F467916

General Info

Members Datasets Scaffolds Average Seq Length
599 326 1198 193

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0255238|Ga0496112_0255238_931_1539
Length 202
Sequence LKSAGSFCYTGRPNGYASGPNVRLLFGTVLALTIAAMAGLGATWMALTRGSAYGGVTIGAWTGWPKNGTSGIDPYARAMVARTGELPVGSGDGVAFYGRCDVLLSGTTPQARFWTLTLYDPEGRLVANSTQRQGFTSQEIVRNADGTFDIMVGPRARPGNWLPTGGADKYVLVLRLYDTPIGMASRTGSEAPMPSVTKRACL

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
92 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
170 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
171 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
172 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
176 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
199 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
200 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
217 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
229 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
230 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
231 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
241 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
248 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
249 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
250 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
265 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
270 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
271 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
272 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
273 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
274 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
275 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
276 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
277 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
298 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
299 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
300 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
301 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
302 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
305 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 9.85
Rhizosphere 86.98
Stem 0
Stem Tuber 0
Unclassified 7.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_0255238 3300048915 Bacteria 1704
2 JGI24746J21847_1009384 3300001977 Bacteria 1461
3 JGI24747J21853_1024653 3300001978 Bacteria 668
4 JGI24744J21845_10013903 3300002077 Unclassified 1621
5 JGI24034J26672_10004896 3300002239 Bacteria 1907
6 JGI24742J22300_10002110 3300002244 Bacteria 3164
7 Ga0070658_10110778 3300005327 Bacteria 2274
8 Ga0070676_10043785 3300005328 Bacteria 2602
9 Ga0070690_100066795 3300005330 Bacteria 2328
10 Ga0070690_100089087 3300005330 Bacteria 2029
11 Ga0070670_100003320 3300005331 Bacteria 13313
12 Ga0070670_100424345 3300005331 Bacteria 1176
13 Ga0070677_10043250 3300005333 Bacteria 1788
14 Ga0070666_10037885 3300005335 Bacteria 3207
15 Ga0070682_100197877 3300005337 Bacteria 1416
16 Ga0068868_100067478 3300005338 Bacteria 2847
