Ga0207661_10000711 3300025944 Bacteria 21612
336 Ga0207679_10022596 3300025945 Bacteria 4285
337 Ga0207679_10122035 3300025945 Bacteria 2076
338 Ga0207679_10128262 3300025945 Unclassified 2031
339 Ga0207679_10148757 3300025945 Bacteria 1903
340 Ga0207651_10020228 3300025960 Unclassified 4012
341 Ga0207712_10005605 3300025961 Bacteria 7915
342 Ga0207712_10093210 3300025961 Archaea 2222
343 Ga0207640_10019062 3300025981 Unclassified 4046
344 Ga0207640_10107693 3300025981 Bacteria 1968
345 Ga0207677_10006032 3300026023 Bacteria 6607
346 Ga0207677_10014352 3300026023 Unclassified 4624
347 Ga0207677_10018511 3300026023 Bacteria 4182
348 Ga0207677_10035604 3300026023 Bacteria 3235
349 Ga0207677_10145191 3300026023 Bacteria 1822
350 Ga0207703_10083438 3300026035 Bacteria 2670
351 Ga0207678_10246574 3300026067 Bacteria 1530
352 Ga0207708_10008083 3300026075 Bacteria 7795
353 Ga0207708_10025251 3300026075 Unclassified 4494
354 Ga0207708_10118754 3300026075 Archaea 2059
355 Ga0207708_10165872 3300026075 Bacteria 1746
356 Ga0207702_10095676 3300026078 Bacteria 2610
357 Ga0207648_10001897 3300026089 Bacteria 22845
358 Ga0207648_10008539 3300026089 Bacteria 9911
359 Ga0207648_10012670 3300026089 Archaea 7884
360 Ga0207648_10038986 3300026089 Bacteria 4179
361 Ga0207648_10055848 3300026089 Archaea 3446
362 Ga0207648_10066721 3300026089 Unclassified 3138
363 Ga0207648_10108566 3300026089 Unclassified 2436
364 Ga0207676_10085311 3300026095 Bacteria 2577
365 Ga0207676_10183106 3300026095 Archaea 1836
366 Ga0207674_10000757 3300026116 Bacteria 42258
367 Ga0207674_10037807 3300026116 Bacteria 5016
368 Ga0207674_10081997 3300026116 Archaea 3227
369 Ga0207674_10276138 3300026116 Bacteria 1628
370 Ga0207675_100001595 3300026118 Bacteria 22714
371 Ga0207675_100007926 3300026118 Bacteria 10014
372 Ga0207683_10011982 3300026121 Bacteria 7401
373 Ga0207683_10261280 3300026121 Unclassified 1581
374 Ga0207683_10271369 3300026121 Bacteria 1550
375 Ga0207698_10005638 3300026142 Bacteria 7750
376 Ga0207698_10008191 3300026142 Bacteria 6591
377 Ga0207698_10112560 3300026142 Archaea 2285
378 Ga0209973_1000848 3300027252 Archaea 2466
379 Ga0209969_1000163 3300027360 Archaea 8820
380 Ga0209967_1000220 3300027364 Archaea 8099
381 Ga0209981_1000288 3300027378 Archaea 6424
382 Ga0209996_1000177 3300027395 Archaea 8171
383 Ga0209984_1000138 3300027424 Archaea 8416
384 Ga0210000_1000157 3300027462 Archaea 9680
385 Ga0209995_1006676 3300027471 Archaea 1855
386 Ga0209968_1004836 3300027526 Archaea 2018
387 Ga0209999_1000204 3300027543 Archaea 8221
388 Ga0209982_1000203 3300027552 Archaea 6926
389 Ga0209982_1001988 3300027552 Archaea 2835
390 Ga0209970_1001311 3300027614 Archaea 4371
391 Ga0210002_1000208 3300027617 Archaea 8405
392 Ga0210002_1001570 3300027617 Unclassified 3252
393 Ga0209983_1000722 3300027665 Archaea 7145
394 Ga0209983_1014467 3300027665 Archaea 1626
395 Ga0209971_1000828 3300027682 Archaea 7972
396 Ga0209998_10000242 3300027717 Archaea 17979
397 Ga0209998_10001486 3300027717 Archaea 5646
398 Ga0209974_10000351 3300027876 Archaea 15063
399 Ga0209974_10001406 3300027876 Archaea 8699
400 Ga0209974_10003627 3300027876 Archaea 5546
401 Ga0207428_10000230 3300027907 Archaea 77168
402 Ga0207428_10007434 3300027907 Archaea 9988
403 Ga0207428_10037021 3300027907 Archaea 3973
404 Ga0207428_10141902 3300027907 Archaea 1833
405 Ga0268265_10069280 3300028380 Archaea 2738
406 Ga0268265_10241547 3300028380 Archaea 1594
407 Ga0268264_10116397 3300028381 Bacteria 2349
408 Ga0307408_100010535 3300031548 Bacteria 6096
409 Ga0307408_100083982 3300031548 Bacteria 2387
