F467935

General Info

Members Datasets Scaffolds Average Seq Length
600 207 1200 132

Family's Representative Sequence

Representative Sequence 3300001915|JGI24741J21665_1008775|JGI24741J21665_10087754
Length 133
Sequence MIVFDLQCRDGGETFEAWFRSGADFEEQRDAGLVQCPICASANVDKAPMAPRVPRKDSDQPITRLAALQSKLLKDSRWVGDAFTDTARAMHSGEIETEQVHGNATLEQARSLLDDGVPVAPLPLRVTPPNQVN

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
160 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
161 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
174 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
196 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
197 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
198 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
199 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
200 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
201 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
202 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
203 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
204 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
205 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
206 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 5.17
Rhizosphere 94.67
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1008775 3300001915 Bacteria 1891
2 JGI24752J21851_1007792 3300001976 Bacteria 1397
3 JGI24740J21852_10054256 3300001979 Bacteria 1133
4 JGI24740J21852_10152503 3300001979 Bacteria 574
5 JGI24740J21852_10153683 3300001979 Bacteria 571
6 JGI24737J22298_10004423 3300001990 Bacteria 4899
7 JGI24737J22298_10016740 3300001990 Bacteria 2366
8 JGI24737J22298_10033648 3300001990 Bacteria 1592
9 JGI24737J22298_10041436 3300001990 Bacteria 1412
10 JGI24735J21928_10012868 3300002067 Bacteria 2641
11 JGI24735J21928_10023753 3300002067 Bacteria 1858
12 JGI24751J29686_10048114 3300002459 Bacteria 880
13 Ga0070658_10004769 3300005327 Bacteria 11028
14 Ga0070658_10707497 3300005327 Bacteria 874
15 Ga0070658_10732777 3300005327 Bacteria 858
16 Ga0070658_11073292 3300005327 Bacteria 700
17 Ga0070676_10040887 3300005328 Bacteria 2686
18 Ga0070676_10094326 3300005328 Bacteria 1839
19 Ga0070683_100088552 3300005329 Bacteria 2904
20 Ga0070683_100173081 3300005329 Bacteria 2049
21 Ga0070690_100411167 3300005330 Bacteria 996
22 Ga0070690_100453151 3300005330 Bacteria 952
23 Ga0070670_100002627 3300005331 Bacteria 14846
24 Ga0070670_100012376 3300005331 Bacteria 7301
25 Ga0070670_100142006 3300005331 Bacteria 2077
26 Ga0070670_100270536 3300005331 Bacteria 1482
27 Ga0070677_10069843 3300005333 Bacteria 1475
28 Ga0070677_10210544 3300005333 Bacteria 944
29 Ga0068869_101515347 3300005334 Bacteria 596
30 Ga0070666_10003780 3300005335 Bacteria 9176
31 Ga0070666_10010427 3300005335 Bacteria 5814
32 Ga0070680_100011194 3300005336 Bacteria 6939
33 Ga0070680_100032624 3300005336 Bacteria 4193
34 Ga0070680_100061251 3300005336 Bacteria 3080
35 Ga0070680_100358448 3300005336 Bacteria 1240
36 Ga0068868_100029891 3300005338 Bacteria 4175
37 Ga0068868_100364192 3300005338 Bacteria 1241
38 Ga0070660_100038122 3300005339 Bacteria 3646
39 Ga0070660_100072584 3300005339 Bacteria 2690
40 Ga0070660_100087503 3300005339 Bacteria 2452
41 Ga0070660_100140344 3300005339 Bacteria 1938
42 Ga0070660_100274085 3300005339 Bacteria 1380
43 Ga0070660_100590529 3300005339 Bacteria 928
44 Ga0070660_100675477 3300005339 Bacteria 865
45 Ga0070689_100223692 3300005340 Bacteria 1545
46 Ga0070687_100139177 3300005343 Bacteria 1411
47 Ga0070661_100009782 3300005344 Bacteria 6650
48 Ga0070661_100016888 3300005344 Bacteria 5166
49 Ga0070661_100139620 3300005344 Bacteria 1825
50 Ga0070661_100145700 3300005344 Bacteria 1788
51 Ga0070661_100146956 3300005344 Bacteria 1780
52 Ga0070661_100252434 3300005344 Bacteria 1361
53 Ga0070661_100288950 3300005344 Bacteria 1274
54 Ga0070661_100314053 3300005344 Bacteria 1223
55 Ga0070661_100406225 3300005344 Bacteria 1078
56 Ga0070661_100450870 3300005344 Bacteria 1023
57 Ga0070661_101381511 3300005344 Bacteria 592
58 Ga0070692_10177342 3300005345 Bacteria 1233
59 Ga0070692_10659127 3300005345 Bacteria 700
60 Ga0070675_100211770 3300005354 Bacteria 1685
61 Ga0070675_101247310 3300005354 Bacteria 685
62 Ga0070671_100021209 3300005355 Bacteria 5305
63 Ga0070671_100183561 3300005355 Bacteria 1772
64 Ga0070671_100228915 3300005355 Bacteria 1577
65 Ga0070671_100449947 3300005355 Bacteria 1105
66 Ga0070674_100097243 3300005356 Bacteria 2138
67 Ga0070673_100005516 3300005364 Bacteria 8104
68 Ga0070673_100053655 3300005364 Bacteria 3168
69 Ga0070673_100370030 3300005364 Bacteria 1276
70 Ga0070673_100406950 3300005364 Bacteria 1218
71 Ga0070659_100054364 3300005366 Bacteria 3153
72 Ga0070659_100241689 3300005366 Bacteria 1494
73 Ga0070659_100585623 3300005366 Bacteria 958
74 Ga0070659_100683581 3300005366 Bacteria 886
75 Ga0070667_100007652 3300005367 Bacteria 8957
76 Ga0070667_100017936 3300005367 Bacteria 5867
77 Ga0070667_100446329 3300005367 Bacteria 1182
78 Ga0070667_100579610 3300005367 Bacteria 1033
79 Ga0070667_101897533 3300005367 Bacteria 561
80 Ga0070714_100023919 3300005435 Bacteria 5025
81 Ga0070714_100025168 3300005435 Bacteria 4909
82 Ga0070714_100045059 3300005435 Bacteria 3737
83 Ga0070713_100009927 3300005436 Bacteria 6853
84 Ga0070701_10323728 3300005438 Bacteria 955
85 Ga0070663_100025864 3300005455 Bacteria 3967
86 Ga0070663_100176941 3300005455 Bacteria 1652
87 Ga0070663_100339238 3300005455 Bacteria 1214
88 Ga0070663_100984075 3300005455 Bacteria 733