17 Ga0070660_100050021 3300005339 Bacteria 3215
18 Ga0070689_100002615 3300005340 Bacteria 11794
19 Ga0070689_100184595 3300005340 Bacteria 1696
20 Ga0070689_100348925 3300005340 Bacteria 1241
21 Ga0070691_10139132 3300005341 Bacteria 1236
22 Ga0070687_100010268 3300005343 Bacteria 4043
23 Ga0070687_100025652 3300005343 Bacteria 2830
24 Ga0070661_100014636 3300005344 Bacteria 5530
25 Ga0070692_10012657 3300005345 Bacteria 3914
26 Ga0070668_100020744 3300005347 Bacteria 4962
27 Ga0070669_100784777 3300005353 Bacteria 809
28 Ga0070669_100809077 3300005353 Bacteria 797
29 Ga0070675_100287379 3300005354 Bacteria 1447
30 Ga0070675_101137868 3300005354 Unclassified 718
31 Ga0070671_100004085 3300005355 Bacteria 11520
32 Ga0070673_100180513 3300005364 Bacteria 1807
33 Ga0070688_100117556 3300005365 Bacteria 1776
34 Ga0070659_100049191 3300005366 Bacteria 3314
35 Ga0070667_100739231 3300005367 Bacteria 911
36 Ga0070703_10011669 3300005406 Bacteria 2485
37 Ga0070709_10178477 3300005434 Bacteria 1489
38 Ga0070714_100040717 3300005435 Bacteria 3917
39 Ga0070714_100098844 3300005435 Bacteria 2568
40 Ga0070713_100065968 3300005436 Bacteria 3043
41 Ga0070713_100089268 3300005436 Bacteria 2647
42 Ga0070713_100125990 3300005436 Bacteria 2253
43 Ga0070713_100493092 3300005436 Unclassified 1155
44 Ga0070710_10022554 3300005437 Bacteria 3294
45 Ga0070710_10272073 3300005437 Bacteria 1096
46 Ga0070701_10018697 3300005438 Bacteria 3260
47 Ga0070711_100010990 3300005439 Bacteria 5612
48 Ga0070711_100069018 3300005439 Bacteria 2486
49 Ga0070711_100407415 3300005439 Bacteria 1105
50 Ga0070711_100422097 3300005439 Bacteria 1087
51 Ga0070705_100265342 3300005440 Bacteria 1213
52 Ga0070705_100354531 3300005440 Bacteria 1071
53 Ga0070705_100603823 3300005440 Bacteria 849
54 Ga0070700_100043890 3300005441 Bacteria 2751
55 Ga0070694_100144822 3300005444 Bacteria 1729
56 Ga0070678_100255377 3300005456 Bacteria 1471
57 Ga0070678_100604368 3300005456 Bacteria 979
58 Ga0070662_100082291 3300005457 Bacteria 2400
59 Ga0070681_10532657 3300005458 Bacteria 1088
60 Ga0068867_100046225 3300005459 Bacteria 3196
61 Ga0070685_10070557 3300005466 Bacteria 2069
62 Ga0070699_100028449 3300005518 Bacteria 4820
63 Ga0070679_100775750 3300005530 Bacteria 902
64 Ga0070684_100203055 3300005535 Bacteria 1806
65 Ga0070697_100419374 3300005536 Bacteria 1163
66 Ga0070697_100954748 3300005536 Bacteria 761
67 Ga0068853_100019266 3300005539 Bacteria 5656
68 Ga0070672_100587004 3300005543 Bacteria 970
69 Ga0070686_100091386 3300005544 Bacteria 2036
70 Ga0070696_100162828 3300005546 Bacteria 1645
71 Ga0070696_100208613 3300005546 Bacteria 1462
72 Ga0070704_100686643 3300005549 Bacteria 907
73 Ga0070664_100100332 3300005564 Bacteria 2517
74 Ga0070664_100166804 3300005564 Bacteria 1951
75 Ga0068857_100076467 3300005577 Bacteria 2986
76 Ga0068856_100377880 3300005614 Bacteria 1436
77 Ga0070702_100131722 3300005615 Bacteria 1580
78 Ga0070702_100155698 3300005615 Bacteria 1472
79 Ga0068852_100194377 3300005616 Bacteria 1916
80 Ga0068859_100014185 3300005617 Bacteria 7991
81 Ga0068864_100021408 3300005618 Bacteria 5417