410 Ga0307408_100137987 3300031548 Bacteria 1910
411 Ga0307408_100219453 3300031548 Bacteria 1551
412 Ga0307408_100243648 3300031548 Bacteria 1479
413 Ga0316577_10093258 3300031733 Bacteria 1686
414 Ga0307413_10027619 3300031824 Bacteria 3147
415 Ga0307413_10099171 3300031824 Bacteria 1920
416 Ga0307410_10120376 3300031852 Bacteria 1913
417 Ga0307406_10012150 3300031901 Bacteria 4903
418 Ga0307407_10008817 3300031903 Archaea 4657
419 Ga0307407_10025066 3300031903 Bacteria 3138
420 Ga0307412_10030502 3300031911 Bacteria 3396
421 Ga0307412_10220962 3300031911 Bacteria 1452
422 Ga0307409_100028943 3300031995 Archaea 3956
423 Ga0307409_100113515 3300031995 Bacteria 2277
424 Ga0307416_100004149 3300032002 Archaea 8680
425 Ga0307416_100266649 3300032002 Bacteria 1678
426 Ga0307411_10048632 3300032005 Bacteria 2750
427 Ga0307415_100119579 3300032126 Archaea 1972
428 Ga0307415_100163612 3300032126 Bacteria 1727
429 Ga0373959_0018569 3300034820 Unclassified 1310
430 Ga0373934_0005593 3300035086 Archaea 4653
431 Ga0373941_0001870 3300035115 Bacteria 4551
432 Ga0373953_0000747 3300035117 Archaea 9002
433 Ga0373953_0002770 3300035117 Archaea 5328
434 Ga0373954_0003433 3300035118 Archaea 6718
435 Ga0373954_0003749 3300035118 Archaea 6482
436 Ga0373956_0004411 3300035119 Archaea 5632
437 Ga0373956_0013904 3300035119 Archaea 3353
438 Ga0373957_0001993 3300035120 Archaea 5703
439 Ga0373955_0000781 3300035172 Archaea 13638
440 Ga0373955_0002402 3300035172 Archaea 8160
441 Ga0373961_0006412 3300035241 Archaea 2825
442 Ga0373933_0000323 3300035724 Archaea 30848
443 Ga0373933_0002587 3300035724 Archaea 10136
444 Ga0373937_0000430 3300036401 Archaea 39037
445 Ga0373937_0000570 3300036401 Archaea 32715
446 Ga0316582_0081694 3300036647 Bacteria 2112
447 Ga0242422_00673 3300038699 Archaea 2247
448 Ga0242420_000689 3300038996 Archaea 4014
449 Ga0436361_0343503 3300039447 Archaea 1404
450 Ga0439466_0016945 3300041411 Archaea 2629
451 Ga0451839_1197429 3300041496 Unclassified 2010
452 Ga0451853_1011576 3300041512 Bacteria 1571
453 Ga0439448_0027721 3300042005 Archaea 1787
454 Ga0439464_0030962 3300042439 Archaea 1500
455 Ga0439460_0008021 3300042461 Archaea 2660
456 Ga0466968_0047992 3300044735 Unclassified 1817
457 Ga0495592_0024819 3300046454 Archaea 4556
458 Ga0495651_0000594 3300046462 Archaea 28014
459 Ga0495651_0012439 3300046462 Archaea 6563
460 Ga0495653_0103642 3300046463 Archaea 2057
461 Ga0495608_0015573 3300046511 Archaea 5269
462 Ga0495608_0127931 3300046511 Archaea 1626
463 Ga0495628_0091315 3300046516 Unclassified 2357
464 Ga0495652_0004973 3300046529 Archaea 12596
465 Ga0495652_0016608 3300046529 Archaea 6581
466 Ga0495587_0000550 3300046536 Archaea 25987
467 Ga0495587_0095596 3300046536 Archaea 1715
468 Ga0495635_0098152 3300046663 Archaea 2003
469 Ga0495657_0023372 3300046675 Archaea 4417
470 Ga0495657_0159070 3300046675 Archaea 1398
471 Ga0495599_0009580 3300046678 Archaea 5925
472 Ga0495599_0028879 3300046678 Archaea 3475
473 Ga0495623_0016570 3300046679 Archaea 4761
474 Ga0495646_0036458 3300046680 Archaea 3046
475 Ga0495646_0103251 3300046680 Archaea 1631
476 Ga0495684_0261082 3300047471 Archaea 1256
477 Ga0495602_0000512 3300048088 Archaea 36149
478 Ga0495602_0008551 3300048088 Archaea 10688
479 Ga0496100_0076154 3300048903 Bacteria 2252
480 Ga0496102_0231645 3300048905 Bacteria 1741
481 Ga0496104_0123411 3300048907 Bacteria 2486
482 Ga0496106_0009866 3300048909 Archaea 7050
483 Ga0496106_0058664 3300048909 Archaea 2914
484 Ga0496106_0134567 3300048909 Archaea 1940
485 Ga0496107_0046883 3300048910 Bacteria 3111
