metagRoot

F467941

General Info

Members	Datasets	Scaffolds	Average Seq Length
600	246	600	68

Family's Representative Sequence

Representative Sequence	3300005328\|Ga0070676_10167547\|Ga0070676_101675472
Length	83
Sequence	LGLNQVKVEKAKVRYMVAKKAQGAAGKRIKVTLVKSTIGFNRTQDETVIGLGLRRLNHTVELADTPETRGMIHKVRHLVTVQE

Samples

	Sample ID	Description	Type	Environment
1	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
2	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
3	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
4	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
5	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
6	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
7	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
8	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
9	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
10	3300004798	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
11	3300004801	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
12	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
13	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
14	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
15	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
16	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
17	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
18	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
19	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
20	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
21	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
22	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
23	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
24	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
25	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
26	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
27	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
28	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
29	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
30	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
31	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
32	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
33	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
34	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
35	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
36	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
37	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
38	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
39	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
40	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
41	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
42	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
43	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
44	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
45	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
46	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
47	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
48	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
49	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
50	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
51	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
52	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
53	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
54	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
55	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
56	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
57	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
58	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
59	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
60	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
61	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
62	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
63	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
64	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
65	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
66	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
67	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
68	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
69	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
70	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
71	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
72	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
73	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
74	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
75	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
76	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
77	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
78	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
79	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
80	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
81	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
82	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
83	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
84	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
86	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
87	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
88	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
89	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
90	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
91	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
92	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
93	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
94	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
95	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
96	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
97	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
98	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
99	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
100	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
101	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
102	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
103	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
104	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
105	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
106	3300012480	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610	Metagenome	Rhizosphere
107	3300012512	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510	Metagenome	Rhizosphere
108	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
109	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
110	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
111	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
112	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
113	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
114	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
115	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
116	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
117	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
118	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
119	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300027614	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
167	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
170	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
171	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
172	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
173	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
174	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
175	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
176	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
177	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
178	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
179	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
180	3300042133	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134	Metagenome	Rhizosphere
181	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
182	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
183	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
184	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
185	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
186	3300042530	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047	Metagenome	Rhizosphere
187	3300042532	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92	Metagenome	Rhizosphere
188	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
189	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
190	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
191	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
192	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
193	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
194	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
195	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
196	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
197	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
198	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
199	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
200	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
201	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
202	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
203	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
204	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
205	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
206	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
207	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
208	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
209	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
210	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
211	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
212	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
213	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
214	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
215	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
217	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
218	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
219	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
220	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
221	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
222	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
223	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
224	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
225	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
226	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
227	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
228	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
230	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
231	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
232	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
233	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
234	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
235	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
236	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
237	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
238	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
239	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
240	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
241	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
242	3300059423	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
243	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
244	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
245	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
246	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.5
Metatranscriptomes	0.5
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	1.17
Rhizosphere	98.17
Stem	0
Stem Tuber	0
Unclassified	0.67