82 Ga0068864_100871159 3300005618 Unclassified 888
83 Ga0068866_10012258 3300005718 Bacteria 3733
84 Ga0068861_100022917 3300005719 Bacteria 4502
85 Ga0068851_10456093 3300005834 Bacteria 760
86 Ga0068870_10014844 3300005840 Bacteria 3686
87 Ga0068858_100078609 3300005842 Bacteria 3065
88 Ga0068858_100145773 3300005842 Bacteria 2223
89 Ga0068860_100285093 3300005843 Bacteria 1615
90 Ga0068860_100405344 3300005843 Unclassified 1349
91 Ga0068862_100298083 3300005844 Bacteria 1482
92 Ga0081455_10000577 3300005937 Bacteria 47777
93 Ga0081455_10001167 3300005937 Bacteria 32856
94 Ga0081455_10021228 3300005937 Bacteria 6096
95 Ga0081455_10034625 3300005937 Bacteria 4523
96 Ga0081455_10043051 3300005937 Bacteria 3955
97 Ga0081455_10086526 3300005937 Bacteria 2553
98 Ga0081455_10105338 3300005937 Bacteria 2254
99 Ga0081538_10021356 3300005981 Bacteria 4728
100 Ga0081538_10052272 3300005981 Bacteria 2443
101 Ga0081540_1000310 3300005983 Bacteria 50366
102 Ga0081540_1001623 3300005983 Bacteria 19162
103 Ga0081540_1049609 3300005983 Bacteria 2093
104 Ga0081540_1123526 3300005983 Bacteria 1069
105 Ga0081539_10114366 3300005985 Bacteria 1352
106 Ga0070717_10041471 3300006028 Bacteria 3752
107 Ga0070717_10056544 3300006028 Bacteria 3242
108 Ga0070717_10166751 3300006028 Bacteria 1913
109 Ga0070717_10363572 3300006028 Bacteria 1296
110 Ga0075365_10011389 3300006038 Bacteria 5228
111 Ga0075365_10237416 3300006038 Bacteria 1280
112 Ga0075432_10118912 3300006058 Unclassified 991
113 Ga0070715_10000883 3300006163 Bacteria 8309
114 Ga0070715_10022770 3300006163 Bacteria 2446
115 Ga0070715_10230369 3300006163 Bacteria 958
116 Ga0070716_100005227 3300006173 Bacteria 6273
117 Ga0070716_100167621 3300006173 Bacteria 1430
118 Ga0070716_100431217 3300006173 Unclassified 956
119 Ga0070712_100000278 3300006175 Bacteria 28790
120 Ga0070712_100402100 3300006175 Bacteria 1131
121 Ga0075362_10166991 3300006177 Bacteria 1062
122 Ga0075367_10057304 3300006178 Bacteria 2317
123 Ga0097621_100117015 3300006237 Bacteria 2258
124 Ga0075370_10169353 3300006353 Bacteria 1284
125 Ga0068871_100043160 3300006358 Bacteria 3622
126 Ga0075428_100045964 3300006844 Bacteria 4796
127 Ga0075428_100061894 3300006844 Bacteria 4099
128 Ga0075428_100090478 3300006844 Bacteria 3338
129 Ga0075428_100120569 3300006844 Bacteria 2855
130 Ga0075428_100368358 3300006844 Bacteria 1541
131 Ga0075428_100489731 3300006844 Bacteria 1316
132 Ga0075430_100000484 3300006846 Bacteria 29785
133 Ga0075430_100022906 3300006846 Bacteria 5312
134 Ga0075430_100166675 3300006846 Bacteria 1833
135 Ga0075430_100267069 3300006846 Bacteria 1417
136 Ga0075430_100768670 3300006846 Bacteria 794
137 Ga0075431_100039684 3300006847 Bacteria 4851
138 Ga0075431_100039830 3300006847 Bacteria 4841
139 Ga0075431_100200008 3300006847 Bacteria 2044
140 Ga0075431_100320284 3300006847 Bacteria 1564
141 Ga0075431_100323095 3300006847 Bacteria 1556
142 Ga0075431_100334562 3300006847 Bacteria 1525
143 Ga0075431_100769483 3300006847 Bacteria 937
144 Ga0075431_101221700 3300006847 Bacteria 714
145 Ga0075433_10866087 3300006852 Bacteria 788