486 Ga0496107_0126537 3300048910 Archaea 1884
487 Ga0496108_0046513 3300048911 Bacteria 3625
488 Ga0496109_0079425 3300048912 Bacteria 3022
489 Ga0496110_0155594 3300048913 Bacteria 2071
490 Ga0496112_0007025 3300048915 Bacteria 9944
491 Ga0496112_0014771 3300048915 Bacteria 7261
492 Ga0496113_0086438 3300048916 Unclassified 2410
493 Ga0496114_0200450 3300048917 Bacteria 1748
494 Ga0501298_008154 3300049521 Bacteria 1753
495 Ga0501031_0017506 3300049568 Archaea 4658
496 Ga0501033_0003050 3300049570 Archaea 13927
497 Ga0501037_0010084 3300049573 Archaea 6931
498 Ga0501037_0010660 3300049573 Archaea 6756
499 Ga0501038_0001905 3300049574 Archaea 19295
500 Ga0501038_0053206 3300049574 Archaea 3487
501 Ga0501038_0064229 3300049574 Archaea 3131
502 Ga0501039_0000412 3300049575 Archaea 30697
503 Ga0501039_0065559 3300049575 Archaea 2817
504 Ga0501040_0035764 3300049576 Archaea 3369
505 Ga0501041_0000284 3300049577 Archaea 24371
506 Ga0501041_0021428 3300049577 Archaea 3872
507 Ga0501042_0005486 3300049578 Archaea 8175
508 Ga0501042_0022530 3300049578 Archaea 4400
509 Ga0501042_0050933 3300049578 Archaea 2954
510 Ga0501042_0066157 3300049578 Archaea 2583
511 Ga0501043_0012307 3300049579 Archaea 6688
512 Ga0501046_0000970 3300049580 Bacteria 28102
513 Ga0501046_0062678 3300049580 Archaea 2905
514 Ga0501046_0107986 3300049580 Archaea 2129
515 Ga0501048_0003023 3300049582 Archaea 12839
516 Ga0501048_0231420 3300049582 Archaea 1311
517 Ga0501067_0085256 3300049583 Archaea 1753
518 Ga0501068_0027666 3300049584 Archaea 3349
519 Ga0501071_0001994 3300049587 Bacteria 12203
520 Ga0501071_0214331 3300049587 Archaea 1448
521 Ga0501072_0000138 3300049588 Archaea 54437
522 Ga0501072_0014246 3300049588 Archaea 6093
523 Ga0501072_0089125 3300049588 Archaea 2448
524 Ga0501072_0193899 3300049588 Archaea 1620
525 Ga0501074_0000837 3300049590 Archaea 19557
526 Ga0501074_0087472 3300049590 Archaea 2232
527 Ga0501075_0000369 3300049591 Archaea 25835
528 Ga0501075_0010984 3300049591 Archaea 6388
529 Ga0501075_0085041 3300049591 Unclassified 2396
530 Ga0501075_0209226 3300049591 Archaea 1488
531 Ga0501076_0016408 3300049592 Archaea 5615
532 Ga0501076_0037426 3300049592 Archaea 3805
533 Ga0501076_0188825 3300049592 Archaea 1681
534 Ga0501077_0000519 3300049593 Bacteria 23338
535 Ga0501077_0131763 3300049593 Archaea 1585
536 Ga0501202_000609 3300049652 Bacteria 5258
537 Ga0501216_002006 3300049660 Bacteria 2834
538 Ga0501233_000274 3300049668 Bacteria 7876
539 Ga0501235_000068 3300049669 Bacteria 16300
540 Ga0501242_002428 3300049674 Bacteria 1958
541 Ga0501247_002550 3300049677 Unclassified 1900
542 Ga0501249_005140 3300049679 Bacteria 2673
543 Ga0501250_008329 3300049680 Unclassified 1142
544 Ga0501234_000647 3300049707 Bacteria 5377
545 Ga0501079_0000546 3300049741 Archaea 24550
546 Ga0501079_0155395 3300049741 Archaea 1783
547 Ga0501080_0016414 3300049742 Archaea 6838
548 Ga0501080_0285170 3300049742 Archaea 1500
549 Ga0501081_0002633 3300049743 Archaea 11346
550 Ga0501081_0007769 3300049743 Archaea 6953
551 Ga0501081_0092934 3300049743 Archaea 2123
552 Ga0501081_0130655 3300049743 Archaea 1794
553 Ga0501083_0095895 3300049744 Archaea 1957
554 Ga0501241_005044 3300049758 Unclassified 2468
555 Ga0501035_0415259 3300049822 Archaea 1118
556 Ga0501044_0270500 3300049823 Archaea 1635
557 Ga0501044_0347789 3300049823 Archaea 1403
558 Ga0501045_0000416 3300049824 Archaea 25896
559 Ga0501045_0042927 3300049824 Unclassified 3292
560 Ga0501045_0049327 3300049824 Archaea 3069
561 nmdc:mga05p37_25362_c1 3300050507 Archaea 7210