89 Ga0070678_100004461 3300005456 Bacteria 7940
90 Ga0070678_100079545 3300005456 Bacteria 2480
91 Ga0070662_100000866 3300005457 Bacteria 18520
92 Ga0070662_100015772 3300005457 Bacteria 5066
93 Ga0070662_100073072 3300005457 Bacteria 2534
94 Ga0070662_100078928 3300005457 Bacteria 2446
95 Ga0070662_100117206 3300005457 Bacteria 2037
96 Ga0070662_100266832 3300005457 Bacteria 1381
97 Ga0070662_100615064 3300005457 Bacteria 915
98 Ga0070662_101149616 3300005457 Bacteria 667
99 Ga0070662_101545174 3300005457 Bacteria 572
100 Ga0070681_10086675 3300005458 Bacteria 3084
101 Ga0070681_10713807 3300005458 Bacteria 919
102 Ga0070681_10907402 3300005458 Bacteria 800
103 Ga0068867_100082618 3300005459 Bacteria 2424
104 Ga0070685_10147321 3300005466 Bacteria 1489
105 Ga0070679_100022042 3300005530 Bacteria 6223
106 Ga0070679_100108240 3300005530 Bacteria 2765
107 Ga0070679_100145218 3300005530 Bacteria 2350
108 Ga0070679_100427397 3300005530 Bacteria 1270
109 Ga0070679_100616314 3300005530 Bacteria 1028
110 Ga0070679_100976832 3300005530 Bacteria 791
111 Ga0070684_101383819 3300005535 Bacteria 662
112 Ga0068853_100047412 3300005539 Bacteria 3687
113 Ga0068853_100393097 3300005539 Bacteria 1297
114 Ga0068853_100460072 3300005539 Bacteria 1197
115 Ga0068853_100641326 3300005539 Bacteria 1011
116 Ga0068853_100711251 3300005539 Bacteria 959
117 Ga0068853_102175356 3300005539 Bacteria 538
118 Ga0070672_100004370 3300005543 Bacteria 9260
119 Ga0070672_100465297 3300005543 Bacteria 1090
120 Ga0070686_100546213 3300005544 Bacteria 906
121 Ga0070695_100952673 3300005545 Bacteria 696
122 Ga0070693_100665723 3300005547 Bacteria 759
123 Ga0070665_100047968 3300005548 Bacteria 4288
124 Ga0070665_100715064 3300005548 Bacteria 1015
125 Ga0068855_100111436 3300005563 Bacteria 3141
126 Ga0068855_100401184 3300005563 Bacteria 1503
127 Ga0070664_100003352 3300005564 Bacteria 12952
128 Ga0070664_100012903 3300005564 Bacteria 6798
129 Ga0070664_100035952 3300005564 Bacteria 4160
130 Ga0070664_100086103 3300005564 Bacteria 2715
131 Ga0070664_100089714 3300005564 Bacteria 2660
132 Ga0070664_100547593 3300005564 Bacteria 1070
133 Ga0068857_100000325 3300005577 Bacteria 32762
134 Ga0068857_100008239 3300005577 Bacteria 9007
135 Ga0068857_100023606 3300005577 Bacteria 5415
136 Ga0068857_100067419 3300005577 Bacteria 3185
137 Ga0068854_100166108 3300005578 Bacteria 1713
138 Ga0068854_100177936 3300005578 Bacteria 1660
139 Ga0068854_100544313 3300005578 Bacteria 984
140 Ga0068856_100180259 3300005614 Bacteria 2125
141 Ga0068856_100235656 3300005614 Bacteria 1846
142 Ga0068856_100279615 3300005614 Bacteria 1686
143 Ga0068856_101210671 3300005614 Bacteria 771
144 Ga0068856_101976803 3300005614 Bacteria 594
145 Ga0070702_100279385 3300005615 Bacteria 1146
146 Ga0068852_100003856 3300005616 Bacteria 10531
147 Ga0068852_100063800 3300005616 Bacteria 3208
148 Ga0068852_100146549 3300005616 Bacteria 2190
149 Ga0068852_100314819 3300005616 Bacteria 1518
150 Ga0068852_101031994 3300005616 Bacteria 841
151 Ga0068859_100009553 3300005617 Bacteria 9791
152 Ga0068859_100072677 3300005617 Bacteria 3476
153 Ga0068864_100004140 3300005618 Bacteria 11901
154 Ga0068864_100020609 3300005618 Bacteria 5515
155 Ga0068864_100060921 3300005618 Bacteria 3268
156 Ga0068864_101211781 3300005618 Bacteria 754
157 Ga0068861_101725639 3300005719 Bacteria 620
158 Ga0068861_102109652 3300005719 Bacteria 564
159 Ga0068851_10079041 3300005834 Bacteria 1715
160 Ga0068851_10079141 3300005834 Bacteria 1713
161 Ga0068863_100005936 3300005841 Bacteria 11976
162 Ga0068863_100006661 3300005841 Bacteria 11336
163 Ga0068863_100020798 3300005841 Bacteria 6267
164 Ga0068863_100023227 3300005841 Bacteria 5926
165 Ga0068863_101303886 3300005841 Bacteria 733
166 Ga0068863_102139384 3300005841 Bacteria 570
167 Ga0068858_100003340 3300005842 Bacteria 15975
168 Ga0068858_100003679 3300005842 Bacteria 15192
169 Ga0068858_100023693 3300005842 Bacteria 5718
170 Ga0068860_100009867 3300005843 Bacteria 9467
171 Ga0068860_100089601 3300005843 Bacteria 2929
172 Ga0068860_100452568 3300005843 Bacteria 1277
173 Ga0068862_100010153 3300005844 Bacteria 7769
174 Ga0068862_100164289 3300005844 Bacteria 1984
175 Ga0081539_10098674 3300005985 Bacteria 1493
176 Ga0070717_10002077 3300006028 Bacteria 14029
177 Ga0070716_100298750 3300006173 Bacteria 1119
178 Ga0097621_100003188 3300006237 Bacteria 11278
179 Ga0068871_100032309 3300006358 Bacteria 4133
180 Ga0068871_100038312 3300006358 Bacteria 3827
181 Ga0068865_100845107 3300006881 Bacteria 793
182 Ga0097620_100009553 3300006931 Bacteria 9791
183 Ga0097620_100072676 3300006931 Bacteria 3476
184 Ga0105251_10023594 3300009011 Bacteria 3172
185 Ga0105245_11186064 3300009098 Bacteria 811
186 Ga0105247_10134492 3300009101 Bacteria 1614
187 Ga0105243_12993058 3300009148 Unclassified 512
188 Ga0105241_10216474 3300009174 Bacteria 1607
189 Ga0105242_10134224 3300009176 Bacteria 2140
190 Ga0105242_10377229 3300009176 Bacteria 1317
191 Ga0105248_10003888 3300009177 Bacteria 16511
192 Ga0105248_10004674 3300009177 Bacteria 15154
193 Ga0105248_11120632 3300009177 Bacteria 889
194 Ga0105237_10072981 3300009545 Bacteria 3424
195 Ga0105238_10294424 3300009551 Bacteria 1606
196 Ga0105249_10011978 3300009553 Bacteria 7628
197 Ga0105249_10819636 3300009553 Bacteria 995
198 Ga0105239_12181076 3300010375 Bacteria 644
199 Ga0105246_10057416 3300011119 Bacteria 2693
200 Ga0105246_10095415 3300011119 Bacteria 2153
201 Ga0105246_10157233 3300011119 Bacteria 1728
202 Ga0157373_10028381 3300013100 Bacteria 4036