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1011539	3300001977	Bacteria	1298
2	JGI24743J22301_10070352	3300001991	Bacteria	729
3	JGI24748J21848_1037516	3300002074	Unclassified	611
4	JGI24749J21850_1013877	3300002076	Bacteria	1131
5	JGI24749J21850_1018479	3300002076	Bacteria	984
6	JGI24035J26624_1044302	3300002126	Unclassified	501
7	JGI24033J26618_1001778	3300002155	Bacteria	2158
8	JGI24034J26672_10040382	3300002239	Bacteria	782
9	JGI24751J29686_10013286	3300002459	Bacteria	1699
10	JGI25406J46586_10002509	3300003203	Bacteria	8686
11	Ga0058859_11814076	3300004798	Bacteria	2090
12	Ga0058860_11993677	3300004801	Bacteria	799
13	Ga0058860_12007707	3300004801	Bacteria	848
14	Ga0065714_10124682	3300005288	Bacteria	1308
15	Ga0065704_10216868	3300005289	Bacteria	1088
16	Ga0065704_10344543	3300005289	Bacteria	818
17	Ga0065704_10642034	3300005289	Bacteria	587
18	Ga0065712_10001248	3300005290	Bacteria	11167
19	Ga0065712_10001330	3300005290	Bacteria	7767
20	Ga0065715_10001224	3300005293	Bacteria	10036
21	Ga0065715_10039766	3300005293	Bacteria	1322
22	Ga0065715_10093177	3300005293	Bacteria	4779
23	Ga0065707_10005266	3300005295	Bacteria	3607
24	Ga0065707_10009445	3300005295	Bacteria	2588
25	Ga0065707_10284231	3300005295	Bacteria	1040
26	Ga0065707_10822240	3300005295	Bacteria	592
27	Ga0070676_10167547	3300005328	Bacteria	1418
28	Ga0070676_10479504	3300005328	Bacteria	879
29	Ga0070690_100255316	3300005330	Bacteria	1241
30	Ga0070670_100010048	3300005331	Bacteria	8078
31	Ga0070670_100148317	3300005331	Bacteria	2030
32	Ga0070670_100598146	3300005331	Bacteria	987
33	Ga0070677_10004427	3300005333	Bacteria	4587
34	Ga0070677_10012225	3300005333	Bacteria	2977
35	Ga0070677_10459236	3300005333	Bacteria	683
36	Ga0070677_10553755	3300005333	Bacteria	631
37	Ga0068869_100017119	3300005334	Bacteria	4906
38	Ga0068869_100282195	3300005334	Bacteria	1336
39	Ga0068869_100408049	3300005334	Bacteria	1119
40	Ga0070666_10065659	3300005335	Bacteria	2462
41	Ga0070666_10117981	3300005335	Bacteria	1839
42	Ga0070666_10125087	3300005335	Bacteria	1785
43	Ga0070680_100051427	3300005336	Bacteria	3362
44	Ga0070680_101381128	3300005336	Bacteria	610
45	Ga0070680_101420296	3300005336	Bacteria	601
46	Ga0070682_101437439	3300005337	Bacteria	591
47	Ga0068868_100005009	3300005338	Bacteria	9304
48	Ga0068868_100093697	3300005338	Bacteria	2422
49	Ga0068868_100412373	3300005338	Bacteria	1168
50	Ga0068868_100853412	3300005338	Bacteria	825
51	Ga0070660_101318053	3300005339	Bacteria	613
52	Ga0070689_100059593	3300005340	Bacteria	2967
53	Ga0070689_101965495	3300005340	Bacteria	535
54	Ga0070687_100059235	3300005343	Bacteria	2015
55	Ga0070661_100021520	3300005344	Bacteria	4608
56	Ga0070692_10663495	3300005345	Bacteria	698
57	Ga0070692_10976751	3300005345	Bacteria	591
58	Ga0070668_100196990	3300005347	Bacteria	1652
59	Ga0070668_100807185	3300005347	Bacteria	834
60	Ga0070669_100015738	3300005353	Bacteria	5394
61	Ga0070669_100096745	3300005353	Bacteria	2221
62	Ga0070669_100108328	3300005353	Bacteria	2105
63	Ga0070669_100714780	3300005353	Bacteria	847
64	Ga0070669_101019421	3300005353	Bacteria	711
65	Ga0070669_101659450	3300005353	Bacteria	557
66	Ga0070675_100077243	3300005354	Bacteria	2771
67	Ga0070675_100116698	3300005354	Bacteria	2264
68	Ga0070675_100350313	3300005354	Bacteria	1309
69	Ga0070675_100409789	3300005354	Bacteria	1210
70	Ga0070675_100768639	3300005354	Bacteria	880
71	Ga0070671_101334820	3300005355	Bacteria	633
72	Ga0070674_100211775	3300005356	Bacteria	1502
73	Ga0070674_100933499	3300005356	Bacteria	758
74	Ga0070674_101485387	3300005356	Unclassified	609
75	Ga0070674_101486493	3300005356	Bacteria	608
76	Ga0070673_100003685	3300005364	Bacteria	9600
77	Ga0070673_100075590	3300005364	Bacteria	2717
78	Ga0070673_100479368	3300005364	Bacteria	1123
79	Ga0070673_102147363	3300005364	Bacteria	530
80	Ga0070688_100037129	3300005365	Bacteria	2967
81	Ga0070688_100125305	3300005365	Bacteria	1726
82	Ga0070688_100573335	3300005365	Bacteria	860
83	Ga0070659_100060268	3300005366	Bacteria	2997
84	Ga0070659_100246573	3300005366	Bacteria	1480
85	Ga0070667_100042181	3300005367	Bacteria	3828
86	Ga0070667_100547407	3300005367	Bacteria	1063
87	Ga0070667_100578669	3300005367	Bacteria	1033
88	Ga0070667_101072382	3300005367	Bacteria	753
89	Ga0070709_11660113	3300005434	Bacteria	521
90	Ga0070713_101350369	3300005436	Bacteria	691
91	Ga0070701_10094524	3300005438	Bacteria	1644
92	Ga0070705_100815040	3300005440	Bacteria	744
93	Ga0070700_100202089	3300005441	Bacteria	1396
94	Ga0070700_100616020	3300005441	Bacteria	852
95	Ga0070700_101067585	3300005441	Bacteria	668
96	Ga0070700_102010158	3300005441	Bacteria	501
97	Ga0070694_100195955	3300005444	Bacteria	1503
98	Ga0070694_100664588	3300005444	Bacteria	844
99	Ga0070694_101959264	3300005444	Bacteria	501
100	Ga0070708_102074396	3300005445	Unclassified	526
101	Ga0070678_100082872	3300005456	Bacteria	2436
102	Ga0070678_100104101	3300005456	Bacteria	2206
103	Ga0070678_100259903	3300005456	Bacteria	1460
104	Ga0070678_100331458	3300005456	Bacteria	1303
105	Ga0070678_100659057	3300005456	Bacteria	939
106	Ga0070678_101396662	3300005456	Bacteria	653
107	Ga0070678_101981512	3300005456	Bacteria	551
108	Ga0070662_100019082	3300005457	Bacteria	4650
109	Ga0070662_100025787	3300005457	Bacteria	4063
110	Ga0070662_100642736	3300005457	Bacteria	895
111	Ga0070662_101109493	3300005457	Bacteria	679
112	Ga0070662_101497379	3300005457	Bacteria	582
113	Ga0070681_10446849	3300005458	Bacteria	1205
114	Ga0070681_11166878	3300005458	Unclassified	692
115	Ga0068867_100232653	3300005459	Bacteria	1490
116	Ga0068867_100423213	3300005459	Bacteria	1128
117	Ga0068867_101129879	3300005459	Bacteria	716
118	Ga0068867_102232231	3300005459	Unclassified	520
119	Ga0070685_10059148	3300005466	Bacteria	2236
120	Ga0070685_10601006	3300005466	Bacteria	791
121	Ga0070706_100494586	3300005467	Bacteria	1138
122	Ga0070707_100344796	3300005468	Bacteria	1447
123	Ga0070698_102193497	3300005471	Bacteria	506
124	Ga0070699_100085640	3300005518	Bacteria	2750
125	Ga0070699_100828913	3300005518	Bacteria	847
126	Ga0070699_101327883	3300005518	Bacteria	660
127	Ga0070697_100257637	3300005536	Bacteria	1493
128	Ga0068853_100144910	3300005539	Bacteria	2134
129	Ga0070672_100054065	3300005543	Bacteria	3142
130	Ga0070672_100082890	3300005543	Bacteria	2573
131	Ga0070672_100237371	3300005543	Bacteria	1533
132	Ga0070672_100750336	3300005543	Bacteria	856
133	Ga0070672_100928176	3300005543	Bacteria	770
134	Ga0070686_100018855	3300005544	Bacteria	4057
135	Ga0070686_100337368	3300005544	Bacteria	1129
136	Ga0070686_100377799	3300005544	Bacteria	1072
137	Ga0070686_100488107	3300005544	Bacteria	954
138	Ga0070695_100099062	3300005545	Bacteria	1960
139	Ga0070695_100644823	3300005545	Bacteria	836
140	Ga0070695_101219775	3300005545	Bacteria	619
141	Ga0070695_101557114	3300005545	Bacteria	551
142	Ga0070696_100227575	3300005546	Bacteria	1402
143	Ga0070696_101829323	3300005546	Bacteria	525
144	Ga0070693_100323508	3300005547	Bacteria	1047
145	Ga0070665_100035338	3300005548	Bacteria	5024
146	Ga0070704_100332922	3300005549	Bacteria	1276
147	Ga0070664_100007621	3300005564	Bacteria	8741
148	Ga0070664_100297929	3300005564	Bacteria	1457
149	Ga0070664_101010568	3300005564	Bacteria	782
150	Ga0070664_101274663	3300005564	Bacteria	694
151	Ga0068857_100136997	3300005577	Bacteria	2210
152	Ga0068857_102074594	3300005577	Bacteria	558
153	Ga0068854_100799981	3300005578	Bacteria	822
154	Ga0068856_100512946	3300005614	Bacteria	1220
155	Ga0070702_100785839	3300005615	Bacteria	735
156	Ga0070702_101217433	3300005615	Bacteria	608
157	Ga0068852_101587045	3300005616	Bacteria	677
158	Ga0068859_100096871	3300005617	Bacteria	3002
159	Ga0068859_100345064	3300005617	Bacteria	1583
160	Ga0068859_100695398	3300005617	Bacteria	1108
161	Ga0068859_100801551	3300005617	Bacteria	1029
162	Ga0068859_101531912	3300005617	Bacteria	736
163	Ga0068859_101615805	3300005617	Bacteria	716
164	Ga0068859_103172371	3300005617	Archaea	500
165	Ga0068864_100171289	3300005618	Bacteria	1979
166	Ga0068864_100359108	3300005618	Bacteria	1376
167	Ga0068864_100553109	3300005618	Bacteria	1113
168	Ga0068866_10152458	3300005718	Bacteria	1340
169	Ga0068866_10207682	3300005718	Bacteria	1174
170	Ga0068861_100263499	3300005719	Bacteria	1476
171	Ga0068861_101318157	3300005719	Unclassified	702
172	Ga0068870_10000698	3300005840	Bacteria	12863
173	Ga0068870_10103466	3300005840	Bacteria	1614
174	Ga0068870_10111021	3300005840	Bacteria	1565
175	Ga0068870_10114181	3300005840	Bacteria	1546
176	Ga0068863_100026745	3300005841	Bacteria	5501
177	Ga0068863_100252788	3300005841	Bacteria	1703
178	Ga0068863_100594476	3300005841	Bacteria	1095
179	Ga0068863_100598104	3300005841	Bacteria	1091
180	Ga0068863_101934851	3300005841	Bacteria	600
181	Ga0068863_102033711	3300005841	Unclassified	584
182	Ga0068858_100152303	3300005842	Bacteria	2174
183	Ga0068858_101117946	3300005842	Bacteria	774
184	Ga0068860_100023512	3300005843	Bacteria	5955
185	Ga0068860_100389439	3300005843	Bacteria	1377
186	Ga0068860_102332178	3300005843	Bacteria	555
187	Ga0068860_102683472	3300005843	Bacteria	517
188	Ga0068862_100005694	3300005844	Bacteria	10395
189	Ga0068862_100118185	3300005844	Bacteria	2334
190	Ga0068862_100377333	3300005844	Bacteria	1322
191	Ga0068862_100626209	3300005844	Bacteria	1035
192	Ga0068862_100912735	3300005844	Bacteria	864
193	Ga0081455_10056754	3300005937	Bacteria	3323
194	Ga0081539_10000215	3300005985	Bacteria	135054
195	Ga0075432_10050350	3300006058	Bacteria	1469
196	Ga0075432_10132851	3300006058	Bacteria	944
197	Ga0070712_100106321	3300006175	Bacteria	2086
198	Ga0070712_101030225	3300006175	Bacteria	713
199	Ga0097621_100024753	3300006237	Bacteria	4691
200	Ga0097621_101083743	3300006237	Bacteria	752
201	Ga0097621_102240313	3300006237	Bacteria	523
202	Ga0068871_100240157	3300006358	Bacteria	1575
203	Ga0068871_100267505	3300006358	Bacteria	1493
204	Ga0075428_100036785	3300006844	Bacteria	5390
205	Ga0075428_100045925	3300006844	Bacteria	4798
206	Ga0075428_100049170	3300006844	Bacteria	4627
207	Ga0075428_100769921	3300006844	Bacteria	1024
208	Ga0075428_100860247	3300006844	Unclassified	962
209	Ga0075428_100963257	3300006844	Bacteria	904
210	Ga0075428_102724138	3300006844	Bacteria	503
211	Ga0075430_100002725	3300006846	Bacteria	14742
212	Ga0075430_100004914	3300006846	Bacteria	11243
213	Ga0075430_100094701	3300006846	Bacteria	2496
214	Ga0075430_100156036	3300006846	Bacteria	1900
215	Ga0075430_100291810	3300006846	Bacteria	1349
216	Ga0075430_100498959	3300006846	Bacteria	1004
217	Ga0075430_100565875	3300006846	Bacteria	937
218	Ga0075430_100902808	3300006846	Bacteria	728
219	Ga0075430_100943424	3300006846	Bacteria	711
220	Ga0075430_101635346	3300006846	Bacteria	529
221	Ga0075430_101805038	3300006846	Bacteria	501
222	Ga0075431_100007812	3300006847	Bacteria	10653