562 nmdc:mga05p37_45343_c1 3300050507 Bacteria 5408
563 nmdc:mga09592_20878_c1 3300050508 Archaea 5393
564 nmdc:mga09592_2348_c1 3300050508 Archaea 15278
565 nmdc:mga0qj67_15649_c1 3300050509 Archaea 5746
566 nmdc:mga0qj67_666_c1 3300050509 Archaea 23561
567 nmdc:mga0qj67_78504_c1 3300050509 Archaea 2643
568 nmdc:mga06r32_1713_c1 3300050510 Archaea 19748
569 nmdc:mga06r32_275289_c1 3300050510 Archaea 1671
570 nmdc:mga08y16_136470_c1 3300050511 Bacteria 2550
571 nmdc:mga08y16_181763_c1 3300050511 Archaea 2184
572 nmdc:mga08y16_21075_c1 3300050511 Archaea 6882
573 nmdc:mga08y16_3927_c1 3300050511 Archaea 15483
574 nmdc:mga08y16_6276_c1 3300050511 Archaea 12463
575 nmdc:mga0n895_12_c1 3300050512 Bacteria 112043
576 nmdc:mga0n895_149026_c1 3300050512 Archaea 2369
577 nmdc:mga0n895_2472_c1 3300050512 Archaea 13588
578 nmdc:mga0n895_27449_c1 3300050512 Bacteria 5408
579 nmdc:mga0rr50_183665_c1 3300050513 Archaea 1711
580 nmdc:mga0rr50_18374_c1 3300050513 Bacteria 4696
581 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
582 nmdc:mga0rr50_962_c1 3300050513 Archaea 15617
583 nmdc:mga08x19_18959_c2 3300050514 Unclassified 3038
584 nmdc:mga08x19_19665_c1 3300050514 Unclassified 3391
585 nmdc:mga08x19_87_c1 3300050514 Bacteria 83168
586 nmdc:mga0a205_116213_c1 3300050515 Unclassified 2574
587 nmdc:mga0a205_168160_c1 3300050515 Archaea 2088
588 nmdc:mga0a205_2621_c1 3300050515 Archaea 15885
589 nmdc:mga0a205_4877_c1 3300050515 Bacteria 12068
590 Ga0495619_0000496 3300053085 Archaea 26409
591 Ga0495619_0006184 3300053085 Archaea 7587
592 Ga0501084_0001784 3300054114 Bacteria 17123
593 Ga0501084_0019642 3300054114 Archaea 5630
594 Ga0501084_0061309 3300054114 Archaea 3149
595 Ga0501082_0074239 3300060353 Archaea 2929
596 Ga0530510_0001582 3300061734 Archaea 15348
597 Ga0530510_0015376 3300061734 Archaea 5408
598 Ga0530510_0083872 3300061734 Archaea 2321
599 Ga0530510_0172817 3300061734 Archaea 1601
600 Ga0530510_0186655 3300061734 Archaea 1538
601 Ga0070682_100012705
602 ARcpr5oldR_c000109
603 ARcpr5oldR_c002704
604 ARSoilYngRDRAFT_c00260
605 ARcpr5yngRDRAFT_c000111
606 ARcpr5yngRDRAFT_c000730
607 ARcpr5yngRDRAFT_c003463
608 ARSoilOldRDRAFT_c000183
609 ARSoilOldRDRAFT_c000693
610 ARCol0yngRDRAFT_1000222
611 ARCol0yngRDRAFT_1002699
612 JGI24743J22301_10008872
613 JGI26145J50221_1000057
614 JGI26144J50225_100385
615 JGI26140J50224_100334
616 JGI26141J51220_1000867
617 JGI25405J52794_10006254
618 Ga0065704_10088171
619 Ga0065715_10101262
620 Ga0070676_10001665
621 Ga0070676_10005601
622 Ga0070676_10008370
623 Ga0070676_10045000
624 Ga0070683_100009138
625 Ga0070683_100181523
626 Ga0070683_100204269
627 Ga0070683_100206454
628 Ga0070683_100342801
629 Ga0070690_100055494
630 Ga0070670_100046989
631 Ga0070670_100068630
632 Ga0070670_100077862
633 Ga0070670_100228434
634 Ga0068869_100032276
635 Ga0068869_100044028
636 Ga0070680_100004972
637 Ga0070680_100012425
638 Ga0070680_100037210
639 Ga0070680_100090223
640 Ga0070682_100003170
641 Ga0068868_100009832
642 Ga0068868_100013046
643 Ga0068868_100026035
644 Ga0068868_100036631
645 Ga0068868_100077731
646 Ga0068868_100195764
647 Ga0070660_100289705
648 Ga0070687_100022336
649 Ga0070687_100055011
650 Ga0070661_100006053
651 Ga0070692_10001465
652 Ga0070692_10024979
653 Ga0070692_10036685
654 Ga0070668_100018406
655 Ga0070669_100003750
656 Ga0070669_100116305
657 Ga0070669_100116841
658 Ga0070675_100217372
659 Ga0070671_100193170
660 Ga0070673_100005868
661 Ga0070673_100015845
662 Ga0070673_100451363
663 Ga0070688_100149894
664 Ga0070659_100031156
665 Ga0070667_100065702