203 Ga0157373_10041410 3300013100 Bacteria 3295
204 Ga0157373_10048778 3300013100 Bacteria 3019
205 Ga0157373_10054747 3300013100 Bacteria 2834
206 Ga0157373_10117482 3300013100 Bacteria 1869
207 Ga0157373_10197757 3300013100 Bacteria 1417
208 Ga0157373_10289971 3300013100 Bacteria 1161
209 Ga0157371_10033953 3300013102 Bacteria 3663
210 Ga0157371_10042456 3300013102 Bacteria 3241
211 Ga0157371_10056524 3300013102 Bacteria 2784
212 Ga0157371_10125525 3300013102 Bacteria 1825
213 Ga0157371_10162919 3300013102 Bacteria 1593
214 Ga0157371_10852361 3300013102 Bacteria 689
215 Ga0157371_11302404 3300013102 Bacteria 562
216 Ga0157370_10122089 3300013104 Bacteria 2433
217 Ga0157370_10441629 3300013104 Bacteria 1196
218 Ga0157370_10526892 3300013104 Bacteria 1084
219 Ga0157369_10024494 3300013105 Bacteria 6713
220 Ga0157369_10060288 3300013105 Bacteria 4092
221 Ga0157369_10144172 3300013105 Bacteria 2518
222 Ga0157369_10327270 3300013105 Bacteria 1592
223 Ga0157369_10644014 3300013105 Bacteria 1093
224 Ga0157369_11728168 3300013105 Bacteria 636
225 Ga0157374_10005377 3300013296 Bacteria 10757
226 Ga0157374_10147413 3300013296 Bacteria 2286
227 Ga0157374_10516494 3300013296 Bacteria 1200
228 Ga0157378_10395148 3300013297 Bacteria 1361
229 Ga0157378_11074138 3300013297 Bacteria 841
230 Ga0163162_10660132 3300013306 Bacteria 1169
231 Ga0163162_11745950 3300013306 Bacteria 711
232 Ga0157372_10233079 3300013307 Bacteria 2135
233 Ga0157372_10281738 3300013307 Bacteria 1932
234 Ga0157372_11435029 3300013307 Bacteria 795
235 Ga0157375_10015225 3300013308 Bacteria 6881
236 Ga0157375_11390835 3300013308 Bacteria 826
237 Ga0163163_10003320 3300014325 Bacteria 13646
238 Ga0163163_10005065 3300014325 Bacteria 11360
239 Ga0163163_10031079 3300014325 Bacteria 5151
240 Ga0163163_10177361 3300014325 Bacteria 2178
241 Ga0163163_11180438 3300014325 Bacteria 828
242 Ga0182008_10641031 3300014497 Bacteria 601
243 Ga0157377_10064773 3300014745 Bacteria 2097
244 Ga0157379_10020582 3300014968 Bacteria 5836
245 Ga0157379_10490137 3300014968 Bacteria 1138
246 Ga0157376_11696928 3300014969 Bacteria 667
247 Ga0163161_10156513 3300017792 Bacteria 1735
248 Ga0206356_10595307 3300020070 Bacteria 938
249 Ga0206353_11024971 3300020082 Bacteria 688
250 Ga0207697_10004795 3300025315 Bacteria 6399
251 Ga0207697_10269455 3300025315 Bacteria 754
252 Ga0207713_1242696 3300025735 Unclassified 534
253 Ga0207682_10087951 3300025893 Bacteria 1343
254 Ga0207680_10470541 3300025903 Bacteria 893
255 Ga0207647_10033480 3300025904 Bacteria 3291
256 Ga0207647_10168185 3300025904 Bacteria 1277
257 Ga0207647_10297210 3300025904 Bacteria 920
258 Ga0207645_10115482 3300025907 Bacteria 1740
259 Ga0207705_10006474 3300025909 Bacteria 8672
260 Ga0207705_10038002 3300025909 Bacteria 3446
261 Ga0207705_10046555 3300025909 Bacteria 3117
262 Ga0207705_10054279 3300025909 Bacteria 2888
263 Ga0207705_10069366 3300025909 Bacteria 2553
264 Ga0207705_10091686 3300025909 Bacteria 2226
265 Ga0207705_10188824 3300025909 Bacteria 1557
266 Ga0207705_10253962 3300025909 Bacteria 1341
267 Ga0207705_10436833 3300025909 Bacteria 1014
268 Ga0207654_10481733 3300025911 Bacteria 874
269 Ga0207707_10082846 3300025912 Bacteria 2801
270 Ga0207707_10391433 3300025912 Bacteria 1194
271 Ga0207660_10000698 3300025917 Bacteria 22444
272 Ga0207660_10005544 3300025917 Bacteria 8197
273 Ga0207660_10138100 3300025917 Bacteria 1861
274 Ga0207660_10812163 3300025917 Bacteria 763
275 Ga0207657_10001033 3300025919 Bacteria 29450
276 Ga0207657_10005050 3300025919 Bacteria 13845
277 Ga0207657_10041705 3300025919 Bacteria 4056
278 Ga0207657_10051832 3300025919 Bacteria 3565
279 Ga0207657_10090059 3300025919 Bacteria 2561
280 Ga0207657_10107006 3300025919 Bacteria 2314
281 Ga0207657_10276886 3300025919 Bacteria 1333
282 Ga0207657_10341549 3300025919 Bacteria 1182
283 Ga0207657_11040565 3300025919 Bacteria 627
284 Ga0207649_10053951 3300025920 Bacteria 2500
285 Ga0207649_10066355 3300025920 Bacteria 2287
286 Ga0207649_10082422 3300025920 Bacteria 2085
287 Ga0207649_10120318 3300025920 Bacteria 1769
288 Ga0207649_10226456 3300025920 Bacteria 1335
289 Ga0207649_10319991 3300025920 Bacteria 1139
290 Ga0207649_10863576 3300025920 Bacteria 708
291 Ga0207652_10053574 3300025921 Bacteria 3465
292 Ga0207652_10115310 3300025921 Bacteria 2386
293 Ga0207652_10269655 3300025921 Bacteria 1535
294 Ga0207652_10553801 3300025921 Bacteria 1033
295 Ga0207652_11416987 3300025921 Bacteria 598
296 Ga0207650_10112621 3300025925 Bacteria 2108
297 Ga0207650_10126133 3300025925 Bacteria 1998
298 Ga0207650_10414131 3300025925 Bacteria 1117
299 Ga0207650_10497300 3300025925 Bacteria 1019
300 Ga0207659_10077438 3300025926 Bacteria 2447
301 Ga0207659_10218392 3300025926 Bacteria 1531
302 Ga0207687_11412378 3300025927 Bacteria 598
303 Ga0207700_10027375 3300025928 Bacteria 3991
304 Ga0207700_10105050 3300025928 Bacteria 2261
305 Ga0207664_10336211 3300025929 Bacteria 1334
306 Ga0207664_10480346 3300025929 Bacteria 1111
307 Ga0207664_11025264 3300025929 Unclassified 739
308 Ga0207644_10009710 3300025931 Bacteria 6325
309 Ga0207644_10014700 3300025931 Bacteria 5245
310 Ga0207644_10107434 3300025931 Bacteria 2105
311 Ga0207644_10454339 3300025931 Bacteria 1053
312 Ga0207690_10077618 3300025932 Bacteria 2309
313 Ga0207690_10138198 3300025932 Bacteria 1792
314 Ga0207690_10600032 3300025932 Bacteria 899
315 Ga0207690_10605108 3300025932 Bacteria 895
316 Ga0207690_10654550 3300025932 Bacteria 861
317 Ga0207706_10006116 3300025933 Bacteria 11181