223	Ga0075431_100009893	3300006847	Bacteria	9575
224	Ga0075431_100028175	3300006847	Bacteria	5768
225	Ga0075431_100240279	3300006847	Bacteria	1843
226	Ga0075431_100550306	3300006847	Bacteria	1141
227	Ga0075433_10007511	3300006852	Bacteria	8653
228	Ga0075433_10045822	3300006852	Bacteria	3802
229	Ga0075433_10651102	3300006852	Bacteria	924
230	Ga0075434_100096102	3300006871	Bacteria	2968
231	Ga0075434_100118557	3300006871	Bacteria	2660
232	Ga0075434_100149750	3300006871	Bacteria	2354
233	Ga0075434_101387338	3300006871	Bacteria	713
234	Ga0075429_100018802	3300006880	Bacteria	5985
235	Ga0075429_100065780	3300006880	Bacteria	3156
236	Ga0075429_100110990	3300006880	Bacteria	2397
237	Ga0075429_100153624	3300006880	Bacteria	2015
238	Ga0075429_100211148	3300006880	Bacteria	1701
239	Ga0075429_100622485	3300006880	Bacteria	946
240	Ga0075429_101275868	3300006880	Bacteria	641
241	Ga0075429_101279873	3300006880	Bacteria	640
242	Ga0075429_101722657	3300006880	Bacteria	544
243	Ga0075429_101731910	3300006880	Bacteria	542
244	Ga0068865_100088512	3300006881	Bacteria	2240
245	Ga0068865_100679732	3300006881	Bacteria	878
246	Ga0068865_100728830	3300006881	Bacteria	850
247	Ga0068865_100807775	3300006881	Unclassified	809
248	Ga0068865_101422583	3300006881	Bacteria	619
249	Ga0097620_100096869	3300006931	Bacteria	3002
250	Ga0097620_100345050	3300006931	Bacteria	1583
251	Ga0097620_100695333	3300006931	Bacteria	1108
252	Ga0097620_100801593	3300006931	Bacteria	1029
253	Ga0097620_101531801	3300006931	Bacteria	736
254	Ga0097620_101616052	3300006931	Bacteria	716
255	Ga0097620_103172379	3300006931	Archaea	500
256	Ga0075435_100037667	3300007076	Bacteria	3852
257	Ga0075435_100048081	3300007076	Bacteria	3426
258	Ga0075435_100788944	3300007076	Bacteria	827
259	Ga0075435_101641676	3300007076	Unclassified	564
260	Ga0105240_11452056	3300009093	Bacteria	720
261	Ga0111539_10000566	3300009094	Bacteria	47366
262	Ga0111539_10000614	3300009094	Bacteria	46152
263	Ga0111539_10008096	3300009094	Bacteria	13396
264	Ga0111539_10011587	3300009094	Bacteria	11064
265	Ga0111539_10093123	3300009094	Bacteria	3540
266	Ga0111539_10177333	3300009094	Bacteria	2489
267	Ga0111539_10357403	3300009094	Bacteria	1700
268	Ga0111539_10559524	3300009094	Bacteria	1332
269	Ga0111539_11841041	3300009094	Bacteria	702
270	Ga0111539_12143603	3300009094	Bacteria	648
271	Ga0111539_13487180	3300009094	Bacteria	505
272	Ga0105245_12323835	3300009098	Unclassified	590
273	Ga0114129_10023812	3300009147	Bacteria	8679
274	Ga0114129_10060506	3300009147	Bacteria	5295
275	Ga0114129_10082942	3300009147	Bacteria	4454
276	Ga0114129_10279353	3300009147	Bacteria	2231
277	Ga0114129_11467773	3300009147	Bacteria	839
278	Ga0114129_11664342	3300009147	Bacteria	780
279	Ga0114129_11835556	3300009147	Bacteria	736
280	Ga0114129_11878782	3300009147	Bacteria	727
281	Ga0114129_12369890	3300009147	Bacteria	636
282	Ga0105243_10740133	3300009148	Bacteria	963
283	Ga0105243_10765681	3300009148	Bacteria	948
284	Ga0105241_11656763	3300009174	Bacteria	620
285	Ga0105242_10265801	3300009176	Bacteria	1551
286	Ga0105242_10707149	3300009176	Bacteria	987
287	Ga0105242_12495693	3300009176	Bacteria	565
288	Ga0105248_11764110	3300009177	Bacteria	702
289	Ga0105248_12306702	3300009177	Bacteria	613
290	Ga0105248_12769717	3300009177	Unclassified	559
291	Ga0105249_10000649	3300009553	Bacteria	31693
292	Ga0105249_10115117	3300009553	Bacteria	2547
293	Ga0105249_10663269	3300009553	Bacteria	1101
294	Ga0105249_10663859	3300009553	Bacteria	1101
295	Ga0105249_12283588	3300009553	Bacteria	614
296	Ga0105249_12958810	3300009553	Bacteria	545
297	Ga0105239_10550941	3300010375	Bacteria	1313
298	Ga0105239_11177761	3300010375	Bacteria	883
299	Ga0105239_12071557	3300010375	Bacteria	661
300	Ga0105246_10091366	3300011119	Bacteria	2194
301	Ga0105246_11541608	3300011119	Bacteria	626
302	Ga0157346_1015896	3300012480	Bacteria	608
303	Ga0157327_1017342	3300012512	Bacteria	772
304	Ga0157373_11258570	3300013100	Bacteria	559
305	Ga0157371_10155004	3300013102	Bacteria	1634
306	Ga0157371_10311770	3300013102	Bacteria	1140
307	Ga0157374_10071069	3300013296	Bacteria	3281
308	Ga0157374_10374933	3300013296	Bacteria	1417
309	Ga0157378_10041548	3300013297	Bacteria	4079
310	Ga0157378_10402678	3300013297	Bacteria	1349
311	Ga0157378_10848502	3300013297	Bacteria	942
312	Ga0163162_10007697	3300013306	Bacteria	10494
313	Ga0163162_10055707	3300013306	Bacteria	3982
314	Ga0163162_10465701	3300013306	Bacteria	1395
315	Ga0163162_10741123	3300013306	Bacteria	1102
316	Ga0157375_10138512	3300013308	Bacteria	2559
317	Ga0157375_10238046	3300013308	Bacteria	1980
318	Ga0157375_10268186	3300013308	Bacteria	1869
319	Ga0157375_10301514	3300013308	Bacteria	1766
320	Ga0157375_10822547	3300013308	Bacteria	1077
321	Ga0157375_10943897	3300013308	Bacteria	1005
322	Ga0163163_10216917	3300014325	Bacteria	1962
323	Ga0163163_10219521	3300014325	Bacteria	1950
324	Ga0163163_12028757	3300014325	Bacteria	635
325	Ga0163163_12318255	3300014325	Bacteria	596
326	Ga0157380_10038005	3300014326	Bacteria	3735
327	Ga0157380_10279446	3300014326	Bacteria	1527
328	Ga0157380_11321689	3300014326	Bacteria	769
329	Ga0157380_11371958	3300014326	Bacteria	756
330	Ga0157380_11430877	3300014326	Bacteria	742
331	Ga0157377_10060625	3300014745	Bacteria	2160
332	Ga0157377_10185201	3300014745	Bacteria	1312
333	Ga0157377_10345707	3300014745	Bacteria	996
334	Ga0157377_10715146	3300014745	Bacteria	729
335	Ga0157377_11478331	3300014745	Bacteria	539
336	Ga0157379_10011639	3300014968	Bacteria	7682
337	Ga0157379_10231746	3300014968	Bacteria	1674
338	Ga0157379_10350305	3300014968	Bacteria	1352
339	Ga0157379_10828217	3300014968	Bacteria	875
340	Ga0163161_10477911	3300017792	Bacteria	1011
341	Ga0163161_10659478	3300017792	Bacteria	868
342	Ga0207666_1009561	3300025271	Bacteria	1312
343	Ga0207697_10549721	3300025315	Bacteria	508
344	Ga0207682_10006707	3300025893	Bacteria	4623
345	Ga0207682_10027880	3300025893	Bacteria	2251
346	Ga0207682_10106620	3300025893	Bacteria	1230
347	Ga0207642_10730795	3300025899	Bacteria	626
348	Ga0207688_10029115	3300025901	Bacteria	3039
349	Ga0207688_10073514	3300025901	Bacteria	1943
350	Ga0207680_10100869	3300025903	Bacteria	1854
351	Ga0207680_10308481	3300025903	Bacteria	1104
352	Ga0207680_10958448	3300025903	Bacteria	613
353	Ga0207685_10325923	3300025905	Bacteria	767
354	Ga0207645_10012143	3300025907	Bacteria	5851
355	Ga0207645_10222886	3300025907	Bacteria	1243
356	Ga0207645_10270114	3300025907	Bacteria	1127
357	Ga0207645_10402842	3300025907	Bacteria	920
358	Ga0207643_10003397	3300025908	Bacteria	8582
359	Ga0207643_10130789	3300025908	Bacteria	1493
360	Ga0207643_10313115	3300025908	Bacteria	979
361	Ga0207643_10372695	3300025908	Bacteria	899
362	Ga0207684_10567778	3300025910	Bacteria	970
363	Ga0207707_10288177	3300025912	Bacteria	1421
364	Ga0207660_11066625	3300025917	Bacteria	659
365	Ga0207660_11616943	3300025917	Bacteria	522
366	Ga0207657_10316586	3300025919	Bacteria	1234
367	Ga0207649_11397106	3300025920	Bacteria	554
368	Ga0207646_10577019	3300025922	Bacteria	1010
369	Ga0207681_10119766	3300025923	Bacteria	1928
370	Ga0207681_10131285	3300025923	Bacteria	1852
371	Ga0207681_10397113	3300025923	Bacteria	1113
372	Ga0207681_10666440	3300025923	Bacteria	863
373	Ga0207681_10682727	3300025923	Bacteria	853
374	Ga0207681_11034082	3300025923	Bacteria	689
375	Ga0207681_11313093	3300025923	Bacteria	607
376	Ga0207650_10054826	3300025925	Bacteria	2958
377	Ga0207650_10365707	3300025925	Bacteria	1189
378	Ga0207650_10447562	3300025925	Bacteria	1074
379	Ga0207650_10637853	3300025925	Bacteria	897
380	Ga0207659_10011349	3300025926	Bacteria	5625
381	Ga0207659_10021970	3300025926	Bacteria	4243
382	Ga0207659_10156584	3300025926	Bacteria	1784
383	Ga0207644_11757738	3300025931	Unclassified	519
384	Ga0207690_10016950	3300025932	Bacteria	4442
385	Ga0207690_11749448	3300025932	Bacteria	519
386	Ga0207706_10136699	3300025933	Bacteria	2156
387	Ga0207706_10447423	3300025933	Bacteria	1118
388	Ga0207706_10936094	3300025933	Bacteria	730
389	Ga0207706_11042719	3300025933	Bacteria	685
390	Ga0207709_11294862	3300025935	Bacteria	602
391	Ga0207709_11790561	3300025935	Bacteria	511
392	Ga0207670_11421192	3300025936	Bacteria	589
393	Ga0207669_10117996	3300025937	Bacteria	1794
394	Ga0207669_10564199	3300025937	Bacteria	920
395	Ga0207669_10758537	3300025937	Bacteria	802
396	Ga0207691_10016722	3300025940	Bacteria	6964
397	Ga0207691_10306224	3300025940	Bacteria	1364
398	Ga0207691_10451428	3300025940	Bacteria	1094
399	Ga0207711_10864761	3300025941	Bacteria	841
400	Ga0207689_10160774	3300025942	Bacteria	1851
401	Ga0207689_10939481	3300025942	Bacteria	730
402	Ga0207679_10216354	3300025945	Bacteria	1610
403	Ga0207679_10446337	3300025945	Bacteria	1146
404	Ga0207679_11125531	3300025945	Bacteria	720
405	Ga0207651_10173613	3300025960	Bacteria	1702
406	Ga0207651_11001930	3300025960	Bacteria	746
407	Ga0207651_11249827	3300025960	Bacteria	667
408	Ga0207651_11847938	3300025960	Bacteria	543
409	Ga0207712_10401611	3300025961	Bacteria	1152
410	Ga0207712_11570924	3300025961	Bacteria	590
411	Ga0207640_10663334	3300025981	Bacteria	890
412	Ga0207658_10603394	3300025986	Bacteria	986
413	Ga0207658_10737894	3300025986	Bacteria	891
414	Ga0207658_11489922	3300025986	Bacteria	619
415	Ga0207677_10385665	3300026023	Bacteria	1184
416	Ga0207639_11929908	3300026041	Unclassified	551
417	Ga0207678_10889721	3300026067	Bacteria	787
418	Ga0207708_10090767	3300026075	Bacteria	2355
419	Ga0207708_10155711	3300026075	Bacteria	1802
420	Ga0207708_10179429	3300026075	Bacteria	1681
421	Ga0207708_10758681	3300026075	Bacteria	833
422	Ga0207708_11794383	3300026075	Archaea	538
423	Ga0207641_10543105	3300026088	Bacteria	1133
424	Ga0207641_11191203	3300026088	Bacteria	761
425	Ga0207641_11581502	3300026088	Bacteria	657
426	Ga0207648_10329870	3300026089	Bacteria	1372
427	Ga0207648_10423599	3300026089	Bacteria	1209
428	Ga0207648_11367643	3300026089	Bacteria	665
429	Ga0207648_12243846	3300026089	Bacteria	506
430	Ga0207676_10038236	3300026095	Bacteria	3661
431	Ga0207676_10162244	3300026095	Bacteria	1938
432	Ga0207676_10170810	3300026095	Bacteria	1894
433	Ga0207674_10096945	3300026116	Bacteria	2933
434	Ga0207674_10475922	3300026116	Bacteria	1207
435	Ga0207674_10625517	3300026116	Bacteria	1040
436	Ga0207674_11601872	3300026116	Bacteria	620
437	Ga0207675_100049309	3300026118	Bacteria	3930
438	Ga0207675_102275634	3300026118	Bacteria	556
439	Ga0207683_10041503	3300026121	Bacteria	4017
440	Ga0207683_10298010	3300026121	Bacteria	1475
441	Ga0207683_10318794	3300026121	Bacteria	1424
442	Ga0207683_10907126	3300026121	Bacteria	818
443	Ga0207683_11022626	3300026121	Bacteria	767
444	Ga0207683_11853999	3300026121	Bacteria	552
445	Ga0209970_1012238	3300027614	Bacteria	1417
446	Ga0210002_1042784	3300027617	Bacteria	771
447	Ga0209971_1005418	3300027682	Bacteria	3030