666 Ga0070709_10002273
667 Ga0070709_10055909
668 Ga0070709_10103694
669 Ga0070709_10133149
670 Ga0070714_100005548
671 Ga0070714_100125293
672 Ga0070710_10020449
673 Ga0070710_10027390
674 Ga0070701_10015023
675 Ga0070701_10021816
676 Ga0070711_100001043
677 Ga0070711_100003625
678 Ga0070711_100151157
679 Ga0070705_100002808
680 Ga0070705_100037280
681 Ga0070705_100092842
682 Ga0070700_100007811
683 Ga0070700_100012632
684 Ga0070700_100047280
685 Ga0070694_100005882
686 Ga0070694_100007831
687 Ga0070694_100101620
688 Ga0070663_100064881
689 Ga0070663_100248396
690 Ga0070678_100046171
691 Ga0070678_100130942
692 Ga0070678_100251077
693 Ga0070662_100005746
694 Ga0070662_100006398
695 Ga0070662_100247067
696 Ga0070681_10006425
697 Ga0070681_10041806
698 Ga0070681_10076328
699 Ga0070681_10289751
700 Ga0068867_100004379
701 Ga0068867_100027672
702 Ga0068867_100043059
703 Ga0068867_100090003
704 Ga0070699_100020411
705 Ga0070699_100172070
706 Ga0070679_100006471
707 Ga0070679_100055048
708 Ga0070679_100103561
709 Ga0070684_100000924
710 Ga0070684_100122988
711 Ga0070697_100054026
712 Ga0070697_100086525
713 Ga0070672_100110027
714 Ga0070672_100212540
715 Ga0070686_100084329
716 Ga0070695_100001159
717 Ga0070695_100035308
718 Ga0070695_100045033
719 Ga0070695_100108375
720 Ga0070696_100013333
721 Ga0070696_100015059
722 Ga0070696_100038265
723 Ga0070696_100070279
724 Ga0070693_100001135
725 Ga0070693_100021236
726 Ga0070693_100035784
727 Ga0070693_100044154
728 Ga0070693_100075325
729 Ga0070704_100175145
730 Ga0070704_100187047
731 Ga0068855_100553461
732 Ga0070664_100002569
733 Ga0070664_100150375
734 Ga0070664_100224767
735 Ga0070664_100225989
736 Ga0070664_100227656
737 Ga0068857_100130507
738 Ga0068857_100238483
739 Ga0068854_100024016
740 Ga0068854_100096687
741 Ga0068856_100037751
742 Ga0068856_100127961
743 Ga0070702_100014043
744 Ga0070702_100034229
745 Ga0068852_100000530
746 Ga0068852_100044235
747 Ga0068859_100310557
748 Ga0068864_100055439
749 Ga0068861_100002770
750 Ga0068861_100006935
751 Ga0068851_10005049
752 Ga0068870_10000132
753 Ga0068870_10038986
754 Ga0068863_100079412
755 Ga0068858_100053527
756 Ga0068860_100006087
757 Ga0068862_100028706
758 Ga0068862_100069556
759 Ga0081455_10001665
760 Ga0081455_10021615
761 Ga0081538_10118703
762 Ga0070717_10007182
763 Ga0070717_10079926
764 Ga0070715_10000311
765 Ga0070715_10044853
766 Ga0070716_100000468
767 Ga0070716_100015014
768 Ga0070716_100018698
769 Ga0070716_100234185
770 Ga0070712_100003414
771 Ga0097621_100006445
772 Ga0097621_100010551
773 Ga0097621_100107612
774 Ga0068871_100016169
775 Ga0068871_100104170
776 Ga0075428_100004997
777 Ga0075428_100031308
778 Ga0075428_100052559
779 Ga0075428_100053001
780 Ga0075428_100205337
781 Ga0075428_100269686
782 Ga0075430_100000321
783 Ga0075430_100119233
784 Ga0075430_100139437
785 Ga0075430_100205954
786 Ga0075431_100038695
787 Ga0075431_100175788
788 Ga0075433_10002712
789 Ga0075433_10022240
790 Ga0075433_10034365
791 Ga0075433_10034542
792 Ga0075434_100000451
793 Ga0075434_100003653
794 Ga0075434_100003830
795 Ga0075434_100035483
796 Ga0075434_100182079
797 Ga0075434_100256494
798 Ga0075429_100000235
799 Ga0075429_100077255
800 Ga0075429_100108219
801 Ga0075429_100130361
802 Ga0068865_100114412
803 Ga0068865_100250168
804 Ga0075436_100000305
805 Ga0075436_100006514
806 Ga0075436_100008242
807 Ga0075436_100027989
808 Ga0075436_100036759
809 Ga0097620_100310558
810 Ga0075435_100000012
811 Ga0075435_100046142
812 Ga0075435_100047204
813 Ga0111539_10000717
814 Ga0111539_10001094
815 Ga0111539_10014149
816 Ga0111539_10031558