318 Ga0207706_10007227 3300025933 Bacteria 10269
319 Ga0207706_10010548 3300025933 Bacteria 8442
320 Ga0207706_10085405 3300025933 Bacteria 2775
321 Ga0207706_10131596 3300025933 Bacteria 2200
322 Ga0207706_10178246 3300025933 Bacteria 1867
323 Ga0207706_10285244 3300025933 Bacteria 1440
324 Ga0207706_10399902 3300025933 Bacteria 1191
325 Ga0207686_10603248 3300025934 Bacteria 864
326 Ga0207691_10016648 3300025940 Bacteria 6981
327 Ga0207691_10057864 3300025940 Bacteria 3527
328 Ga0207711_10001618 3300025941 Bacteria 20781
329 Ga0207711_10160010 3300025941 Bacteria 2037
330 Ga0207711_10791027 3300025941 Bacteria 884
331 Ga0207661_10043925 3300025944 Bacteria 3528
332 Ga0207661_10160284 3300025944 Bacteria 1951
333 Ga0207661_10412596 3300025944 Bacteria 1226
334 Ga0207679_10043464 3300025945 Bacteria 3235
335 Ga0207679_10044248 3300025945 Bacteria 3211
336 Ga0207679_10070811 3300025945 Bacteria 2628
337 Ga0207679_10122560 3300025945 Bacteria 2072
338 Ga0207679_10173017 3300025945 Bacteria 1779
339 Ga0207667_10447894 3300025949 Bacteria 1312
340 Ga0207667_10529129 3300025949 Bacteria 1194
341 Ga0207667_11101321 3300025949 Bacteria 777
342 Ga0207651_10043640 3300025960 Bacteria 2994
343 Ga0207651_10153912 3300025960 Bacteria 1794
344 Ga0207651_10378842 3300025960 Bacteria 1198
345 Ga0207712_10900154 3300025961 Bacteria 782
346 Ga0207640_10039757 3300025981 Bacteria 2980
347 Ga0207640_10195013 3300025981 Bacteria 1530
348 Ga0207640_10667376 3300025981 Bacteria 888
349 Ga0207640_11727216 3300025981 Bacteria 565
350 Ga0207658_10057412 3300025986 Bacteria 2892
351 Ga0207658_10178637 3300025986 Bacteria 1755
352 Ga0207658_10190931 3300025986 Bacteria 1702
353 Ga0207658_10579358 3300025986 Bacteria 1006
354 Ga0207658_11493975 3300025986 Bacteria 618
355 Ga0207677_10150980 3300026023 Bacteria 1792
356 Ga0207677_10476076 3300026023 Bacteria 1075
357 Ga0207703_10012169 3300026035 Bacteria 6707
358 Ga0207703_10073615 3300026035 Bacteria 2826
359 Ga0207639_10064242 3300026041 Bacteria 2845
360 Ga0207639_10417582 3300026041 Bacteria 1212
361 Ga0207639_10889638 3300026041 Bacteria 832
362 Ga0207678_10025299 3300026067 Bacteria 5182
363 Ga0207702_10118849 3300026078 Bacteria 2362
364 Ga0207702_10155963 3300026078 Bacteria 2081
365 Ga0207641_10007401 3300026088 Bacteria 9132
366 Ga0207641_10013830 3300026088 Bacteria 6619
367 Ga0207641_10013873 3300026088 Bacteria 6610
368 Ga0207641_10211826 3300026088 Bacteria 1792
369 Ga0207641_11191343 3300026088 Bacteria 761
370 Ga0207676_10003070 3300026095 Bacteria 11917
371 Ga0207676_10003305 3300026095 Bacteria 11447
372 Ga0207676_10005158 3300026095 Bacteria 9245
373 Ga0207676_10069776 3300026095 Bacteria 2815
374 Ga0207676_10988995 3300026095 Bacteria 828
375 Ga0207674_10000567 3300026116 Bacteria 48417
376 Ga0207674_10001013 3300026116 Bacteria 36709
377 Ga0207674_10004577 3300026116 Bacteria 16604
378 Ga0207674_10035277 3300026116 Bacteria 5222
379 Ga0207683_10002114 3300026121 Bacteria 17471
380 Ga0207683_10122432 3300026121 Bacteria 2336
381 Ga0207698_10004067 3300026142 Bacteria 8878
382 Ga0207698_10141608 3300026142 Bacteria 2073
383 Ga0207698_10277900 3300026142 Bacteria 1547
384 Ga0207698_10379734 3300026142 Bacteria 1344
385 Ga0207698_10642742 3300026142 Bacteria 1050
386 Ga0207698_11024658 3300026142 Bacteria 837
387 Ga0268265_10013136 3300028380 Bacteria 5625
388 Ga0268264_10020729 3300028381 Bacteria 5371
389 Ga0268264_10106701 3300028381 Bacteria 2445
390 Ga0307408_100195469 3300031548 Bacteria 1633
391 Ga0307408_101111005 3300031548 Bacteria 734
392 Ga0307405_10004362 3300031731 Bacteria 6672
393 Ga0307413_10000231 3300031824 Bacteria 16517
394 Ga0307413_10015262 3300031824 Bacteria 3931
395 Ga0307413_10991029 3300031824 Bacteria 720
396 Ga0307410_10000568 3300031852 Bacteria 15167
397 Ga0307410_10261189 3300031852 Bacteria 1350
398 Ga0307406_10528256 3300031901 Bacteria 961
399 Ga0307412_10535274 3300031911 Bacteria 981
400 Ga0307412_10596760 3300031911 Bacteria 934
401 Ga0307409_100002286 3300031995 Bacteria 9927
402 Ga0307409_100374924 3300031995 Bacteria 1350
403 Ga0307409_101223887 3300031995 Bacteria 775
404 Ga0307416_100015950 3300032002 Bacteria 5205
405 Ga0307416_101084726 3300032002 Bacteria 905
406 Ga0307416_101263689 3300032002 Bacteria 844
407 Ga0307414_10603484 3300032004 Bacteria 984
408 Ga0307411_10021290 3300032005 Bacteria 3790
409 Ga0307411_10195447 3300032005 Bacteria 1548
410 Ga0307415_100032260 3300032126 Bacteria 3385
411 Ga0307415_100191646 3300032126 Bacteria 1614
412 Ga0373951_0200301 3300035091 Bacteria 581
413 Ga0373939_0386701 3300035114 Bacteria 577
414 Ga0395899_0002666 3300037312 Bacteria 14397
415 Ga0395899_0018500 3300037312 Bacteria 5295
416 Ga0395899_0029346 3300037312 Bacteria 4137
417 Ga0395899_0046610 3300037312 Bacteria 3229
418 Ga0395899_0091058 3300037312 Bacteria 2210
419 Ga0395899_0105238 3300037312 Bacteria 2033
420 Ga0395899_0204579 3300037312 Bacteria 1374
421 Ga0395899_0280756 3300037312 Bacteria 1133
422 Ga0395899_0665687 3300037312 Bacteria 656
423 Ga0395899_0908898 3300037312 Bacteria 536
424 Ga0395900_0003945 3300037418 Bacteria 15834
425 Ga0395900_0008362 3300037418 Bacteria 10648
426 Ga0395900_0012868 3300037418 Bacteria 8548
427 Ga0395900_0015856 3300037418 Bacteria 7678
428 Ga0395900_0017274 3300037418 Bacteria 7363
429 Ga0395900_0035481 3300037418 Bacteria 5136
430 Ga0395900_0036155 3300037418 Bacteria 5089
431 Ga0395900_0055337 3300037418 Bacteria 4086
432 Ga0395900_0062987 3300037418 Bacteria 3812