448	Ga0209971_1013410	3300027682	Bacteria	1942
449	Ga0209971_1063313	3300027682	Bacteria	896
450	Ga0209966_1049674	3300027695	Bacteria	890
451	Ga0209974_10032443	3300027876	Bacteria	1731
452	Ga0209974_10274760	3300027876	Bacteria	639
453	Ga0209974_10411471	3300027876	Unclassified	532
454	Ga0207428_10001541	3300027907	Bacteria	24114
455	Ga0207428_10018444	3300027907	Bacteria	5960
456	Ga0207428_10039500	3300027907	Bacteria	3832
457	Ga0207428_10790116	3300027907	Bacteria	675
458	Ga0268265_10267882	3300028380	Bacteria	1522
459	Ga0268265_11118159	3300028380	Bacteria	783
460	Ga0268264_10443232	3300028381	Bacteria	1257
461	Ga0268264_11937806	3300028381	Bacteria	599
462	Ga0307413_10754067	3300031824	Bacteria	814
463	Ga0307413_11056480	3300031824	Bacteria	699
464	Ga0307410_10668676	3300031852	Bacteria	873
465	Ga0307407_10631910	3300031903	Bacteria	800
466	Ga0373923_0213150	3300035111	Bacteria	896
467	Ga0373956_0172409	3300035119	Bacteria	1021
468	Ga0373925_0545741	3300037068	Bacteria	953
469	Ga0439453_0007184	3300041408	Bacteria	1758
470	Ga0451853_3467807	3300041512	Bacteria	701
471	Ga0439455_0211226	3300042012	Bacteria	563
472	Ga0450920_107747	3300042122	Bacteria	581
473	Ga0450923_068022	3300042125	Bacteria	786
474	Ga0450923_151902	3300042125	Unclassified	561
475	Ga0450896_050272	3300042133	Bacteria	663
476	Ga0439458_0176040	3300042157	Bacteria	580
477	Ga0439458_0181114	3300042157	Unclassified	572
478	Ga0439444_0004779	3300042437	Bacteria	1983
479	Ga0439444_0036252	3300042437	Bacteria	950
480	Ga0439459_0080843	3300042438	Bacteria	767
481	Ga0439464_0073062	3300042439	Bacteria	1017
482	Ga0439464_0087594	3300042439	Bacteria	936
483	Ga0439464_0174631	3300042439	Bacteria	679
484	Ga0439460_0252438	3300042461	Bacteria	610
485	Ga0450916_014348	3300042530	Bacteria	1031
486	Ga0450893_0046786	3300042532	Bacteria	803
487	Ga0495618_0247624	3300046514	Bacteria	1119
488	Ga0495663_0020162	3300046525	Bacteria	1913
489	Ga0495663_0059369	3300046525	Bacteria	1200
490	Ga0495640_0472351	3300046533	Bacteria	765
491	Ga0495598_0010641	3300046537	Bacteria	2208
492	Ga0495598_0021069	3300046537	Bacteria	1729
493	Ga0495598_0031457	3300046537	Bacteria	1493
494	Ga0495609_0099359	3300046538	Bacteria	1262
495	Ga0495621_0042836	3300046539	Bacteria	1595
496	Ga0495621_0226313	3300046539	Bacteria	758
497	Ga0495621_0265214	3300046539	Bacteria	704
498	Ga0495656_0024718	3300046615	Bacteria	2375
499	Ga0495656_0032868	3300046615	Bacteria	2114
500	Ga0495656_0804137	3300046615	Unclassified	508
501	Ga0495635_0468207	3300046663	Bacteria	832
502	Ga0495659_0033199	3300046664	Bacteria	1811
503	Ga0495659_0412328	3300046664	Bacteria	584
504	Ga0495669_0054603	3300046684	Bacteria	1798
505	Ga0495669_0083872	3300046684	Bacteria	1465
506	Ga0495669_0126279	3300046684	Bacteria	1202
507	Ga0495670_0067755	3300046691	Bacteria	1802
508	Ga0495670_0261327	3300046691	Bacteria	924
509	Ga0495675_0230505	3300047444	Bacteria	1118
510	Ga0495677_0329094	3300047445	Bacteria	602
511	Ga0495685_228406	3300047447	Bacteria	593
512	Ga0496101_1423794	3300048904	Bacteria	540
513	Ga0496106_0144499	3300048909	Bacteria	1873
514	Ga0496109_0070343	3300048912	Bacteria	3211
515	Ga0496109_0932796	3300048912	Bacteria	806
516	Ga0496112_1167425	3300048915	Bacteria	687
517	Ga0496112_1662692	3300048915	Bacteria	551
518	Ga0496113_0092058	3300048916	Bacteria	2338
519	Ga0501031_0350603	3300049568	Bacteria	955
520	Ga0501032_0867708	3300049569	Bacteria	569
521	Ga0501036_0415887	3300049572	Bacteria	1121
522	Ga0501036_0447474	3300049572	Bacteria	1076
523	Ga0501036_1450408	3300049572	Unclassified	556
524	Ga0501037_0915936	3300049573	Bacteria	574
525	Ga0501038_0946698	3300049574	Bacteria	634
526	Ga0501039_0042299	3300049575	Bacteria	3520
527	Ga0501039_0418702	3300049575	Bacteria	1052
528	Ga0501039_1597308	3300049575	Viruses	501
529	Ga0501040_0024381	3300049576	Bacteria	4060
530	Ga0501041_0038438	3300049577	Bacteria	2902
531	Ga0501041_0087808	3300049577	Bacteria	1919
532	Ga0501043_0083347	3300049579	Bacteria	2514
533	Ga0501046_0348494	3300049580	Bacteria	1076
534	Ga0501046_0365335	3300049580	Bacteria	1046
535	Ga0501047_0940720	3300049581	Bacteria	677
536	Ga0501048_0087487	3300049582	Bacteria	2198
537	Ga0501048_0654298	3300049582	Bacteria	754
538	Ga0501071_0106140	3300049587	Bacteria	2074
539	Ga0501071_0141611	3300049587	Bacteria	1791
540	Ga0501072_0017488	3300049588	Bacteria	5510
541	Ga0501072_0316376	3300049588	Bacteria	1240
542	Ga0501074_0044870	3300049590	Bacteria	3199
543	Ga0501074_0426627	3300049590	Bacteria	940
544	Ga0501075_0210969	3300049591	Bacteria	1481
545	Ga0501075_0269661	3300049591	Bacteria	1297
546	Ga0501076_0015697	3300049592	Bacteria	5729
547	Ga0501076_0078951	3300049592	Bacteria	2641
548	Ga0501076_0835693	3300049592	Bacteria	760
549	Ga0501077_0156344	3300049593	Bacteria	1447
550	Ga0501077_0324419	3300049593	Bacteria	982
551	Ga0501079_0070579	3300049741	Bacteria	2698
552	Ga0501080_0206266	3300049742	Bacteria	1803
553	Ga0501080_1684054	3300049742	Bacteria	535
554	Ga0501081_0083033	3300049743	Bacteria	2245
555	Ga0501083_0372313	3300049744	Bacteria	929
556	Ga0501083_0387714	3300049744	Bacteria	909
557	Ga0501035_0471162	3300049822	Bacteria	1037
558	Ga0501045_0094768	3300049824	Bacteria	2208
559	Ga0501045_0362305	3300049824	Bacteria	1079
560	nmdc:mga05p37_17293_c1	3300050507	Bacteria	8698
561	nmdc:mga05p37_434571_c1	3300050507	Bacteria	1524
562	nmdc:mga05p37_495712_c1	3300050507	Bacteria	1403
563	nmdc:mga05p37_675480_c1	3300050507	Bacteria	1152
564	nmdc:mga05p37_881009_c1	3300050507	Bacteria	968
565	nmdc:mga09592_107905_c1	3300050508	Bacteria	2388
566	nmdc:mga09592_39654_c1	3300050508	Bacteria	3956
567	nmdc:mga09592_556463_c1	3300050508	Bacteria	985
568	nmdc:mga09592_620247_c1	3300050508	Bacteria	925
569	nmdc:mga0qj67_10318_c1	3300050509	Bacteria	6976
570	nmdc:mga0qj67_149396_c1	3300050509	Bacteria	1895
571	nmdc:mga0qj67_154236_c1	3300050509	Bacteria	1863
572	nmdc:mga0qj67_34396_c1	3300050509	Bacteria	3958
573	nmdc:mga0qj67_8629_c1	3300050509	Bacteria	7562
574	nmdc:mga06r32_181423_c1	3300050510	Bacteria	2091
575	nmdc:mga06r32_25188_c1	3300050510	Bacteria	5531
576	nmdc:mga06r32_658738_c1	3300050510	Bacteria	1015
577	nmdc:mga06r32_7117_c1	3300050510	Bacteria	10077
578	nmdc:mga08y16_1053409_c1	3300050511	Bacteria	791
579	nmdc:mga08y16_1304271_c1	3300050511	Bacteria	693
580	nmdc:mga08y16_13623_c1	3300050511	Bacteria	8559
581	nmdc:mga08y16_147568_c1	3300050511	Bacteria	2445
582	nmdc:mga08y16_155_c1	3300050511	Bacteria	31746
583	nmdc:mga08y16_29936_c1	3300050511	Bacteria	5733
584	nmdc:mga08y16_475371_c1	3300050511	Bacteria	1272
585	nmdc:mga0n895_10459_c1	3300050512	Bacteria	8200
586	nmdc:mga0n895_139147_c1	3300050512	Bacteria	2455
587	nmdc:mga0rr50_1983_c1	3300050513	Bacteria	11375
588	nmdc:mga0a205_1142552_c1	3300050515	Bacteria	626
589	nmdc:mga0a205_2239_c1	3300050515	Bacteria	17045
590	Ga0495601_0379505	3300053077	Bacteria	917
591	Ga0495601_0459340	3300053077	Bacteria	823
592	Ga0495612_0127730	3300053078	Bacteria	1097
593	Ga0590071_035169	3300059421	Bacteria	1199
594	Ga0590074_011563	3300059423	Bacteria	1479
595	Ga0590075_002910	3300059424	Bacteria	4072
596	Ga0590077_002379	3300059426	Bacteria	4043
597	Ga0501082_0088437	3300060353	Bacteria	2673
598	Ga0501082_1391964	3300060353	Bacteria	613
599	Ga0530510_0004587	3300061734	Bacteria	9554
600	Ga0530510_0208522	3300061734	Bacteria	1452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300027614	Ga0209970_1012238	Ga0209970_10122383	62
2	3300027682	Ga0209971_1005418	Ga0209971_10054181	62
3	3300027876	Ga0209974_10032443	Ga0209974_100324433	62
4	3300042439	Ga0439464_0073062	Ga0439464_0073062_579_788	62
5	3300049744	Ga0501083_0372313	Ga0501083_0372313_73_285	62
6	3300001991	JGI24743J22301_10070352	JGI24743J22301_100703522	67
7	3300002076	JGI24749J21850_1018479	JGI24749J21850_10184792	67
8	3300002126	JGI24035J26624_1044302	JGI24035J26624_10443022	67
9	3300004798	Ga0058859_11814076	Ga0058859_118140762	67
10	3300004801	Ga0058860_12007707	Ga0058860_120077072	67
11	3300005289	Ga0065704_10344543	Ga0065704_103445432	67
12	3300005293	Ga0065715_10093177	Ga0065715_100931778	67
13	3300005295	Ga0065707_10284231	Ga0065707_102842311	67
14	3300005295	Ga0065707_10822240	Ga0065707_108222402	67
15	3300005330	Ga0070690_100255316	Ga0070690_1002553163	67
16	3300005331	Ga0070670_100148317	Ga0070670_1001483172	67
17	3300005333	Ga0070677_10004427	Ga0070677_100044275	67
18	3300005333	Ga0070677_10459236	Ga0070677_104592361	67
19	3300005333	Ga0070677_10553755	Ga0070677_105537551	67
20	3300005334	Ga0068869_100017119	Ga0068869_1000171197	67
21	3300005335	Ga0070666_10065659	Ga0070666_100656594	67
22	3300005336	Ga0070680_101420296	Ga0070680_1014202962	67
23	3300005338	Ga0068868_100005009	Ga0068868_1000050097	67
24	3300005338	Ga0068868_100093697	Ga0068868_1000936973	67
25	3300005340	Ga0070689_100059593	Ga0070689_1000595933	67
26	3300005344	Ga0070661_100021520	Ga0070661_1000215202	67
27	3300005347	Ga0070668_100807185	Ga0070668_1008071852	67
28	3300005353	Ga0070669_100015738	Ga0070669_1000157387	67
29	3300005353	Ga0070669_101019421	Ga0070669_1010194211	67
30	3300005354	Ga0070675_100116698	Ga0070675_1001166983	67
31	3300005355	Ga0070671_101334820	Ga0070671_1013348202	67
32	3300005364	Ga0070673_100479368	Ga0070673_1004793681	67
33	3300005364	Ga0070673_102147363	Ga0070673_1021473632	67
34	3300005365	Ga0070688_100037129	Ga0070688_1000371293	67
35	3300005366	Ga0070659_100060268	Ga0070659_1000602683	67
36	3300005366	Ga0070659_100246573	Ga0070659_1002465732	67
37	3300005367	Ga0070667_100042181	Ga0070667_1000421817	67
38	3300005367	Ga0070667_101072382	Ga0070667_1010723822	67
39	3300005434	Ga0070709_11660113	Ga0070709_116601132	67
40	3300005438	Ga0070701_10094524	Ga0070701_100945243	67
41	3300005441	Ga0070700_100616020	Ga0070700_1006160201	67
42	3300005444	Ga0070694_100195955	Ga0070694_1001959553	67
43	3300005456	Ga0070678_100104101	Ga0070678_1001041013	67
44	3300005456	Ga0070678_100259903	Ga0070678_1002599032	67
45	3300005456	Ga0070678_100331458	Ga0070678_1003314582	67
46	3300005456	Ga0070678_101981512	Ga0070678_1019815122	67
47	3300005457	Ga0070662_100025787	Ga0070662_1000257871	67
48	3300005457	Ga0070662_101109493	Ga0070662_1011094932	67
49	3300005458	Ga0070681_10446849	Ga0070681_104468493	67
50	3300005459	Ga0068867_102232231	Ga0068867_1022322311	67
51	3300005466	Ga0070685_10601006	Ga0070685_106010061	67
52	3300005536	Ga0070697_100257637	Ga0070697_1002576373	67
53	3300005539	Ga0068853_100144910	Ga0068853_1001449105	67
54	3300005543	Ga0070672_100054065	Ga0070672_1000540653	67
55	3300005543	Ga0070672_100237371	Ga0070672_1002373711	67
56	3300005544	Ga0070686_100018855	Ga0070686_1000188556	67
57	3300005544	Ga0070686_100377799	Ga0070686_1003777992	67
58	3300005544	Ga0070686_100488107	Ga0070686_1004881072	67
59	3300005545	Ga0070695_101219775	Ga0070695_1012197751	67