817 Ga0105245_10036635
818 Ga0105245_10357104
819 Ga0114129_10000060
820 Ga0114129_10020046
821 Ga0114129_10073261
822 Ga0114129_10115154
823 Ga0114129_10249801
824 Ga0114129_10636465
825 Ga0105243_10334487
826 Ga0105241_10053239
827 Ga0105242_10030803
828 Ga0105242_10158847
829 Ga0105248_10034290
830 Ga0105248_10133673
831 Ga0105249_10015205
832 Ga0105249_10062562
833 Ga0105239_10121677
834 Ga0105239_10165631
835 Ga0105246_10012508
836 Ga0105246_10045304
837 Ga0157337_1000409
838 Ga0157345_1000537
839 Ga0157371_10068382
840 Ga0157369_10202958
841 Ga0157374_10023590
842 Ga0157374_10043646
843 Ga0157374_10062913
844 Ga0157378_10006292
845 Ga0157378_10015301
846 Ga0157378_10021876
847 Ga0157378_10029836
848 Ga0163162_10017015
849 Ga0163162_10185165
850 Ga0157372_10034252
851 Ga0157372_10269810
852 Ga0157372_10425685
853 Ga0157372_10641787
854 Ga0157375_10065600
855 Ga0157375_10261521
856 Ga0157375_10290050
857 Ga0163163_10366983
858 Ga0157380_10005235
859 Ga0182008_10009111
860 Ga0182008_10016842
861 Ga0182008_10027903
862 Ga0157377_10000581
863 Ga0157377_10020119
864 Ga0157376_10015644
865 Ga0157376_10103146
866 Ga0182007_10027820
867 Ga0182005_1018093
868 Ga0206350_10214828
869 Ga0207697_10002927
870 Ga0207656_10020518
871 Ga0207692_10017156
872 Ga0207692_10034099
873 Ga0207642_10039876
874 Ga0207688_10035095
875 Ga0207688_10141177
876 Ga0207647_10001264
877 Ga0207685_10000161
878 Ga0207699_10006288
879 Ga0207699_10131728
880 Ga0207645_10002001
881 Ga0207645_10005058
882 Ga0207645_10046409
883 Ga0207643_10000469
884 Ga0207643_10003727
885 Ga0207643_10012883
886 Ga0207684_10091858
887 Ga0207707_10001467
888 Ga0207707_10009442
889 Ga0207707_10016298
890 Ga0207693_10006416
891 Ga0207693_10023924
892 Ga0207693_10113064
893 Ga0207663_10001458
894 Ga0207663_10002090
895 Ga0207663_10057889
896 Ga0207663_10088279
897 Ga0207660_10005681
898 Ga0207662_10011220
899 Ga0207662_10016408
900 Ga0207649_10009183
901 Ga0207649_10015132
902 Ga0207652_10010349
903 Ga0207652_10025869
904 Ga0207652_10144028
905 Ga0207646_10316291
906 Ga0207681_10004325
907 Ga0207681_10035919
908 Ga0207681_10039025
909 Ga0207681_10178062
910 Ga0207650_10113794
911 Ga0207650_10199393
912 Ga0207687_10049521
913 Ga0207664_10145430
914 Ga0207664_10152217
915 Ga0207644_10166153
916 Ga0207690_10125968
917 Ga0207690_10275274
918 Ga0207706_10003892
919 Ga0207706_10005128
920 Ga0207686_10096823
921 Ga0207704_10008776
922 Ga0207704_10068854
923 Ga0207704_10221112
924 Ga0207665_10000515
925 Ga0207665_10003255
926 Ga0207665_10022878
927 Ga0207665_10243146
928 Ga0207691_10023408
929 Ga0207691_10139827
930 Ga0207691_10221277
931 Ga0207711_10103813
932 Ga0207689_10013951
933 Ga0207689_10040527
934 Ga0207689_10056784
935 Ga0207661_10000711
936 Ga0207679_10022596
937 Ga0207679_10122035
938 Ga0207679_10128262
939 Ga0207679_10148757
940 Ga0207651_10020228
941 Ga0207712_10005605
942 Ga0207712_10093210
943 Ga0207640_10019062
944 Ga0207640_10107693
945 Ga0207677_10006032
946 Ga0207677_10014352
947 Ga0207677_10018511
948 Ga0207677_10035604
949 Ga0207677_10145191
950 Ga0207703_10083438
951 Ga0207678_10246574
952 Ga0207708_10008083
953 Ga0207708_10025251
954 Ga0207708_10118754
955 Ga0207708_10165872
956 Ga0207702_10095676
957 Ga0207648_10001897
958 Ga0207648_10008539
959 Ga0207648_10012670
960 Ga0207648_10038986
961 Ga0207648_10055848
962 Ga0207648_10066721
963 Ga0207648_10108566
964 Ga0207676_10085311
965 Ga0207676_10183106
966 Ga0207674_10000757
967 Ga0207674_10037807
968 Ga0207674_10081997
969 Ga0207674_10276138
970 Ga0207675_100001595
971 Ga0207675_100007926