433 Ga0395900_0074332 3300037418 Bacteria 3494
434 Ga0395900_0087174 3300037418 Bacteria 3208
435 Ga0395900_0206954 3300037418 Bacteria 1983
436 Ga0395900_0245425 3300037418 Bacteria 1794
437 Ga0395900_0351897 3300037418 Bacteria 1446
438 Ga0395900_0369879 3300037418 Bacteria 1403
439 Ga0395900_0694575 3300037418 Bacteria 951
440 Ga0395900_0945651 3300037418 Bacteria 783
441 Ga0395900_1020419 3300037418 Bacteria 747
442 Ga0395898_0004715 3300037466 Bacteria 14837
443 Ga0395898_0010722 3300037466 Bacteria 9572
444 Ga0395898_0018827 3300037466 Bacteria 7034
445 Ga0395898_0043538 3300037466 Bacteria 4423
446 Ga0395898_0050073 3300037466 Bacteria 4089
447 Ga0395898_0080193 3300037466 Bacteria 3148
448 Ga0395898_0133842 3300037466 Bacteria 2373
449 Ga0395898_0208028 3300037466 Bacteria 1867
450 Ga0395898_0532652 3300037466 Bacteria 1116
451 Ga0395898_1446226 3300037466 Bacteria 614
452 Ga0395905_0000806 3300037471 Bacteria 41147
453 Ga0395905_0003473 3300037471 Bacteria 16844
454 Ga0395905_0010840 3300037471 Bacteria 8829
455 Ga0395905_0016391 3300037471 Bacteria 7041
456 Ga0395905_0029031 3300037471 Bacteria 5213
457 Ga0395905_0029786 3300037471 Bacteria 5144
458 Ga0395905_0034998 3300037471 Bacteria 4714
459 Ga0395905_0054924 3300037471 Bacteria 3727
460 Ga0395905_0058167 3300037471 Bacteria 3615
461 Ga0395905_0150133 3300037471 Bacteria 2192
462 Ga0395905_0158368 3300037471 Bacteria 2129
463 Ga0395905_0191794 3300037471 Bacteria 1917
464 Ga0395905_0246300 3300037471 Bacteria 1670
465 Ga0395905_0247769 3300037471 Bacteria 1664
466 Ga0395905_0260128 3300037471 Bacteria 1620
467 Ga0395905_0316276 3300037471 Bacteria 1450
468 Ga0395905_0419274 3300037471 Bacteria 1234
469 Ga0395905_0453337 3300037471 Bacteria 1181
470 Ga0395905_0486603 3300037471 Bacteria 1133
471 Ga0395905_0584064 3300037471 Bacteria 1019
472 Ga0395905_0654182 3300037471 Bacteria 953
473 Ga0395905_0684399 3300037471 Bacteria 928
474 Ga0395905_0705831 3300037471 Bacteria 911
475 Ga0395905_0890110 3300037471 Bacteria 793
476 Ga0395905_1417311 3300037471 Bacteria 599
477 Ga0395905_1438500 3300037471 Bacteria 593
478 Ga0395905_1527105 3300037471 Bacteria 572
479 Ga0395901_0005045 3300038443 Bacteria 13333
480 Ga0395901_0007836 3300038443 Bacteria 10780
481 Ga0395901_0008595 3300038443 Bacteria 10321
482 Ga0395901_0022268 3300038443 Bacteria 6493
483 Ga0395901_0022600 3300038443 Bacteria 6447
484 Ga0395901_0026915 3300038443 Bacteria 5904
485 Ga0395901_0035731 3300038443 Bacteria 5134
486 Ga0395901_0039085 3300038443 Bacteria 4909
487 Ga0395901_0055124 3300038443 Bacteria 4133
488 Ga0395901_0070902 3300038443 Bacteria 3631
489 Ga0395901_0088607 3300038443 Bacteria 3237
490 Ga0395901_0138048 3300038443 Bacteria 2562
491 Ga0395901_0178011 3300038443 Bacteria 2230
492 Ga0395901_0271296 3300038443 Bacteria 1764
493 Ga0395901_0281856 3300038443 Bacteria 1726
494 Ga0395901_0320681 3300038443 Bacteria 1603
495 Ga0395901_0331869 3300038443 Bacteria 1572
496 Ga0395901_0416817 3300038443 Bacteria 1378
497 Ga0395901_0494167 3300038443 Bacteria 1246
498 Ga0395901_0562486 3300038443 Bacteria 1154
499 Ga0395901_0802758 3300038443 Bacteria 930
500 Ga0395901_0924039 3300038443 Bacteria 853
501 Ga0395901_1221963 3300038443 Bacteria 716
502 Ga0395901_1821715 3300038443 Bacteria 557
503 Ga0439448_0005860 3300042005 Bacteria 3514
504 Ga0439448_0261473 3300042005 Bacteria 612
505 Ga0439449_0127644 3300042007 Bacteria 945
506 Ga0439455_0001164 3300042012 Bacteria 4252
507 Ga0439458_0000058 3300042157 Bacteria 19198
508 Ga0439458_0000648 3300042157 Bacteria 8987
509 Ga0466969_0114280 3300044656 Bacteria 1261
510 Ga0466969_0146272 3300044656 Bacteria 1090
511 Ga0466966_0004450 3300044684 Bacteria 9242
512 Ga0466966_0010374 3300044684 Bacteria 6185
513 Ga0466961_0001957 3300044693 Bacteria 12837
514 Ga0466961_0024552 3300044693 Bacteria 3878
515 Ga0466963_0038861 3300044694 Bacteria 3114
516 Ga0466963_0049042 3300044694 Bacteria 2791
517 Ga0466964_0013652 3300044706 Bacteria 3082
518 Ga0466964_0015373 3300044706 Bacteria 2912
519 Ga0466971_0003475 3300044719 Bacteria 6729
520 Ga0466970_0010465 3300044765 Bacteria 4709
521 Ga0466957_0010510 3300044842 Bacteria 5319
522 Ga0466957_0047568 3300044842 Bacteria 2606
523 Ga0466957_0116087 3300044842 Bacteria 1703
524 Ga0466957_0185783 3300044842 Bacteria 1359
525 Ga0466959_0021962 3300045049 Bacteria 4713
526 Ga0466959_0476964 3300045049 Bacteria 844
527 Ga0466958_0000709 3300045836 Bacteria 14546
528 Ga0466958_0103127 3300045836 Bacteria 1776
529 Ga0466958_0181225 3300045836 Bacteria 1336
530 Ga0466958_0507679 3300045836 Bacteria 782
531 Ga0466967_0002207 3300045976 Bacteria 11970
532 Ga0466967_0040812 3300045976 Bacteria 3997
533 Ga0466967_0044577 3300045976 Bacteria 3848
534 Ga0466967_0046491 3300045976 Bacteria 3779
535 Ga0466967_0105840 3300045976 Bacteria 2577
536 Ga0466967_0194067 3300045976 Bacteria 1920
537 Ga0466967_0262535 3300045976 Bacteria 1652
538 Ga0466967_0325164 3300045976 Bacteria 1484
539 Ga0466967_0443909 3300045976 Bacteria 1267
540 Ga0466967_0917768 3300045976 Bacteria 871
541 Ga0466967_0985288 3300045976 Bacteria 839
542 Ga0466967_1206499 3300045976 Bacteria 754
543 Ga0495629_0200542 3300046459 Bacteria 1380
544 Ga0495663_0015982 3300046525 Bacteria 2120
545 Ga0495621_0361372 3300046539 Bacteria 611
546 Ga0495647_0187692 3300046681 Bacteria 902
547 Ga0495669_0032486 3300046684 Bacteria 2294
548 Ga0495669_0333563 3300046684 Bacteria 732
549 Ga0495677_0003406 3300047445 Bacteria 6179
550 Ga0496100_0046186 3300048903 Bacteria 2799