60	3300005545	Ga0070695_101557114	Ga0070695_1015571142	67
61	3300005546	Ga0070696_101829323	Ga0070696_1018293232	67
62	3300005547	Ga0070693_100323508	Ga0070693_1003235082	67
63	3300005548	Ga0070665_100035338	Ga0070665_10003533810	67
64	3300005564	Ga0070664_100007621	Ga0070664_1000076215	67
65	3300005615	Ga0070702_101217433	Ga0070702_1012174332	67
66	3300005617	Ga0068859_100345064	Ga0068859_1003450644	67
67	3300005617	Ga0068859_100695398	Ga0068859_1006953981	67
68	3300005617	Ga0068859_101531912	Ga0068859_1015319122	67
69	3300005617	Ga0068859_101615805	Ga0068859_1016158052	67
70	3300005618	Ga0068864_100171289	Ga0068864_1001712893	67
71	3300005718	Ga0068866_10152458	Ga0068866_101524583	67
72	3300005840	Ga0068870_10000698	Ga0068870_1000069816	67
73	3300005841	Ga0068863_100026745	Ga0068863_1000267452	67
74	3300005841	Ga0068863_100252788	Ga0068863_1002527883	67
75	3300005842	Ga0068858_100152303	Ga0068858_1001523032	67
76	3300005842	Ga0068858_101117946	Ga0068858_1011179462	67
77	3300005843	Ga0068860_100023512	Ga0068860_10002351214	67
78	3300005844	Ga0068862_100005694	Ga0068862_1000056943	67
79	3300005844	Ga0068862_100118185	Ga0068862_1001181852	67
80	3300005937	Ga0081455_10056754	Ga0081455_100567546	67
81	3300006058	Ga0075432_10050350	Ga0075432_100503504	67
82	3300006058	Ga0075432_10132851	Ga0075432_101328512	67
83	3300006175	Ga0070712_100106321	Ga0070712_1001063214	67
84	3300006175	Ga0070712_101030225	Ga0070712_1010302252	67
85	3300006237	Ga0097621_100024753	Ga0097621_1000247535	67
86	3300006237	Ga0097621_101083743	Ga0097621_1010837432	67
87	3300006358	Ga0068871_100240157	Ga0068871_1002401572	67
88	3300006358	Ga0068871_100267505	Ga0068871_1002675053	67
89	3300006844	Ga0075428_100049170	Ga0075428_1000491702	67
90	3300006844	Ga0075428_100769921	Ga0075428_1007699212	67
91	3300006844	Ga0075428_102724138	Ga0075428_1027241382	67
92	3300006846	Ga0075430_100002725	Ga0075430_10000272511	67
93	3300006846	Ga0075430_100094701	Ga0075430_1000947013	67
94	3300006846	Ga0075430_100291810	Ga0075430_1002918102	67
95	3300006846	Ga0075430_100498959	Ga0075430_1004989592	67
96	3300006846	Ga0075430_101635346	Ga0075430_1016353462	67
97	3300006846	Ga0075430_101805038	Ga0075430_1018050382	67
98	3300006847	Ga0075431_100007812	Ga0075431_10000781213	67
99	3300006847	Ga0075431_100028175	Ga0075431_10002817514	67
100	3300006852	Ga0075433_10045822	Ga0075433_100458223	67
101	3300006871	Ga0075434_100118557	Ga0075434_1001185573	67
102	3300006871	Ga0075434_101387338	Ga0075434_1013873381	67
103	3300006880	Ga0075429_100018802	Ga0075429_1000188023	67
104	3300006880	Ga0075429_100065780	Ga0075429_1000657803	67
105	3300006880	Ga0075429_100110990	Ga0075429_1001109903	67
106	3300006880	Ga0075429_101722657	Ga0075429_1017226572	67
107	3300006880	Ga0075429_101731910	Ga0075429_1017319102	67
108	3300006881	Ga0068865_100679732	Ga0068865_1006797322	67
109	3300006881	Ga0068865_100728830	Ga0068865_1007288302	67
110	3300006931	Ga0097620_100345050	Ga0097620_1003450504	67
111	3300006931	Ga0097620_100695333	Ga0097620_1006953331	67
112	3300006931	Ga0097620_101531801	Ga0097620_1015318012	67
113	3300006931	Ga0097620_101616052	Ga0097620_1016160522	67
114	3300007076	Ga0075435_100048081	Ga0075435_1000480813	67
115	3300007076	Ga0075435_100788944	Ga0075435_1007889442	67
116	3300007076	Ga0075435_101641676	Ga0075435_1016416762	67
117	3300009094	Ga0111539_10000566	Ga0111539_1000056613	67
118	3300009094	Ga0111539_10000614	Ga0111539_1000061414	67
119	3300009094	Ga0111539_10008096	Ga0111539_1000809612	67
120	3300009147	Ga0114129_10060506	Ga0114129_100605062	67
121	3300009147	Ga0114129_11664342	Ga0114129_116643422	67
122	3300009147	Ga0114129_11878782	Ga0114129_118787822	67
123	3300009148	Ga0105243_10740133	Ga0105243_107401332	67
124	3300009176	Ga0105242_10707149	Ga0105242_107071492	67
125	3300009176	Ga0105242_12495693	Ga0105242_124956932	67
126	3300009177	Ga0105248_12306702	Ga0105248_123067022	67
127	3300009553	Ga0105249_10000649	Ga0105249_1000064924	67
128	3300009553	Ga0105249_10115117	Ga0105249_101151174	67
129	3300010375	Ga0105239_10550941	Ga0105239_105509412	67
130	3300010375	Ga0105239_12071557	Ga0105239_120715572	67
131	3300011119	Ga0105246_10091366	Ga0105246_100913663	67
132	3300012480	Ga0157346_1015896	Ga0157346_10158962	67
133	3300012512	Ga0157327_1017342	Ga0157327_10173422	67
134	3300013100	Ga0157373_11258570	Ga0157373_112585701	67
135	3300013102	Ga0157371_10155004	Ga0157371_101550043	67
136	3300013296	Ga0157374_10071069	Ga0157374_100710693	67
137	3300013296	Ga0157374_10374933	Ga0157374_103749333	67
138	3300013297	Ga0157378_10041548	Ga0157378_100415486	67
139	3300013297	Ga0157378_10848502	Ga0157378_108485021	67
140	3300013306	Ga0163162_10007697	Ga0163162_1000769721	67
141	3300013306	Ga0163162_10465701	Ga0163162_104657013	67
142	3300013308	Ga0157375_10238046	Ga0157375_102380464	67
143	3300013308	Ga0157375_10301514	Ga0157375_103015143	67
144	3300014326	Ga0157380_10038005	Ga0157380_100380057	67
145	3300014745	Ga0157377_10060625	Ga0157377_100606252	67
146	3300014745	Ga0157377_10185201	Ga0157377_101852013	67
147	3300014745	Ga0157377_10715146	Ga0157377_107151462	67
148	3300014968	Ga0157379_10011639	Ga0157379_100116395	67
149	3300014968	Ga0157379_10231746	Ga0157379_102317463	67
150	3300014968	Ga0157379_10350305	Ga0157379_103503053	67
151	3300025912	Ga0207707_10288177	Ga0207707_102881773	67
152	3300025919	Ga0207657_10316586	Ga0207657_103165863	67
153	3300025923	Ga0207681_11034082	Ga0207681_110340822	67
154	3300025925	Ga0207650_10637853	Ga0207650_106378532	67
155	3300025932	Ga0207690_10016950	Ga0207690_100169503	67
156	3300025933	Ga0207706_10936094	Ga0207706_109360942	67
157	3300026041	Ga0207639_11929908	Ga0207639_119299082	67
158	3300026116	Ga0207674_10625517	Ga0207674_106255171	67
159	3300026121	Ga0207683_10318794	Ga0207683_103187942	67
160	3300026121	Ga0207683_11853999	Ga0207683_118539992	67
161	3300027907	Ga0207428_10039500	Ga0207428_100395005	67
162	3300041512	Ga0451853_3467807	Ga0451853_3467807_319_525	67
163	3300042157	Ga0439458_0176040	Ga0439458_0176040_339_545	67
164	3300046525	Ga0495663_0020162	Ga0495663_0020162_1359_1565	67
165	3300046537	Ga0495598_0021069	Ga0495598_0021069_466_672	67
166	3300046538	Ga0495609_0099359	Ga0495609_0099359_769_975	67
167	3300046539	Ga0495621_0226313	Ga0495621_0226313_287_493	67
168	3300046684	Ga0495669_0054603	Ga0495669_0054603_464_670	67
169	3300047445	Ga0495677_0329094	Ga0495677_0329094_230_436	67
170	3300049572	Ga0501036_1450408	Ga0501036_1450408_241_447	67
171	3300050509	nmdc:mga0qj67_149396_c1	nmdc:mga0qj67_149396_c1_643_849	67
172	3300050511	nmdc:mga08y16_29936_c1	nmdc:mga08y16_29936_c1_5128_5334	67
173	3300001977	JGI24746J21847_1011539	JGI24746J21847_10115392	68
174	3300002074	JGI24748J21848_1037516	JGI24748J21848_10375162	68
175	3300002076	JGI24749J21850_1013877	JGI24749J21850_10138772	68
176	3300002155	JGI24033J26618_1001778	JGI24033J26618_10017783	68
177	3300002239	JGI24034J26672_10040382	JGI24034J26672_100403822	68
178	3300002459	JGI24751J29686_10013286	JGI24751J29686_100132863	68
179	3300003203	JGI25406J46586_10002509	JGI25406J46586_1000250915	68
180	3300004801	Ga0058860_11993677	Ga0058860_119936772	68
181	3300005288	Ga0065714_10124682	Ga0065714_101246822	68
182	3300005289	Ga0065704_10216868	Ga0065704_102168682	68
183	3300005289	Ga0065704_10642034	Ga0065704_106420341	68
184	3300005290	Ga0065712_10001248	Ga0065712_100012483	68
185	3300005290	Ga0065712_10001330	Ga0065712_1000133017	68
186	3300005293	Ga0065715_10001224	Ga0065715_1000122412	68
187	3300005293	Ga0065715_10039766	Ga0065715_100397662	68
188	3300005295	Ga0065707_10005266	Ga0065707_100052663	68
189	3300005295	Ga0065707_10009445	Ga0065707_100094451	68
190	3300005328	Ga0070676_10167547	Ga0070676_101675472	68
191	3300005328	Ga0070676_10479504	Ga0070676_104795042	68
192	3300005331	Ga0070670_100010048	Ga0070670_1000100486	68
193	3300005331	Ga0070670_100598146	Ga0070670_1005981462	68
194	3300005333	Ga0070677_10012225	Ga0070677_100122253	68
195	3300005334	Ga0068869_100282195	Ga0068869_1002821951	68
196	3300005334	Ga0068869_100408049	Ga0068869_1004080493	68
197	3300005335	Ga0070666_10117981	Ga0070666_101179811	68
198	3300005335	Ga0070666_10125087	Ga0070666_101250872	68
199	3300005336	Ga0070680_100051427	Ga0070680_1000514272	68
200	3300005336	Ga0070680_101381128	Ga0070680_1013811282	68
201	3300005337	Ga0070682_101437439	Ga0070682_1014374392	68
202	3300005338	Ga0068868_100412373	Ga0068868_1004123731	68
203	3300005338	Ga0068868_100853412	Ga0068868_1008534121	68
204	3300005339	Ga0070660_101318053	Ga0070660_1013180531	68
205	3300005340	Ga0070689_101965495	Ga0070689_1019654952	68
206	3300005343	Ga0070687_100059235	Ga0070687_1000592353	68
207	3300005345	Ga0070692_10663495	Ga0070692_106634952	68
208	3300005345	Ga0070692_10976751	Ga0070692_109767512	68
209	3300005347	Ga0070668_100196990	Ga0070668_1001969903	68
210	3300005353	Ga0070669_100096745	Ga0070669_1000967454	68
211	3300005353	Ga0070669_100108328	Ga0070669_1001083283	68
212	3300005353	Ga0070669_100714780	Ga0070669_1007147802	68
213	3300005353	Ga0070669_101659450	Ga0070669_1016594501	68
214	3300005354	Ga0070675_100077243	Ga0070675_1000772434	68
215	3300005354	Ga0070675_100350313	Ga0070675_1003503134	68
216	3300005354	Ga0070675_100409789	Ga0070675_1004097891	68
217	3300005354	Ga0070675_100768639	Ga0070675_1007686391	68
218	3300005356	Ga0070674_100211775	Ga0070674_1002117754	68
219	3300005356	Ga0070674_100933499	Ga0070674_1009334992	68
220	3300005356	Ga0070674_101485387	Ga0070674_1014853871	68
221	3300005356	Ga0070674_101486493	Ga0070674_1014864931	68
222	3300005364	Ga0070673_100003685	Ga0070673_10000368516	68
223	3300005364	Ga0070673_100075590	Ga0070673_1000755902	68
224	3300005365	Ga0070688_100125305	Ga0070688_1001253053	68
225	3300005365	Ga0070688_100573335	Ga0070688_1005733352	68
226	3300005367	Ga0070667_100547407	Ga0070667_1005474073	68
227	3300005367	Ga0070667_100578669	Ga0070667_1005786692	68
228	3300005436	Ga0070713_101350369	Ga0070713_1013503691	68
229	3300005440	Ga0070705_100815040	Ga0070705_1008150402	68
230	3300005441	Ga0070700_100202089	Ga0070700_1002020893	68
231	3300005441	Ga0070700_101067585	Ga0070700_1010675852	68
232	3300005441	Ga0070700_102010158	Ga0070700_1020101581	68
233	3300005444	Ga0070694_100664588	Ga0070694_1006645882	68
234	3300005444	Ga0070694_101959264	Ga0070694_1019592641	68
235	3300005445	Ga0070708_102074396	Ga0070708_1020743962	68
236	3300005456	Ga0070678_100082872	Ga0070678_1000828725	68
237	3300005456	Ga0070678_100659057	Ga0070678_1006590572	68
238	3300005456	Ga0070678_101396662	Ga0070678_1013966621	68
239	3300005457	Ga0070662_100019082	Ga0070662_10001908212	68
240	3300005457	Ga0070662_100642736	Ga0070662_1006427362	68
241	3300005457	Ga0070662_101497379	Ga0070662_1014973792	68
242	3300005458	Ga0070681_11166878	Ga0070681_111668781	68
243	3300005459	Ga0068867_100232653	Ga0068867_1002326532	68