972 Ga0207683_10011982
973 Ga0207683_10261280
974 Ga0207683_10271369
975 Ga0207698_10005638
976 Ga0207698_10008191
977 Ga0207698_10112560
978 Ga0209973_1000848
979 Ga0209969_1000163
980 Ga0209967_1000220
981 Ga0209981_1000288
982 Ga0209996_1000177
983 Ga0209984_1000138
984 Ga0210000_1000157
985 Ga0209995_1006676
986 Ga0209968_1004836
987 Ga0209999_1000204
988 Ga0209982_1000203
989 Ga0209982_1001988
990 Ga0209970_1001311
991 Ga0210002_1000208
992 Ga0210002_1001570
993 Ga0209983_1000722
994 Ga0209983_1014467
995 Ga0209971_1000828
996 Ga0209998_10000242
997 Ga0209998_10001486
998 Ga0209974_10000351
999 Ga0209974_10001406
1000 Ga0209974_10003627
1001 Ga0207428_10000230
1002 Ga0207428_10007434
1003 Ga0207428_10037021
1004 Ga0207428_10141902
1005 Ga0268265_10069280
1006 Ga0268265_10241547
1007 Ga0268264_10116397
1008 Ga0307408_100010535
1009 Ga0307408_100083982
1010 Ga0307408_100137987
1011 Ga0307408_100219453
1012 Ga0307408_100243648
1013 Ga0316577_10093258
1014 Ga0307413_10027619
1015 Ga0307413_10099171
1016 Ga0307410_10120376
1017 Ga0307406_10012150
1018 Ga0307407_10008817
1019 Ga0307407_10025066
1020 Ga0307412_10030502
1021 Ga0307412_10220962
1022 Ga0307409_100028943
1023 Ga0307409_100113515
1024 Ga0307416_100004149
1025 Ga0307416_100266649
1026 Ga0307411_10048632
1027 Ga0307415_100119579
1028 Ga0307415_100163612
1029 Ga0373959_0018569
1030 Ga0373934_0005593
1031 Ga0373941_0001870
1032 Ga0373953_0000747
1033 Ga0373953_0002770
1034 Ga0373954_0003433
1035 Ga0373954_0003749
1036 Ga0373956_0004411
1037 Ga0373956_0013904
1038 Ga0373957_0001993
1039 Ga0373955_0000781
1040 Ga0373955_0002402
1041 Ga0373961_0006412
1042 Ga0373933_0000323
1043 Ga0373933_0002587
1044 Ga0373937_0000430
1045 Ga0373937_0000570
1046 Ga0316582_0081694
1047 Ga0242422_00673
1048 Ga0242420_000689
1049 Ga0436361_0343503
1050 Ga0439466_0016945
1051 Ga0451839_1197429
1052 Ga0451853_1011576
1053 Ga0439448_0027721
1054 Ga0439464_0030962
1055 Ga0439460_0008021
1056 Ga0466968_0047992
1057 Ga0495592_0024819
1058 Ga0495651_0000594
1059 Ga0495651_0012439
1060 Ga0495653_0103642
1061 Ga0495608_0015573
1062 Ga0495608_0127931
1063 Ga0495628_0091315
1064 Ga0495652_0004973
1065 Ga0495652_0016608
1066 Ga0495587_0000550
1067 Ga0495587_0095596
1068 Ga0495635_0098152
1069 Ga0495657_0023372
1070 Ga0495657_0159070
1071 Ga0495599_0009580
1072 Ga0495599_0028879
1073 Ga0495623_0016570
1074 Ga0495646_0036458
1075 Ga0495646_0103251
1076 Ga0495684_0261082
1077 Ga0495602_0000512
1078 Ga0495602_0008551
1079 Ga0496100_0076154
1080 Ga0496102_0231645
1081 Ga0496104_0123411
1082 Ga0496106_0009866
1083 Ga0496106_0058664
1084 Ga0496106_0134567
1085 Ga0496107_0046883
1086 Ga0496107_0126537
1087 Ga0496108_0046513
1088 Ga0496109_0079425
1089 Ga0496110_0155594
1090 Ga0496112_0007025
1091 Ga0496112_0014771
1092 Ga0496113_0086438
1093 Ga0496114_0200450
1094 Ga0501298_008154
1095 Ga0501031_0017506
1096 Ga0501033_0003050
1097 Ga0501037_0010084
1098 Ga0501037_0010660
1099 Ga0501038_0001905
1100 Ga0501038_0053206
1101 Ga0501038_0064229
1102 Ga0501039_0000412
1103 Ga0501039_0065559
1104 Ga0501040_0035764
1105 Ga0501041_0000284
1106 Ga0501041_0021428
1107 Ga0501042_0005486
1108 Ga0501042_0022530
1109 Ga0501042_0050933
1110 Ga0501042_0066157
1111 Ga0501043_0012307
1112 Ga0501046_0000970
1113 Ga0501046_0062678
1114 Ga0501046_0107986
1115 Ga0501048_0003023
1116 Ga0501048_0231420
1117 Ga0501067_0085256
1118 Ga0501068_0027666
1119 Ga0501071_0001994
1120 Ga0501071_0214331
1121 Ga0501072_0000138
1122 Ga0501072_0014246
1123 Ga0501072_0089125
1124 Ga0501072_0193899
1125 Ga0501074_0000837