551 Ga0496101_0052164 3300048904 Bacteria 2949
552 Ga0496101_0086998 3300048904 Bacteria 2319
553 Ga0496102_0032011 3300048905 Bacteria 4722
554 Ga0496103_0006858 3300048906 Bacteria 6800
555 Ga0496104_0181476 3300048907 Bacteria 2015
556 Ga0496106_0110735 3300048909 Bacteria 2137
557 Ga0496106_0121689 3300048909 Bacteria 2040
558 Ga0496106_0159579 3300048909 Bacteria 1783
559 Ga0496107_0130823 3300048910 Bacteria 1853
560 Ga0496108_0020382 3300048911 Bacteria 5450
561 Ga0496108_0024311 3300048911 Bacteria 4986
562 Ga0496108_0718939 3300048911 Bacteria 865
563 Ga0496109_0019383 3300048912 Bacteria 5998
564 Ga0496109_0097749 3300048912 Bacteria 2721
565 Ga0496109_0102088 3300048912 Bacteria 2662
566 Ga0496109_0105245 3300048912 Bacteria 2620
567 Ga0496110_0015487 3300048913 Bacteria 6347
568 Ga0496110_0082937 3300048913 Bacteria 2859
569 Ga0496110_0382018 3300048913 Bacteria 1283
570 Ga0496110_0433537 3300048913 Bacteria 1198
571 Ga0496111_0001326 3300048914 Bacteria 13920
572 Ga0496111_0007818 3300048914 Bacteria 7041
573 Ga0496111_0008538 3300048914 Bacteria 6786
574 Ga0496112_0000738 3300048915 Bacteria 22790
575 Ga0496112_0037443 3300048915 Bacteria 4735
576 Ga0496112_0060509 3300048915 Bacteria 3732
577 Ga0496112_0104159 3300048915 Bacteria 2808
578 Ga0496113_0005687 3300048916 Bacteria 7807
579 Ga0496113_0013718 3300048916 Bacteria 5503
580 Ga0496113_0071689 3300048916 Bacteria 2635
581 Ga0501067_0021612 3300049583 Bacteria 3561
582 Ga0501069_0082884 3300049585 Bacteria 1808
583 Ga0501070_0146064 3300049586 Bacteria 1952
584 Ga0501073_0179852 3300049589 Bacteria 1464
585 Ga0501202_003386 3300049652 Bacteria 2729
586 Ga0501216_012664 3300049660 Bacteria 1388
587 Ga0501217_009326 3300049661 Bacteria 2133
588 Ga0501223_013012 3300049663 Bacteria 1659
589 Ga0501224_046801 3300049664 Bacteria 659
590 Ga0501247_006026 3300049677 Bacteria 1364
591 Ga0501253_030049 3300049683 Bacteria 1030
592 Ga0501225_0035655 3300049705 Bacteria 1370
593 Ga0501268_003834 3300049765 Bacteria 2084
594 Ga0501270_017311 3300049767 Bacteria 1053
595 Ga0501283_005380 3300049779 Bacteria 1759
596 nmdc:mga0k408_265349_c1 3300050493 Bacteria 1025
597 Ga0466962_0003308 3300061719 Bacteria 7662
598 Ga0466962_0058580 3300061719 Bacteria 1838
599 Ga0466962_0064580 3300061719 Bacteria 1748
600 Ga0466962_0113608 3300061719 Bacteria 1304
601 JGI24741J21665_1008775
602 JGI24752J21851_1007792
603 JGI24740J21852_10054256
604 JGI24740J21852_10152503
605 JGI24740J21852_10153683
606 JGI24737J22298_10004423
607 JGI24737J22298_10016740
608 JGI24737J22298_10033648
609 JGI24737J22298_10041436
610 JGI24735J21928_10012868
611 JGI24735J21928_10023753
612 JGI24751J29686_10048114
613 Ga0070658_10004769
614 Ga0070658_10707497
615 Ga0070658_10732777
616 Ga0070658_11073292
617 Ga0070676_10040887
618 Ga0070676_10094326
619 Ga0070683_100088552
620 Ga0070683_100173081
621 Ga0070690_100411167
622 Ga0070690_100453151
623 Ga0070670_100002627
624 Ga0070670_100012376
625 Ga0070670_100142006
626 Ga0070670_100270536
627 Ga0070677_10069843
628 Ga0070677_10210544
629 Ga0068869_101515347
630 Ga0070666_10003780
631 Ga0070666_10010427
632 Ga0070680_100011194
633 Ga0070680_100032624
634 Ga0070680_100061251
635 Ga0070680_100358448
636 Ga0068868_100029891
637 Ga0068868_100364192
638 Ga0070660_100038122
639 Ga0070660_100072584
640 Ga0070660_100087503
641 Ga0070660_100140344
642 Ga0070660_100274085
643 Ga0070660_100590529
644 Ga0070660_100675477
645 Ga0070689_100223692
646 Ga0070687_100139177
647 Ga0070661_100009782
648 Ga0070661_100016888
649 Ga0070661_100139620
650 Ga0070661_100145700
651 Ga0070661_100146956
652 Ga0070661_100252434
653 Ga0070661_100288950
654 Ga0070661_100314053
655 Ga0070661_100406225
656 Ga0070661_100450870
657 Ga0070661_101381511
658 Ga0070692_10177342
659 Ga0070692_10659127
660 Ga0070675_100211770
661 Ga0070675_101247310
662 Ga0070671_100021209
663 Ga0070671_100183561
664 Ga0070671_100228915
665 Ga0070671_100449947
666 Ga0070674_100097243
667 Ga0070673_100005516
668 Ga0070673_100053655
669 Ga0070673_100370030
670 Ga0070673_100406950
671 Ga0070659_100054364
672 Ga0070659_100241689
673 Ga0070659_100585623
674 Ga0070659_100683581
675 Ga0070667_100007652
676 Ga0070667_100017936
677 Ga0070667_100446329
678 Ga0070667_100579610
679 Ga0070667_101897533
680 Ga0070714_100023919
681 Ga0070714_100025168
682 Ga0070714_100045059
683 Ga0070713_100009927
684 Ga0070701_10323728
685 Ga0070663_100025864
686 Ga0070663_100176941
687 Ga0070663_100339238
688 Ga0070663_100984075
689 Ga0070678_100004461
690 Ga0070678_100079545
691 Ga0070662_100000866
692 Ga0070662_100015772
693 Ga0070662_100073072
694 Ga0070662_100078928
695 Ga0070662_100117206
696 Ga0070662_100266832
697 Ga0070662_100615064
698 Ga0070662_101149616
699 Ga0070662_101545174
700 Ga0070681_10086675
701 Ga0070681_10713807
702 Ga0070681_10907402
703 Ga0068867_100082618
704 Ga0070685_10147321
705 Ga0070679_100022042
706 Ga0070679_100108240
707 Ga0070679_100145218
708 Ga0070679_100427397
709 Ga0070679_100616314
710 Ga0070679_100976832
711 Ga0070684_101383819
712 Ga0068853_100047412
713 Ga0068853_100393097
714 Ga0068853_100460072
715 Ga0068853_100641326
716 Ga0068853_100711251
717 Ga0068853_102175356
718 Ga0070672_100004370
719 Ga0070672_100465297
720 Ga0070686_100546213
721 Ga0070695_100952673
722 Ga0070693_100665723
723 Ga0070665_100047968
724 Ga0070665_100715064
725 Ga0068855_100111436
726 Ga0068855_100401184
727 Ga0070664_100003352
728 Ga0070664_100012903
729 Ga0070664_100035952
730 Ga0070664_100086103
731 Ga0070664_100089714