244	3300005459	Ga0068867_100423213	Ga0068867_1004232131	68
245	3300005459	Ga0068867_101129879	Ga0068867_1011298792	68
246	3300005466	Ga0070685_10059148	Ga0070685_100591484	68
247	3300005467	Ga0070706_100494586	Ga0070706_1004945862	68
248	3300005468	Ga0070707_100344796	Ga0070707_1003447962	68
249	3300005471	Ga0070698_102193497	Ga0070698_1021934971	68
250	3300005518	Ga0070699_100085640	Ga0070699_1000856402	68
251	3300005518	Ga0070699_100828913	Ga0070699_1008289132	68
252	3300005518	Ga0070699_101327883	Ga0070699_1013278832	68
253	3300005543	Ga0070672_100082890	Ga0070672_1000828903	68
254	3300005543	Ga0070672_100750336	Ga0070672_1007503361	68
255	3300005543	Ga0070672_100928176	Ga0070672_1009281762	68
256	3300005544	Ga0070686_100337368	Ga0070686_1003373683	68
257	3300005545	Ga0070695_100099062	Ga0070695_1000990623	68
258	3300005545	Ga0070695_100644823	Ga0070695_1006448232	68
259	3300005546	Ga0070696_100227575	Ga0070696_1002275753	68
260	3300005549	Ga0070704_100332922	Ga0070704_1003329221	68
261	3300005564	Ga0070664_100297929	Ga0070664_1002979292	68
262	3300005564	Ga0070664_101010568	Ga0070664_1010105681	68
263	3300005564	Ga0070664_101274663	Ga0070664_1012746631	68
264	3300005577	Ga0068857_100136997	Ga0068857_1001369972	68
265	3300005577	Ga0068857_102074594	Ga0068857_1020745942	68
266	3300005578	Ga0068854_100799981	Ga0068854_1007999812	68
267	3300005614	Ga0068856_100512946	Ga0068856_1005129463	68
268	3300005615	Ga0070702_100785839	Ga0070702_1007858392	68
269	3300005616	Ga0068852_101587045	Ga0068852_1015870452	68
270	3300005617	Ga0068859_100096871	Ga0068859_1000968714	68
271	3300005617	Ga0068859_100801551	Ga0068859_1008015512	68
272	3300005617	Ga0068859_103172371	Ga0068859_1031723712	68
273	3300005618	Ga0068864_100359108	Ga0068864_1003591083	68
274	3300005618	Ga0068864_100553109	Ga0068864_1005531092	68
275	3300005718	Ga0068866_10207682	Ga0068866_102076822	68
276	3300005719	Ga0068861_100263499	Ga0068861_1002634993	68
277	3300005719	Ga0068861_101318157	Ga0068861_1013181572	68
278	3300005840	Ga0068870_10103466	Ga0068870_101034663	68
279	3300005840	Ga0068870_10111021	Ga0068870_101110212	68
280	3300005840	Ga0068870_10114181	Ga0068870_101141813	68
281	3300005841	Ga0068863_100594476	Ga0068863_1005944763	68
282	3300005841	Ga0068863_100598104	Ga0068863_1005981043	68
283	3300005841	Ga0068863_101934851	Ga0068863_1019348512	68
284	3300005841	Ga0068863_102033711	Ga0068863_1020337112	68
285	3300005843	Ga0068860_100389439	Ga0068860_1003894392	68
286	3300005843	Ga0068860_102332178	Ga0068860_1023321781	68
287	3300005843	Ga0068860_102683472	Ga0068860_1026834722	68
288	3300005844	Ga0068862_100377333	Ga0068862_1003773331	68
289	3300005844	Ga0068862_100626209	Ga0068862_1006262092	68
290	3300005844	Ga0068862_100912735	Ga0068862_1009127352	68
291	3300005985	Ga0081539_10000215	Ga0081539_10000215136	68
292	3300006237	Ga0097621_102240313	Ga0097621_1022403132	68
293	3300006844	Ga0075428_100036785	Ga0075428_10003678511	68
294	3300006844	Ga0075428_100045925	Ga0075428_1000459252	68
295	3300006844	Ga0075428_100860247	Ga0075428_1008602472	68
296	3300006844	Ga0075428_100963257	Ga0075428_1009632573	68
297	3300006846	Ga0075430_100004914	Ga0075430_1000049144	68
298	3300006846	Ga0075430_100156036	Ga0075430_1001560361	68
299	3300006846	Ga0075430_100565875	Ga0075430_1005658753	68
300	3300006846	Ga0075430_100902808	Ga0075430_1009028082	68
301	3300006846	Ga0075430_100943424	Ga0075430_1009434242	68
302	3300006847	Ga0075431_100009893	Ga0075431_1000098934	68
303	3300006847	Ga0075431_100240279	Ga0075431_1002402793	68
304	3300006847	Ga0075431_100550306	Ga0075431_1005503062	68
305	3300006852	Ga0075433_10007511	Ga0075433_100075112	68
306	3300006852	Ga0075433_10651102	Ga0075433_106511022	68
307	3300006871	Ga0075434_100096102	Ga0075434_1000961022	68
308	3300006871	Ga0075434_100149750	Ga0075434_1001497504	68
309	3300006880	Ga0075429_100153624	Ga0075429_1001536242	68
310	3300006880	Ga0075429_100211148	Ga0075429_1002111481	68
311	3300006880	Ga0075429_100622485	Ga0075429_1006224852	68
312	3300006880	Ga0075429_101275868	Ga0075429_1012758682	68
313	3300006880	Ga0075429_101279873	Ga0075429_1012798732	68
314	3300006881	Ga0068865_100088512	Ga0068865_1000885124	68
315	3300006881	Ga0068865_100807775	Ga0068865_1008077752	68
316	3300006881	Ga0068865_101422583	Ga0068865_1014225832	68
317	3300006931	Ga0097620_100096869	Ga0097620_1000968694	68
318	3300006931	Ga0097620_100801593	Ga0097620_1008015932	68
319	3300006931	Ga0097620_103172379	Ga0097620_1031723792	68
320	3300007076	Ga0075435_100037667	Ga0075435_1000376673	68
321	3300009093	Ga0105240_11452056	Ga0105240_114520562	68
322	3300009094	Ga0111539_10011587	Ga0111539_1001158721	68
323	3300009094	Ga0111539_10093123	Ga0111539_100931234	68
324	3300009094	Ga0111539_10177333	Ga0111539_101773333	68
325	3300009094	Ga0111539_10357403	Ga0111539_103574033	68
326	3300009094	Ga0111539_10559524	Ga0111539_105595242	68
327	3300009094	Ga0111539_11841041	Ga0111539_118410412	68
328	3300009094	Ga0111539_12143603	Ga0111539_121436032	68
329	3300009094	Ga0111539_13487180	Ga0111539_134871802	68
330	3300009098	Ga0105245_12323835	Ga0105245_123238352	68
331	3300009147	Ga0114129_10023812	Ga0114129_100238129	68
332	3300009147	Ga0114129_10082942	Ga0114129_100829422	68
333	3300009147	Ga0114129_10279353	Ga0114129_102793535	68
334	3300009147	Ga0114129_11467773	Ga0114129_114677732	68
335	3300009147	Ga0114129_11835556	Ga0114129_118355562	68
336	3300009147	Ga0114129_12369890	Ga0114129_123698902	68
337	3300009148	Ga0105243_10765681	Ga0105243_107656812	68
338	3300009174	Ga0105241_11656763	Ga0105241_116567631	68
339	3300009176	Ga0105242_10265801	Ga0105242_102658012	68
340	3300009177	Ga0105248_11764110	Ga0105248_117641102	68
341	3300009177	Ga0105248_12769717	Ga0105248_127697172	68
342	3300009553	Ga0105249_10663269	Ga0105249_106632692	68
343	3300009553	Ga0105249_10663859	Ga0105249_106638592	68
344	3300009553	Ga0105249_12283588	Ga0105249_122835882	68
345	3300009553	Ga0105249_12958810	Ga0105249_129588102	68
346	3300010375	Ga0105239_11177761	Ga0105239_111777612	68
347	3300011119	Ga0105246_11541608	Ga0105246_115416082	68
348	3300013102	Ga0157371_10311770	Ga0157371_103117703	68
349	3300013297	Ga0157378_10402678	Ga0157378_104026782	68
350	3300013306	Ga0163162_10055707	Ga0163162_100557079	68
351	3300013306	Ga0163162_10741123	Ga0163162_107411233	68
352	3300013308	Ga0157375_10138512	Ga0157375_101385121	68
353	3300013308	Ga0157375_10268186	Ga0157375_102681863	68
354	3300013308	Ga0157375_10822547	Ga0157375_108225472	68
355	3300013308	Ga0157375_10943897	Ga0157375_109438972	68
356	3300014325	Ga0163163_10216917	Ga0163163_102169173	68
357	3300014325	Ga0163163_10219521	Ga0163163_102195213	68
358	3300014325	Ga0163163_12028757	Ga0163163_120287571	68
359	3300014325	Ga0163163_12318255	Ga0163163_123182552	68
360	3300014326	Ga0157380_10279446	Ga0157380_102794462	68
361	3300014326	Ga0157380_11321689	Ga0157380_113216892	68
362	3300014326	Ga0157380_11371958	Ga0157380_113719582	68
363	3300014326	Ga0157380_11430877	Ga0157380_114308772	68
364	3300014745	Ga0157377_10345707	Ga0157377_103457072	68
365	3300014745	Ga0157377_11478331	Ga0157377_114783312	68
366	3300014968	Ga0157379_10828217	Ga0157379_108282172	68
367	3300017792	Ga0163161_10477911	Ga0163161_104779112	68
368	3300017792	Ga0163161_10659478	Ga0163161_106594782	68
369	3300025271	Ga0207666_1009561	Ga0207666_10095612	68
370	3300025315	Ga0207697_10549721	Ga0207697_105497212	68
371	3300025893	Ga0207682_10006707	Ga0207682_100067073	68
372	3300025893	Ga0207682_10027880	Ga0207682_100278803	68
373	3300025893	Ga0207682_10106620	Ga0207682_101066202	68
374	3300025899	Ga0207642_10730795	Ga0207642_107307952	68
375	3300025901	Ga0207688_10029115	Ga0207688_100291153	68
376	3300025901	Ga0207688_10073514	Ga0207688_100735143	68
377	3300025903	Ga0207680_10100869	Ga0207680_101008695	68
378	3300025903	Ga0207680_10308481	Ga0207680_103084812	68
379	3300025903	Ga0207680_10958448	Ga0207680_109584482	68
380	3300025905	Ga0207685_10325923	Ga0207685_103259232	68
381	3300025907	Ga0207645_10012143	Ga0207645_1001214314	68
382	3300025907	Ga0207645_10222886	Ga0207645_102228862	68
383	3300025907	Ga0207645_10270114	Ga0207645_102701141	68
384	3300025907	Ga0207645_10402842	Ga0207645_104028422	68
385	3300025908	Ga0207643_10003397	Ga0207643_100033978	68
386	3300025908	Ga0207643_10130789	Ga0207643_101307893	68
387	3300025908	Ga0207643_10313115	Ga0207643_103131152	68
388	3300025908	Ga0207643_10372695	Ga0207643_103726951	68
389	3300025910	Ga0207684_10567778	Ga0207684_105677782	68
390	3300025917	Ga0207660_11066625	Ga0207660_110666252	68
391	3300025917	Ga0207660_11616943	Ga0207660_116169432	68
392	3300025920	Ga0207649_11397106	Ga0207649_113971062	68
393	3300025922	Ga0207646_10577019	Ga0207646_105770192	68
394	3300025923	Ga0207681_10119766	Ga0207681_101197662	68
395	3300025923	Ga0207681_10131285	Ga0207681_101312853	68
396	3300025923	Ga0207681_10397113	Ga0207681_103971133	68
397	3300025923	Ga0207681_10666440	Ga0207681_106664402	68
398	3300025923	Ga0207681_10682727	Ga0207681_106827271	68
399	3300025923	Ga0207681_11313093	Ga0207681_113130932	68
400	3300025925	Ga0207650_10054826	Ga0207650_100548267	68
401	3300025925	Ga0207650_10365707	Ga0207650_103657072	68
402	3300025925	Ga0207650_10447562	Ga0207650_104475622	68
403	3300025926	Ga0207659_10011349	Ga0207659_100113492	68
404	3300025926	Ga0207659_10021970	Ga0207659_100219703	68
405	3300025926	Ga0207659_10156584	Ga0207659_101565842	68
406	3300025931	Ga0207644_11757738	Ga0207644_117577382	68
407	3300025932	Ga0207690_11749448	Ga0207690_117494481	68
408	3300025933	Ga0207706_10136699	Ga0207706_101366991	68
409	3300025933	Ga0207706_10447423	Ga0207706_104474232	68
410	3300025933	Ga0207706_11042719	Ga0207706_110427192	68
411	3300025935	Ga0207709_11294862	Ga0207709_112948622	68
412	3300025935	Ga0207709_11790561	Ga0207709_117905612	68
413	3300025936	Ga0207670_11421192	Ga0207670_114211922	68
414	3300025937	Ga0207669_10117996	Ga0207669_101179962	68
415	3300025937	Ga0207669_10564199	Ga0207669_105641992	68
416	3300025937	Ga0207669_10758537	Ga0207669_107585372	68
417	3300025940	Ga0207691_10016722	Ga0207691_100167223	68
418	3300025940	Ga0207691_10306224	Ga0207691_103062242	68
419	3300025940	Ga0207691_10451428	Ga0207691_104514282	68
420	3300025941	Ga0207711_10864761	Ga0207711_108647612	68
421	3300025942	Ga0207689_10160774	Ga0207689_101607742	68
422	3300025942	Ga0207689_10939481	Ga0207689_109394812	68
423	3300025945	Ga0207679_10216354	Ga0207679_102163543	68
424	3300025945	Ga0207679_10446337	Ga0207679_104463372	68
425	3300025945	Ga0207679_11125531	Ga0207679_111255312	68
426	3300025960	Ga0207651_10173613	Ga0207651_101736132	68
427	3300025960	Ga0207651_11001930	Ga0207651_110019302	68
428	3300025960	Ga0207651_11249827	Ga0207651_112498272	68
429	3300025960	Ga0207651_11847938	Ga0207651_118479382	68