146 Ga0075434_100014205 3300006871 Bacteria 7607
147 Ga0075434_100046340 3300006871 Bacteria 4314
148 Ga0075434_100074476 3300006871 Bacteria 3388
149 Ga0075434_100160155 3300006871 Bacteria 2270
150 Ga0075434_100398723 3300006871 Bacteria 1397
151 Ga0075434_100487505 3300006871 Bacteria 1253
152 Ga0075429_100213192 3300006880 Bacteria 1692
153 Ga0075429_100425502 3300006880 Bacteria 1163
154 Ga0075436_100238495 3300006914 Bacteria 1293
155 Ga0097620_100014184 3300006931 Bacteria 7991
156 Ga0075435_100013264 3300007076 Bacteria 6122
157 Ga0075435_100074726 3300007076 Bacteria 2773
158 Ga0075435_100339508 3300007076 Bacteria 1287
159 Ga0099795_10000273 3300007788 Bacteria 9215
160 Ga0099795_10016326 3300007788 Bacteria 2347
161 Ga0105251_10075198 3300009011 Unclassified 1568
162 Ga0105244_10093411 3300009036 Unclassified 1478
163 Ga0111539_10035223 3300009094 Bacteria 6063
164 Ga0111539_10113911 3300009094 Bacteria 3171
165 Ga0111539_10305394 3300009094 Bacteria 1852
166 Ga0105245_10026643 3300009098 Bacteria 5089
167 Ga0105245_10123350 3300009098 Bacteria 2423
168 Ga0105247_10039865 3300009101 Bacteria 2870
169 Ga0105247_10171102 3300009101 Bacteria 1444
170 Ga0114129_10003967 3300009147 Bacteria 20897
171 Ga0114129_10006691 3300009147 Bacteria 16368
172 Ga0114129_10043219 3300009147 Bacteria 6340
173 Ga0114129_10077703 3300009147 Bacteria 4617
174 Ga0114129_10081800 3300009147 Bacteria 4489
175 Ga0114129_10249513 3300009147 Bacteria 2383
176 Ga0114129_11168331 3300009147 Bacteria 960
177 Ga0114129_11551093 3300009147 Bacteria 812
178 Ga0105243_10064698 3300009148 Bacteria 2935
179 Ga0105241_10123382 3300009174 Bacteria 2089
180 Ga0105242_10066154 3300009176 Bacteria 2984
181 Ga0105248_10009335 3300009177 Bacteria 10801
182 Ga0105249_10018033 3300009553 Bacteria 6274
183 Ga0105249_10321880 3300009553 Bacteria 1558
184 Ga0105249_10446974 3300009553 Bacteria 1331
185 Ga0099796_10000177 3300010159 Bacteria 9629
186 Ga0105239_10790101 3300010375 Bacteria 1087
187 Ga0105239_11821306 3300010375 Unclassified 705
188 Ga0105246_10017550 3300011119 Bacteria 4551
189 Ga0105246_10109003 3300011119 Bacteria 2031
190 Ga0105246_10519694 3300011119 Bacteria 1014
191 Ga0157369_10434317 3300013105 Bacteria 1360
192 Ga0157374_10057433 3300013296 Bacteria 3635
193 Ga0157378_10034000 3300013297 Bacteria 4509
194 Ga0157378_10278147 3300013297 Bacteria 1612
195 Ga0157378_10291126 3300013297 Bacteria 1577
196 Ga0163162_10541421 3300013306 Bacteria 1293
197 Ga0163163_10165623 3300014325 Bacteria 2256
198 Ga0157380_10099434 3300014326 Bacteria 2419
199 Ga0157377_10316676 3300014745 Unclassified 1035
200 Ga0157379_10063978 3300014968 Bacteria 3288
201 Ga0157379_10798955 3300014968 Bacteria 890
202 Ga0157376_10080223 3300014969 Bacteria 2799
203 Ga0157376_10195772 3300014969 Bacteria 1856
204 Ga0157376_11502258 3300014969 Bacteria 707
205 Ga0213872_10154864 3300021361 Bacteria 999
206 Ga0213876_10359066 3300021384 Bacteria 775
207 Ga0207697_10087936 3300025315 Bacteria 1315
208 Ga0207656_10051330 3300025321 Bacteria 1783
209 Ga0207692_10004790 3300025898 Bacteria 5378