732 Ga0070664_100547593
733 Ga0068857_100000325
734 Ga0068857_100008239
735 Ga0068857_100023606
736 Ga0068857_100067419
737 Ga0068854_100166108
738 Ga0068854_100177936
739 Ga0068854_100544313
740 Ga0068856_100180259
741 Ga0068856_100235656
742 Ga0068856_100279615
743 Ga0068856_101210671
744 Ga0068856_101976803
745 Ga0070702_100279385
746 Ga0068852_100003856
747 Ga0068852_100063800
748 Ga0068852_100146549
749 Ga0068852_100314819
750 Ga0068852_101031994
751 Ga0068859_100009553
752 Ga0068859_100072677
753 Ga0068864_100004140
754 Ga0068864_100020609
755 Ga0068864_100060921
756 Ga0068864_101211781
757 Ga0068861_101725639
758 Ga0068861_102109652
759 Ga0068851_10079041
760 Ga0068851_10079141
761 Ga0068863_100005936
762 Ga0068863_100006661
763 Ga0068863_100020798
764 Ga0068863_100023227
765 Ga0068863_101303886
766 Ga0068863_102139384
767 Ga0068858_100003340
768 Ga0068858_100003679
769 Ga0068858_100023693
770 Ga0068860_100009867
771 Ga0068860_100089601
772 Ga0068860_100452568
773 Ga0068862_100010153
774 Ga0068862_100164289
775 Ga0081539_10098674
776 Ga0070717_10002077
777 Ga0070716_100298750
778 Ga0097621_100003188
779 Ga0068871_100032309
780 Ga0068871_100038312
781 Ga0068865_100845107
782 Ga0097620_100009553
783 Ga0097620_100072676
784 Ga0105251_10023594
785 Ga0105245_11186064
786 Ga0105247_10134492
787 Ga0105243_12993058
788 Ga0105241_10216474
789 Ga0105242_10134224
790 Ga0105242_10377229
791 Ga0105248_10003888
792 Ga0105248_10004674
793 Ga0105248_11120632
794 Ga0105237_10072981
795 Ga0105238_10294424
796 Ga0105249_10011978
797 Ga0105249_10819636
798 Ga0105239_12181076
799 Ga0105246_10057416
800 Ga0105246_10095415
801 Ga0105246_10157233
802 Ga0157373_10028381
803 Ga0157373_10041410
804 Ga0157373_10048778
805 Ga0157373_10054747
806 Ga0157373_10117482
807 Ga0157373_10197757
808 Ga0157373_10289971
809 Ga0157371_10033953
810 Ga0157371_10042456
811 Ga0157371_10056524
812 Ga0157371_10125525
813 Ga0157371_10162919
814 Ga0157371_10852361
815 Ga0157371_11302404
816 Ga0157370_10122089
817 Ga0157370_10441629
818 Ga0157370_10526892
819 Ga0157369_10024494
820 Ga0157369_10060288
821 Ga0157369_10144172
822 Ga0157369_10327270
823 Ga0157369_10644014
824 Ga0157369_11728168
825 Ga0157374_10005377
826 Ga0157374_10147413
827 Ga0157374_10516494
828 Ga0157378_10395148
829 Ga0157378_11074138
830 Ga0163162_10660132
831 Ga0163162_11745950
832 Ga0157372_10233079
833 Ga0157372_10281738
834 Ga0157372_11435029
835 Ga0157375_10015225
836 Ga0157375_11390835
837 Ga0163163_10003320
838 Ga0163163_10005065
839 Ga0163163_10031079
840 Ga0163163_10177361
841 Ga0163163_11180438
842 Ga0182008_10641031
843 Ga0157377_10064773
844 Ga0157379_10020582
845 Ga0157379_10490137
846 Ga0157376_11696928
847 Ga0163161_10156513
848 Ga0206356_10595307
849 Ga0206353_11024971
850 Ga0207697_10004795
851 Ga0207697_10269455
852 Ga0207713_1242696
853 Ga0207682_10087951
854 Ga0207680_10470541
855 Ga0207647_10033480
856 Ga0207647_10168185
857 Ga0207647_10297210
858 Ga0207645_10115482
859 Ga0207705_10006474
860 Ga0207705_10038002
861 Ga0207705_10046555
862 Ga0207705_10054279
863 Ga0207705_10069366
864 Ga0207705_10091686
865 Ga0207705_10188824
866 Ga0207705_10253962
867 Ga0207705_10436833
868 Ga0207654_10481733
869 Ga0207707_10082846
870 Ga0207707_10391433
871 Ga0207660_10000698
872 Ga0207660_10005544
873 Ga0207660_10138100
874 Ga0207660_10812163
875 Ga0207657_10001033
876 Ga0207657_10005050
877 Ga0207657_10041705
878 Ga0207657_10051832
879 Ga0207657_10090059
880 Ga0207657_10107006
881 Ga0207657_10276886
882 Ga0207657_10341549
883 Ga0207657_11040565
884 Ga0207649_10053951
885 Ga0207649_10066355
886 Ga0207649_10082422
887 Ga0207649_10120318
888 Ga0207649_10226456
889 Ga0207649_10319991
890 Ga0207649_10863576
891 Ga0207652_10053574
892 Ga0207652_10115310
893 Ga0207652_10269655
894 Ga0207652_10553801
895 Ga0207652_11416987
896 Ga0207650_10112621
897 Ga0207650_10126133
898 Ga0207650_10414131
899 Ga0207650_10497300
900 Ga0207659_10077438
901 Ga0207659_10218392
902 Ga0207687_11412378
903 Ga0207700_10027375
904 Ga0207700_10105050
905 Ga0207664_10336211
906 Ga0207664_10480346
907 Ga0207664_11025264
908 Ga0207644_10009710
909 Ga0207644_10014700
910 Ga0207644_10107434
911 Ga0207644_10454339
912 Ga0207690_10077618
913 Ga0207690_10138198
914 Ga0207690_10600032
915 Ga0207690_10605108
916 Ga0207690_10654550
917 Ga0207706_10006116
918 Ga0207706_10007227
919 Ga0207706_10010548
920 Ga0207706_10085405
921 Ga0207706_10131596
922 Ga0207706_10178246
923 Ga0207706_10285244
924 Ga0207706_10399902
925 Ga0207686_10603248
926 Ga0207691_10016648
927 Ga0207691_10057864
928 Ga0207711_10001618
929 Ga0207711_10160010
930 Ga0207711_10791027
931 Ga0207661_10043925
932 Ga0207661_10160284
933 Ga0207661_10412596
934 Ga0207679_10043464
935 Ga0207679_10044248
936 Ga0207679_10070811
937 Ga0207679_10122560
938 Ga0207679_10173017
939 Ga0207667_10447894
940 Ga0207667_10529129
941 Ga0207667_11101321
942 Ga0207651_10043640
943 Ga0207651_10153912
944 Ga0207651_10378842
945 Ga0207712_10900154
946 Ga0207640_10039757
947 Ga0207640_10195013
948 Ga0207640_10667376
949 Ga0207640_11727216
950 Ga0207658_10057412
951 Ga0207658_10178637
952 Ga0207658_10190931
953 Ga0207658_10579358
954 Ga0207658_11493975
955 Ga0207677_10150980
956 Ga0207677_10476076
957 Ga0207703_10012169
958 Ga0207703_10073615
959 Ga0207639_10064242
960 Ga0207639_10417582
961 Ga0207639_10889638
962 Ga0207678_10025299
963 Ga0207702_10118849
964 Ga0207702_10155963
965 Ga0207641_10007401
966 Ga0207641_10013830
967 Ga0207641_10013873
968 Ga0207641_10211826
969 Ga0207641_11191343