430	3300025961	Ga0207712_10401611	Ga0207712_104016112	68
431	3300025961	Ga0207712_11570924	Ga0207712_115709242	68
432	3300025981	Ga0207640_10663334	Ga0207640_106633343	68
433	3300025986	Ga0207658_10603394	Ga0207658_106033942	68
434	3300025986	Ga0207658_10737894	Ga0207658_107378942	68
435	3300025986	Ga0207658_11489922	Ga0207658_114899222	68
436	3300026023	Ga0207677_10385665	Ga0207677_103856651	68
437	3300026067	Ga0207678_10889721	Ga0207678_108897212	68
438	3300026075	Ga0207708_10090767	Ga0207708_100907672	68
439	3300026075	Ga0207708_10155711	Ga0207708_101557113	68
440	3300026075	Ga0207708_10179429	Ga0207708_101794293	68
441	3300026075	Ga0207708_10758681	Ga0207708_107586812	68
442	3300026075	Ga0207708_11794383	Ga0207708_117943832	68
443	3300026088	Ga0207641_10543105	Ga0207641_105431053	68
444	3300026088	Ga0207641_11191203	Ga0207641_111912032	68
445	3300026088	Ga0207641_11581502	Ga0207641_115815022	68
446	3300026089	Ga0207648_10329870	Ga0207648_103298703	68
447	3300026089	Ga0207648_10423599	Ga0207648_104235992	68
448	3300026089	Ga0207648_11367643	Ga0207648_113676432	68
449	3300026089	Ga0207648_12243846	Ga0207648_122438461	68
450	3300026095	Ga0207676_10038236	Ga0207676_100382365	68
451	3300026095	Ga0207676_10162244	Ga0207676_101622442	68
452	3300026095	Ga0207676_10170810	Ga0207676_101708102	68
453	3300026116	Ga0207674_10096945	Ga0207674_100969452	68
454	3300026116	Ga0207674_10475922	Ga0207674_104759222	68
455	3300026116	Ga0207674_11601872	Ga0207674_116018722	68
456	3300026118	Ga0207675_100049309	Ga0207675_1000493092	68
457	3300026118	Ga0207675_102275634	Ga0207675_1022756342	68
458	3300026121	Ga0207683_10041503	Ga0207683_1004150310	68
459	3300026121	Ga0207683_10298010	Ga0207683_102980104	68
460	3300026121	Ga0207683_10907126	Ga0207683_109071262	68
461	3300026121	Ga0207683_11022626	Ga0207683_110226262	68
462	3300027617	Ga0210002_1042784	Ga0210002_10427842	68
463	3300027682	Ga0209971_1013410	Ga0209971_10134104	68
464	3300027682	Ga0209971_1063313	Ga0209971_10633132	68
465	3300027695	Ga0209966_1049674	Ga0209966_10496741	68
466	3300027876	Ga0209974_10274760	Ga0209974_102747602	68
467	3300027876	Ga0209974_10411471	Ga0209974_104114712	68
468	3300027907	Ga0207428_10001541	Ga0207428_1000154117	68
469	3300027907	Ga0207428_10018444	Ga0207428_100184447	68
470	3300027907	Ga0207428_10790116	Ga0207428_107901161	68
471	3300028380	Ga0268265_10267882	Ga0268265_102678824	68
472	3300028380	Ga0268265_11118159	Ga0268265_111181592	68
473	3300028381	Ga0268264_10443232	Ga0268264_104432321	68
474	3300028381	Ga0268264_11937806	Ga0268264_119378062	68
475	3300031824	Ga0307413_10754067	Ga0307413_107540672	68
476	3300031824	Ga0307413_11056480	Ga0307413_110564802	68
477	3300031852	Ga0307410_10668676	Ga0307410_106686762	68
478	3300031903	Ga0307407_10631910	Ga0307407_106319101	68
479	3300035111	Ga0373923_0213150	Ga0373923_0213150_222_431	68
480	3300035119	Ga0373956_0172409	Ga0373956_0172409_511_720	68
481	3300037068	Ga0373925_0545741	Ga0373925_0545741_78_284	68
482	3300041408	Ga0439453_0007184	Ga0439453_0007184_1357_1563	68
483	3300042012	Ga0439455_0211226	Ga0439455_0211226_252_458	68
484	3300042122	Ga0450920_107747	Ga0450920_107747_47_253	68
485	3300042125	Ga0450923_068022	Ga0450923_068022_321_527	68
486	3300042125	Ga0450923_151902	Ga0450923_151902_59_265	68
487	3300042133	Ga0450896_050272	Ga0450896_050272_421_627	68
488	3300042157	Ga0439458_0181114	Ga0439458_0181114_254_460	68
489	3300042437	Ga0439444_0004779	Ga0439444_0004779_192_398	68
490	3300042437	Ga0439444_0036252	Ga0439444_0036252_516_728	68
491	3300042438	Ga0439459_0080843	Ga0439459_0080843_333_539	68
492	3300042439	Ga0439464_0087594	Ga0439464_0087594_694_900	68
493	3300042439	Ga0439464_0174631	Ga0439464_0174631_29_235	68
494	3300042461	Ga0439460_0252438	Ga0439460_0252438_351_557	68
495	3300042530	Ga0450916_014348	Ga0450916_014348_50_256	68
496	3300042532	Ga0450893_0046786	Ga0450893_0046786_258_476	68
497	3300046514	Ga0495618_0247624	Ga0495618_0247624_437_643	68
498	3300046525	Ga0495663_0059369	Ga0495663_0059369_655_861	68
499	3300046533	Ga0495640_0472351	Ga0495640_0472351_288_497	68
500	3300046537	Ga0495598_0010641	Ga0495598_0010641_929_1135	68
501	3300046537	Ga0495598_0031457	Ga0495598_0031457_392_598	68
502	3300046539	Ga0495621_0042836	Ga0495621_0042836_1128_1334	68
503	3300046539	Ga0495621_0265214	Ga0495621_0265214_32_238	68
504	3300046615	Ga0495656_0024718	Ga0495656_0024718_770_976	68
505	3300046615	Ga0495656_0032868	Ga0495656_0032868_1107_1313	68
506	3300046615	Ga0495656_0804137	Ga0495656_0804137_225_434	68
507	3300046663	Ga0495635_0468207	Ga0495635_0468207_336_545	68
508	3300046664	Ga0495659_0033199	Ga0495659_0033199_344_550	68
509	3300046664	Ga0495659_0412328	Ga0495659_0412328_366_572	68
510	3300046684	Ga0495669_0083872	Ga0495669_0083872_1065_1271	68
511	3300046684	Ga0495669_0126279	Ga0495669_0126279_174_380	68
512	3300046691	Ga0495670_0067755	Ga0495670_0067755_481_687	68
513	3300046691	Ga0495670_0261327	Ga0495670_0261327_303_509	68
514	3300047444	Ga0495675_0230505	Ga0495675_0230505_673_879	68
515	3300047447	Ga0495685_228406	Ga0495685_228406_197_403	68
516	3300048904	Ga0496101_1423794	Ga0496101_1423794_151_357	68
517	3300048909	Ga0496106_0144499	Ga0496106_0144499_543_749	68
518	3300048912	Ga0496109_0070343	Ga0496109_0070343_617_823	68
519	3300048912	Ga0496109_0932796	Ga0496109_0932796_116_322	68
520	3300048915	Ga0496112_1167425	Ga0496112_1167425_217_423	68
521	3300048915	Ga0496112_1662692	Ga0496112_1662692_74_280	68
522	3300048916	Ga0496113_0092058	Ga0496113_0092058_1103_1309	68
523	3300049568	Ga0501031_0350603	Ga0501031_0350603_507_713	68
524	3300049569	Ga0501032_0867708	Ga0501032_0867708_336_542	68
525	3300049572	Ga0501036_0415887	Ga0501036_0415887_360_566	68
526	3300049572	Ga0501036_0447474	Ga0501036_0447474_682_888	68
527	3300049573	Ga0501037_0915936	Ga0501037_0915936_331_537	68
528	3300049574	Ga0501038_0946698	Ga0501038_0946698_400_606	68
529	3300049575	Ga0501039_0042299	Ga0501039_0042299_2150_2356	68
530	3300049575	Ga0501039_0418702	Ga0501039_0418702_724_930	68
531	3300049575	Ga0501039_1597308	Ga0501039_1597308_149_355	68
532	3300049576	Ga0501040_0024381	Ga0501040_0024381_1365_1571	68
533	3300049577	Ga0501041_0038438	Ga0501041_0038438_187_393	68
534	3300049577	Ga0501041_0087808	Ga0501041_0087808_1631_1837	68
535	3300049579	Ga0501043_0083347	Ga0501043_0083347_379_585	68
536	3300049580	Ga0501046_0348494	Ga0501046_0348494_829_1038	68
537	3300049580	Ga0501046_0365335	Ga0501046_0365335_189_395	68
538	3300049581	Ga0501047_0940720	Ga0501047_0940720_125_334	68
539	3300049582	Ga0501048_0087487	Ga0501048_0087487_277_483	68
540	3300049582	Ga0501048_0654298	Ga0501048_0654298_284_490	68
541	3300049587	Ga0501071_0106140	Ga0501071_0106140_1341_1547	68
542	3300049587	Ga0501071_0141611	Ga0501071_0141611_273_479	68
543	3300049588	Ga0501072_0017488	Ga0501072_0017488_2928_3134	68
544	3300049588	Ga0501072_0316376	Ga0501072_0316376_431_637	68
545	3300049590	Ga0501074_0044870	Ga0501074_0044870_1752_1958	68
546	3300049590	Ga0501074_0426627	Ga0501074_0426627_624_830	68
547	3300049591	Ga0501075_0210969	Ga0501075_0210969_264_470	68
548	3300049591	Ga0501075_0269661	Ga0501075_0269661_390_596	68
549	3300049592	Ga0501076_0015697	Ga0501076_0015697_618_824	68
550	3300049592	Ga0501076_0078951	Ga0501076_0078951_2219_2425	68
551	3300049592	Ga0501076_0835693	Ga0501076_0835693_359_565	68
552	3300049593	Ga0501077_0156344	Ga0501077_0156344_177_383	68
553	3300049593	Ga0501077_0324419	Ga0501077_0324419_426_632	68
554	3300049741	Ga0501079_0070579	Ga0501079_0070579_1881_2087	68
555	3300049742	Ga0501080_0206266	Ga0501080_0206266_1577_1783	68
556	3300049742	Ga0501080_1684054	Ga0501080_1684054_164_370	68
557	3300049743	Ga0501081_0083033	Ga0501081_0083033_1661_1867	68
558	3300049744	Ga0501083_0387714	Ga0501083_0387714_318_524	68
559	3300049822	Ga0501035_0471162	Ga0501035_0471162_591_797	68
560	3300049824	Ga0501045_0094768	Ga0501045_0094768_1409_1615	68
561	3300049824	Ga0501045_0362305	Ga0501045_0362305_723_929	68
562	3300050507	nmdc:mga05p37_17293_c1	nmdc:mga05p37_17293_c1_2302_2508	68
563	3300050507	nmdc:mga05p37_434571_c1	nmdc:mga05p37_434571_c1_1006_1215	68
564	3300050507	nmdc:mga05p37_495712_c1	nmdc:mga05p37_495712_c1_512_718	68
565	3300050507	nmdc:mga05p37_675480_c1	nmdc:mga05p37_675480_c1_847_1053	68
566	3300050507	nmdc:mga05p37_881009_c1	nmdc:mga05p37_881009_c1_549_755	68
567	3300050508	nmdc:mga09592_107905_c1	nmdc:mga09592_107905_c1_281_487	68
568	3300050508	nmdc:mga09592_39654_c1	nmdc:mga09592_39654_c1_1500_1706	68
569	3300050508	nmdc:mga09592_556463_c1	nmdc:mga09592_556463_c1_536_742	68
570	3300050508	nmdc:mga09592_620247_c1	nmdc:mga09592_620247_c1_52_258	68
571	3300050509	nmdc:mga0qj67_10318_c1	nmdc:mga0qj67_10318_c1_5036_5242	68
572	3300050509	nmdc:mga0qj67_154236_c1	nmdc:mga0qj67_154236_c1_953_1159	68
573	3300050509	nmdc:mga0qj67_34396_c1	nmdc:mga0qj67_34396_c1_3127_3333	68
574	3300050509	nmdc:mga0qj67_8629_c1	nmdc:mga0qj67_8629_c1_760_966	68
575	3300050510	nmdc:mga06r32_181423_c1	nmdc:mga06r32_181423_c1_1719_1925	68
576	3300050510	nmdc:mga06r32_25188_c1	nmdc:mga06r32_25188_c1_668_877	68
577	3300050510	nmdc:mga06r32_658738_c1	nmdc:mga06r32_658738_c1_449_655	68
578	3300050510	nmdc:mga06r32_7117_c1	nmdc:mga06r32_7117_c1_2685_2891	68
579	3300050511	nmdc:mga08y16_1053409_c1	nmdc:mga08y16_1053409_c1_570_776	68
580	3300050511	nmdc:mga08y16_1304271_c1	nmdc:mga08y16_1304271_c1_36_242	68
581	3300050511	nmdc:mga08y16_13623_c1	nmdc:mga08y16_13623_c1_3981_4187	68
582	3300050511	nmdc:mga08y16_147568_c1	nmdc:mga08y16_147568_c1_1294_1500	68
583	3300050511	nmdc:mga08y16_155_c1	nmdc:mga08y16_155_c1_10087_10296	68
584	3300050511	nmdc:mga08y16_475371_c1	nmdc:mga08y16_475371_c1_768_974	68
585	3300050512	nmdc:mga0n895_10459_c1	nmdc:mga0n895_10459_c1_6749_6955	68
586	3300050512	nmdc:mga0n895_139147_c1	nmdc:mga0n895_139147_c1_882_1088	68
587	3300050513	nmdc:mga0rr50_1983_c1	nmdc:mga0rr50_1983_c1_2789_2995	68
588	3300050515	nmdc:mga0a205_1142552_c1	nmdc:mga0a205_1142552_c1_230_436	68
589	3300050515	nmdc:mga0a205_2239_c1	nmdc:mga0a205_2239_c1_3279_3485	68
590	3300053077	Ga0495601_0379505	Ga0495601_0379505_477_686	68
591	3300053077	Ga0495601_0459340	Ga0495601_0459340_417_626	68
592	3300053078	Ga0495612_0127730	Ga0495612_0127730_727_936	68
593	3300059421	Ga0590071_035169	Ga0590071_035169_135_341	68
594	3300059423	Ga0590074_011563	Ga0590074_011563_977_1183	68
595	3300059424	Ga0590075_002910	Ga0590075_002910_3457_3663	68
596	3300059426	Ga0590077_002379	Ga0590077_002379_2791_2997	68
597	3300060353	Ga0501082_0088437	Ga0501082_0088437_1723_1929	68
598	3300060353	Ga0501082_1391964	Ga0501082_1391964_338_544	68
599	3300061734	Ga0530510_0004587	Ga0530510_0004587_6130_6336	68
600	3300061734	Ga0530510_0208522	Ga0530510_0208522_756_962	68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