1126 Ga0501074_0087472
1127 Ga0501075_0000369
1128 Ga0501075_0010984
1129 Ga0501075_0085041
1130 Ga0501075_0209226
1131 Ga0501076_0016408
1132 Ga0501076_0037426
1133 Ga0501076_0188825
1134 Ga0501077_0000519
1135 Ga0501077_0131763
1136 Ga0501202_000609
1137 Ga0501216_002006
1138 Ga0501233_000274
1139 Ga0501235_000068
1140 Ga0501242_002428
1141 Ga0501247_002550
1142 Ga0501249_005140
1143 Ga0501250_008329
1144 Ga0501234_000647
1145 Ga0501079_0000546
1146 Ga0501079_0155395
1147 Ga0501080_0016414
1148 Ga0501080_0285170
1149 Ga0501081_0002633
1150 Ga0501081_0007769
1151 Ga0501081_0092934
1152 Ga0501081_0130655
1153 Ga0501083_0095895
1154 Ga0501241_005044
1155 Ga0501035_0415259
1156 Ga0501044_0270500
1157 Ga0501044_0347789
1158 Ga0501045_0000416
1159 Ga0501045_0042927
1160 Ga0501045_0049327
1161 nmdc:mga05p37_25362_c1
1162 nmdc:mga05p37_45343_c1
1163 nmdc:mga09592_20878_c1
1164 nmdc:mga09592_2348_c1
1165 nmdc:mga0qj67_15649_c1
1166 nmdc:mga0qj67_666_c1
1167 nmdc:mga0qj67_78504_c1
1168 nmdc:mga06r32_1713_c1
1169 nmdc:mga06r32_275289_c1
1170 nmdc:mga08y16_136470_c1
1171 nmdc:mga08y16_181763_c1
1172 nmdc:mga08y16_21075_c1
1173 nmdc:mga08y16_3927_c1
1174 nmdc:mga08y16_6276_c1
1175 nmdc:mga0n895_12_c1
1176 nmdc:mga0n895_149026_c1
1177 nmdc:mga0n895_2472_c1
1178 nmdc:mga0n895_27449_c1
1179 nmdc:mga0rr50_183665_c1
1180 nmdc:mga0rr50_18374_c1
1181 nmdc:mga0rr50_1_c1
1182 nmdc:mga0rr50_962_c1
1183 nmdc:mga08x19_18959_c2
1184 nmdc:mga08x19_19665_c1
1185 nmdc:mga08x19_87_c1
1186 nmdc:mga0a205_116213_c1
1187 nmdc:mga0a205_168160_c1
1188 nmdc:mga0a205_2621_c1
1189 nmdc:mga0a205_4877_c1
1190 Ga0495619_0000496
1191 Ga0495619_0006184
1192 Ga0501084_0001784
1193 Ga0501084_0019642
1194 Ga0501084_0061309
1195 Ga0501082_0074239
1196 Ga0530510_0001582
1197 Ga0530510_0015376
1198 Ga0530510_0083872
1199 Ga0530510_0172817
1200 Ga0530510_0186655

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05559

DUF763

Protein of unknown function (DUF763)

3

363

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vkb-assembly1.cif.gz_A crystal structure of the a bacterial kinase complex 0.674 348 388
3m6j-assembly1.cif.gz_B crystal structure of unknown function protein from leptospirillum rubarum 0.6468 351 394
4xdi-assembly2.cif.gz_B structure of chlamydomonas reinhardtii thb1 0.6 348 389
5uc3-assembly1.cif.gz_B-2 structure of the dominant negative mutant glucocorticoid receptor alpha (l733k/n734p) complexed with ru-486 0.5999 350 390
4k61-assembly2.cif.gz_B crystal structure of a duf2874 family protein (bacuni_01296) from bacteroides uniformis atcc 8492 at 1.70 a resolution 0.5727 124 178
ID Description Score Start End Superfamily
af_A0A1D6FJ66_136_209_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.8419 349 388 1.20.930.10
af_A0A1D6F5P2_114_190_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.8367 349 390 1.20.930.10
af_K7TPT0_120_195_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.812 346 390 1.20.930.10
af_A4I943_4_175_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7999 350 392 1.25.10.10
af_Q14CH7_789_871_1.20.1440.50 Mainly Alpha;Up-down Bundle;de novo design (two linked rop proteins);Ta0600-like 0.7731 351 390 1.20.1440.50
ID Description Score Start End GO Terms
AF-A0A2V2UGB1-F1-model_v4 DUF763 domain-containing protein 0.9734 5 220
AF-A0A151BPC4-F1-model_v4 DUF763 domain-containing protein 0.9679 25 215
AF-A0A7C0XE81-F1-model_v4 DUF763 domain-containing protein 0.9618 5 177
AF-A0A531KG94-F1-model_v4 DUF763 domain-containing protein 0.9576 10 172
AF-A0A5C6ETQ3-F1-model_v4 DUF763 domain-containing protein 0.9565 25 190

Map