970 Ga0207676_10003070
971 Ga0207676_10003305
972 Ga0207676_10005158
973 Ga0207676_10069776
974 Ga0207676_10988995
975 Ga0207674_10000567
976 Ga0207674_10001013
977 Ga0207674_10004577
978 Ga0207674_10035277
979 Ga0207683_10002114
980 Ga0207683_10122432
981 Ga0207698_10004067
982 Ga0207698_10141608
983 Ga0207698_10277900
984 Ga0207698_10379734
985 Ga0207698_10642742
986 Ga0207698_11024658
987 Ga0268265_10013136
988 Ga0268264_10020729
989 Ga0268264_10106701
990 Ga0307408_100195469
991 Ga0307408_101111005
992 Ga0307405_10004362
993 Ga0307413_10000231
994 Ga0307413_10015262
995 Ga0307413_10991029
996 Ga0307410_10000568
997 Ga0307410_10261189
998 Ga0307406_10528256
999 Ga0307412_10535274
1000 Ga0307412_10596760
1001 Ga0307409_100002286
1002 Ga0307409_100374924
1003 Ga0307409_101223887
1004 Ga0307416_100015950
1005 Ga0307416_101084726
1006 Ga0307416_101263689
1007 Ga0307414_10603484
1008 Ga0307411_10021290
1009 Ga0307411_10195447
1010 Ga0307415_100032260
1011 Ga0307415_100191646
1012 Ga0373951_0200301
1013 Ga0373939_0386701
1014 Ga0395899_0002666
1015 Ga0395899_0018500
1016 Ga0395899_0029346
1017 Ga0395899_0046610
1018 Ga0395899_0091058
1019 Ga0395899_0105238
1020 Ga0395899_0204579
1021 Ga0395899_0280756
1022 Ga0395899_0665687
1023 Ga0395899_0908898
1024 Ga0395900_0003945
1025 Ga0395900_0008362
1026 Ga0395900_0012868
1027 Ga0395900_0015856
1028 Ga0395900_0017274
1029 Ga0395900_0035481
1030 Ga0395900_0036155
1031 Ga0395900_0055337
1032 Ga0395900_0062987
1033 Ga0395900_0074332
1034 Ga0395900_0087174
1035 Ga0395900_0206954
1036 Ga0395900_0245425
1037 Ga0395900_0351897
1038 Ga0395900_0369879
1039 Ga0395900_0694575
1040 Ga0395900_0945651
1041 Ga0395900_1020419
1042 Ga0395898_0004715
1043 Ga0395898_0010722
1044 Ga0395898_0018827
1045 Ga0395898_0043538
1046 Ga0395898_0050073
1047 Ga0395898_0080193
1048 Ga0395898_0133842
1049 Ga0395898_0208028
1050 Ga0395898_0532652
1051 Ga0395898_1446226
1052 Ga0395905_0000806
1053 Ga0395905_0003473
1054 Ga0395905_0010840
1055 Ga0395905_0016391
1056 Ga0395905_0029031
1057 Ga0395905_0029786
1058 Ga0395905_0034998
1059 Ga0395905_0054924
1060 Ga0395905_0058167
1061 Ga0395905_0150133
1062 Ga0395905_0158368
1063 Ga0395905_0191794
1064 Ga0395905_0246300
1065 Ga0395905_0247769
1066 Ga0395905_0260128
1067 Ga0395905_0316276
1068 Ga0395905_0419274
1069 Ga0395905_0453337
1070 Ga0395905_0486603
1071 Ga0395905_0584064
1072 Ga0395905_0654182
1073 Ga0395905_0684399
1074 Ga0395905_0705831
1075 Ga0395905_0890110
1076 Ga0395905_1417311
1077 Ga0395905_1438500
1078 Ga0395905_1527105
1079 Ga0395901_0005045
1080 Ga0395901_0007836
1081 Ga0395901_0008595
1082 Ga0395901_0022268
1083 Ga0395901_0022600
1084 Ga0395901_0026915
1085 Ga0395901_0035731
1086 Ga0395901_0039085
1087 Ga0395901_0055124
1088 Ga0395901_0070902
1089 Ga0395901_0088607
1090 Ga0395901_0138048
1091 Ga0395901_0178011
1092 Ga0395901_0271296
1093 Ga0395901_0281856
1094 Ga0395901_0320681
1095 Ga0395901_0331869
1096 Ga0395901_0416817
1097 Ga0395901_0494167
1098 Ga0395901_0562486
1099 Ga0395901_0802758
1100 Ga0395901_0924039
1101 Ga0395901_1221963
1102 Ga0395901_1821715
1103 Ga0439448_0005860
1104 Ga0439448_0261473
1105 Ga0439449_0127644
1106 Ga0439455_0001164
1107 Ga0439458_0000058
1108 Ga0439458_0000648
1109 Ga0466969_0114280
1110 Ga0466969_0146272
1111 Ga0466966_0004450
1112 Ga0466966_0010374
1113 Ga0466961_0001957
1114 Ga0466961_0024552
1115 Ga0466963_0038861
1116 Ga0466963_0049042
1117 Ga0466964_0013652
1118 Ga0466964_0015373
1119 Ga0466971_0003475
1120 Ga0466970_0010465
1121 Ga0466957_0010510
1122 Ga0466957_0047568
1123 Ga0466957_0116087
1124 Ga0466957_0185783
1125 Ga0466959_0021962
1126 Ga0466959_0476964
1127 Ga0466958_0000709
1128 Ga0466958_0103127
1129 Ga0466958_0181225
1130 Ga0466958_0507679
1131 Ga0466967_0002207
1132 Ga0466967_0040812
1133 Ga0466967_0044577
1134 Ga0466967_0046491
1135 Ga0466967_0105840
1136 Ga0466967_0194067
1137 Ga0466967_0262535
1138 Ga0466967_0325164
1139 Ga0466967_0443909
1140 Ga0466967_0917768
1141 Ga0466967_0985288
1142 Ga0466967_1206499
1143 Ga0495629_0200542
1144 Ga0495663_0015982
1145 Ga0495621_0361372
1146 Ga0495647_0187692
1147 Ga0495669_0032486
1148 Ga0495669_0333563
1149 Ga0495677_0003406
1150 Ga0496100_0046186
1151 Ga0496101_0052164
1152 Ga0496101_0086998
1153 Ga0496102_0032011
1154 Ga0496103_0006858
1155 Ga0496104_0181476
1156 Ga0496106_0110735
1157 Ga0496106_0121689
1158 Ga0496106_0159579
1159 Ga0496107_0130823
1160 Ga0496108_0020382
1161 Ga0496108_0024311
1162 Ga0496108_0718939
1163 Ga0496109_0019383
1164 Ga0496109_0097749
1165 Ga0496109_0102088
1166 Ga0496109_0105245
1167 Ga0496110_0015487
1168 Ga0496110_0082937
1169 Ga0496110_0382018
1170 Ga0496110_0433537
1171 Ga0496111_0001326
1172 Ga0496111_0007818
1173 Ga0496111_0008538
1174 Ga0496112_0000738
1175 Ga0496112_0037443
1176 Ga0496112_0060509
1177 Ga0496112_0104159
1178 Ga0496113_0005687
1179 Ga0496113_0013718
1180 Ga0496113_0071689
1181 Ga0501067_0021612
1182 Ga0501069_0082884
1183 Ga0501070_0146064
1184 Ga0501073_0179852
1185 Ga0501202_003386
1186 Ga0501216_012664
1187 Ga0501217_009326
1188 Ga0501223_013012
1189 Ga0501224_046801
1190 Ga0501247_006026
1191 Ga0501253_030049
1192 Ga0501225_0035655
1193 Ga0501268_003834
1194 Ga0501270_017311
1195 Ga0501283_005380
1196 nmdc:mga0k408_265349_c1
1197 Ga0466962_0003308
1198 Ga0466962_0058580
1199 Ga0466962_0064580
1200 Ga0466962_0113608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06676

DUF1178

Protein of unknown function (DUF1178)

1

64

0.94

PF06676

DUF1178

Protein of unknown function (DUF1178)

55

127

0.93

Map