210 Ga0207692_10013852 3300025898 Bacteria 3509
211 Ga0207688_10000751 3300025901 Bacteria 16123
212 Ga0207680_10031162 3300025903 Bacteria 3018
213 Ga0207647_10006982 3300025904 Bacteria 8185
214 Ga0207685_10018624 3300025905 Bacteria 2271
215 Ga0207699_10078244 3300025906 Bacteria 2042
216 Ga0207699_10359802 3300025906 Bacteria 1029
217 Ga0207645_10014476 3300025907 Bacteria 5278
218 Ga0207643_10006143 3300025908 Bacteria 6425
219 Ga0207684_10054648 3300025910 Bacteria 3388
220 Ga0207654_10484131 3300025911 Bacteria 872
221 Ga0207693_10001646 3300025915 Bacteria 19719
222 Ga0207693_10004306 3300025915 Bacteria 12051
223 Ga0207693_10016457 3300025915 Bacteria 5909
224 Ga0207693_10037761 3300025915 Bacteria 3806
225 Ga0207663_10310578 3300025916 Unclassified 1181
226 Ga0207663_10358177 3300025916 Bacteria 1106
227 Ga0207662_10014665 3300025918 Bacteria 4401
228 Ga0207662_10025114 3300025918 Bacteria 3430
229 Ga0207657_10102858 3300025919 Bacteria 2369
230 Ga0207681_10132616 3300025923 Bacteria 1844
231 Ga0207681_10232611 3300025923 Bacteria 1431
232 Ga0207650_10201788 3300025925 Bacteria 1593
233 Ga0207659_10669779 3300025926 Bacteria 887
234 Ga0207659_11294980 3300025926 Unclassified 626
235 Ga0207687_10045899 3300025927 Bacteria 3022
236 Ga0207687_10202142 3300025927 Bacteria 1554
237 Ga0207700_10025241 3300025928 Bacteria 4125
238 Ga0207700_10046943 3300025928 Bacteria 3198
239 Ga0207700_10141843 3300025928 Bacteria 1975
240 Ga0207700_10197732 3300025928 Bacteria 1693
241 Ga0207700_10349292 3300025928 Unclassified 1288
242 Ga0207700_11002372 3300025928 Bacteria 747
243 Ga0207664_10333991 3300025929 Bacteria 1339
244 Ga0207664_10449190 3300025929 Bacteria 1150
245 Ga0207706_10020515 3300025933 Bacteria 5940
246 Ga0207686_10070003 3300025934 Bacteria 2252
247 Ga0207709_10083776 3300025935 Bacteria 2063
248 Ga0207670_10015101 3300025936 Bacteria 4604
249 Ga0207670_10106767 3300025936 Bacteria 2009
250 Ga0207704_10056485 3300025938 Bacteria 2405
251 Ga0207665_10000840 3300025939 Bacteria 20737
252 Ga0207665_10300793 3300025939 Bacteria 1199
253 Ga0207665_10368530 3300025939 Bacteria 1088
254 Ga0207691_10001910 3300025940 Bacteria 20354
255 Ga0207711_10065325 3300025941 Bacteria 3145
256 Ga0207689_10547895 3300025942 Bacteria 971
257 Ga0207651_10049176 3300025960 Bacteria 2855
258 Ga0207668_10139954 3300025972 Bacteria 1859
259 Ga0207658_10045522 3300025986 Bacteria 3199
260 Ga0207677_10046219 3300026023 Bacteria 2913
261 Ga0207703_10166535 3300026035 Bacteria 1935
262 Ga0207703_10554981 3300026035 Bacteria 1083
263 Ga0207639_11372165 3300026041 Unclassified 663
264 Ga0207708_10000124 3300026075 Bacteria 59953
265 Ga0207702_10044086 3300026078 Bacteria 3748
266 Ga0207702_10355163 3300026078 Bacteria 1403
267 Ga0207648_10006081 3300026089 Bacteria 12037
268 Ga0207676_10006898 3300026095 Bacteria 8049
269 Ga0207676_10802307 3300026095 Unclassified 918
270 Ga0207675_100001163 3300026118 Bacteria 26202
271 Ga0207683_10425888 3300026121 Unclassified 1223
272 Ga0207428_10229459 3300027907 Bacteria 1390
273 Ga0207428_10578945 3300027907 Bacteria 810