29

79

0.99 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6fxc-assembly1.cif.gz_AX	the cryo-em structure of hibernating 100s ribosome dimer from pathogenic staphylococcus aureus	0.9891	12	68
5mrf-assembly1.cif.gz_U	structure of the yeast mitochondrial ribosome - class c	0.9884	13	68
7nhn-assembly1.cif.gz_3	vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes	0.9881	14	68
7pkt-assembly1.cif.gz_x	large subunit of the chlamydomonas reinhardtii mitoribosome	0.9877	12	67
4wf9-assembly1.cif.gz_W	the crystal structure of the large ribosomal subunit of staphylococcus aureus in complex with telithromycin	0.9854	13	68

ID	Description	Score	Start	End	Superfamily
af_B6SIL2_19_102_3.30.1390.20	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.9876	12	68	3.30.1390.20
1vw4U00	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.9871	13	68	3.30.1390.20
4wfbW00	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.983	12	68	3.30.1390.20
5hl7W00	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.9829	12	68	3.30.1390.20
af_P9WHA3_1_65_3.30.1390.20	Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L30/L7	0.9812	13	67	3.30.1390.20

ID	Description	Score	Start	End	GO Terms
AF-A0A0D3VF34-F1-model_v4	Large ribosomal subunit protein uL30	1.002	13	67	GO:0003735 GO:0006412 GO:0022625
AF-A0A5C6QHG6-F1-model_v4	Large ribosomal subunit protein uL30	1.001	12	68	GO:0003735 GO:0006412 GO:0022625
AF-A0A1T4VM06-F1-model_v4	Large ribosomal subunit protein uL30	1.001	12	68	GO:0003735 GO:0006412 GO:0022625
AF-A0A0F5V754-F1-model_v4	Large ribosomal subunit protein uL30	1.001	12	68	GO:0003735 GO:0006412 GO:0022625
AF-A0A6I7D6A2-F1-model_v4	Large ribosomal subunit protein uL30	1	12	68	GO:0003735 GO:0006412 GO:0022625

Feature Viewer

pLDDT	pTM	Quality
86.96	0.7	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F467941

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00327

Ribosomal_L30

Ribosomal protein L30p/L7e

29

79

0.99

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map