274 Ga0268266_10145355 3300028379 Bacteria 2131
275 Ga0268265_10051381 3300028380 Bacteria 3111
276 Ga0268265_10964335 3300028380 Unclassified 841
277 Ga0268264_10235252 3300028381 Bacteria 1694
278 Ga0268264_10328616 3300028381 Bacteria 1448
279 Ga0265330_10169983 3300031235 Bacteria 924
280 Ga0265329_10066644 3300031242 Bacteria 1139
281 Ga0265329_10093969 3300031242 Bacteria 952
282 Ga0265316_10137517 3300031344 Bacteria 1837
283 Ga0307408_100905202 3300031548 Bacteria 808
284 Ga0265313_10102596 3300031595 Bacteria 1268
285 Ga0316579_10207239 3300031691 Unclassified 948
286 Ga0265314_10167481 3300031711 Bacteria 1330
287 Ga0265342_10090199 3300031712 Bacteria 1758
288 Ga0265342_10248968 3300031712 Bacteria 949
289 Ga0316576_10384047 3300031727 Unclassified 1042
290 Ga0307407_10446613 3300031903 Bacteria 938
291 Ga0307416_100196262 3300032002 Bacteria 1910
292 Ga0316585_10042786 3300032137 Bacteria 1445
293 Ga0373940_0025756 3300035088 Bacteria 1534
294 Ga0373951_0022106 3300035091 Bacteria 1463
295 Ga0373923_0004038 3300035111 Bacteria 4814
296 Ga0373923_0088779 3300035111 Bacteria 1350
297 Ga0373936_0065019 3300035113 Bacteria 1496
298 Ga0373936_0118015 3300035113 Bacteria 1131
299 Ga0373945_0274892 3300035116 Bacteria 716
300 Ga0373954_0327227 3300035118 Bacteria 757
301 Ga0373956_0004133 3300035119 Bacteria 5825
302 Ga0373956_0024887 3300035119 Bacteria 2584
303 Ga0373960_0079890 3300035121 Bacteria 1028
304 Ga0373943_0352630 3300035170 Bacteria 843
305 Ga0373946_0123436 3300035171 Bacteria 1184
306 Ga0373955_0009335 3300035172 Bacteria 4593
307 Ga0316574_0010281 3300035398 Bacteria 5280
308 Ga0373935_0053110 3300035692 Bacteria 2578
309 Ga0373935_0080604 3300035692 Bacteria 2115
310 Ga0373935_0319134 3300035692 Bacteria 1102
311 Ga0373935_0498466 3300035692 Bacteria 884
312 Ga0373927_0007120 3300035695 Bacteria 7590
313 Ga0373927_0056102 3300035695 Bacteria 2546
314 Ga0373927_0287070 3300035695 Bacteria 1083
315 Ga0373933_0185420 3300035724 Bacteria 1328
316 Ga0373947_0007205 3300035725 Bacteria 6447
317 Ga0373947_0042867 3300035725 Bacteria 2702
318 Ga0373947_0538501 3300035725 Bacteria 794
319 Ga0373937_0003943 3300036401 Bacteria 12547
320 Ga0373937_0003978 3300036401 Bacteria 12504
321 Ga0316584_0031962 3300036712 Bacteria 3893
322 Ga0373925_0017072 3300037068 Bacteria 5254
323 Ga0373925_0074452 3300037068 Bacteria 2572
324 Ga0373925_0759239 3300037068 Bacteria 799
325 Ga0395898_0076185 3300037466 Bacteria 3239
326 Ga0436364_1061712 3300037853 Bacteria 2519
327 Ga0436364_1363571 3300037853 Bacteria 947
328 Ga0395901_0339380 3300038443 Bacteria 1552
329 Ga0242420_030225 3300038996 Bacteria 1002
330 Ga0436365_0221195 3300039437 Bacteria 1581
331 Ga0436365_0267214 3300039437 Bacteria 4982
332 Ga0436365_0986594 3300039437 Unclassified 710
333 Ga0436360_1161193 3300039438 Bacteria 866
334 Ga0436361_0493509 3300039447 Bacteria 1687
335 Ga0436361_0748337 3300039447 Bacteria 773
336 Ga0466968_0242910 3300044735 Bacteria 853
337 Ga0466967_1351823 3300045976 Bacteria 709
338 Ga0495627_064020 3300046453 Unclassified 1083
339 Ga0495592_0023048 3300046454 Bacteria 4735
340 Ga0495592_0190187 3300046454 Bacteria 1392
341 Ga0495603_0196419 3300046455 Bacteria 1166
342 Ga0495603_0260236 3300046455 Bacteria 999
343 Ga0495590_0102863 3300046457 Bacteria 1016
344 Ga0495629_0043251 3300046459 Bacteria 3163
345 Ga0495629_0064183 3300046459 Bacteria 2564
346 Ga0495641_0077076 3300046461 Unclassified 1494
347 Ga0495651_0001133 3300046462 Bacteria 20594
348 Ga0495653_0040599 3300046463 Bacteria 3636
349 Ga0495653_0185508 3300046463 Unclassified 1424
350 Ga0495580_0082961 3300046472 Bacteria 2234
351 Ga0495582_0152929 3300046473 Bacteria 1310
352 Ga0495605_0060574 3300046474 Bacteria 1814
353 Ga0495605_0293723 3300046474 Bacteria 688
354 Ga0495639_0014557 3300046475 Bacteria 3407
355 Ga0495662_0419803 3300046476 Bacteria 657
356 Ga0495664_0136328 3300046477 Bacteria 1487
357 Ga0495584_0043040 3300046491 Bacteria 2279
358 Ga0495584_0086753 3300046491 Bacteria 1577
359 Ga0495585_0030552 3300046492 Bacteria 3064
360 Ga0495594_0101237 3300046499 Bacteria 1621
361 Ga0495594_0470520 3300046499 Bacteria 714
362 Ga0495596_0078471 3300046500 Unclassified 1282
363 Ga0495607_0134008 3300046501 Unclassified 1285
364 Ga0495608_0000983 3300046511 Bacteria 20118
365 Ga0495616_0052310 3300046513 Bacteria 2034
366 Ga0495616_0184883 3300046513 Unclassified 924
367 Ga0495618_0004200 3300046514 Bacteria 8890
368 Ga0495618_0085693 3300046514 Bacteria 2014
369 Ga0495620_0044802 3300046515 Unclassified 1920
370 Ga0495628_0043901 3300046516 Bacteria 3558
371 Ga0495630_0394241 3300046517 Bacteria 1061
372 Ga0495630_0427760 3300046517 Bacteria 1014
373 Ga0495631_0041756 3300046518 Bacteria 2029
374 Ga0495643_0177104 3300046522 Bacteria 1039
375 Ga0495663_0031957 3300046525 Unclassified 1565
376 Ga0495666_0059767 3300046526 Bacteria 1823
377 Ga0495652_0019400 3300046529 Bacteria 6057
378 Ga0495640_0005034 3300046533 Bacteria 10499
379 Ga0495587_0009183 3300046536 Bacteria 6345
380 Ga0495598_0006057 3300046537 Bacteria 2713
381 Ga0495598_0009637 3300046537 Unclassified 2291
382 Ga0495645_0034093 3300046543 Bacteria 3715
383 Ga0495633_0033550 3300046558 Bacteria 2475
384 Ga0495667_0002720 3300046559 Bacteria 11829
385 Ga0495656_0015367 3300046615 Bacteria 2888
386 Ga0495656_0032876 3300046615 Bacteria 2114
387 Ga0495656_0240444 3300046615 Unclassified 911
388 Ga0495656_0495572 3300046615 Bacteria 647
389 Ga0495634_0127101 3300046642 Bacteria 1628
390 Ga0495635_0002740 3300046663 Bacteria 12078
391 Ga0495635_0272407 3300046663 Bacteria 1138
392 Ga0495659_0009105 3300046664 Bacteria 3166
393 Ga0495588_0042877 3300046674 Bacteria 2314
394 Ga0495599_0038045 3300046678 Bacteria 3022
395 Ga0495623_0002422 3300046679 Bacteria 12359
396 Ga0495646_0027519 3300046680 Bacteria 3567
397 Ga0495647_0058572 3300046681 Bacteria 1514
398 Ga0495647_0263501 3300046681 Unclassified 770
399 Ga0495647_0302301 3300046681 Bacteria 721
400 Ga0495658_0007724 3300046683 Bacteria 5329
401 Ga0495624_0100874 3300046690 Bacteria 1777
402 Ga0495624_0115468 3300046690 Unclassified 1650
403 Ga0495624_0476907 3300046690 Bacteria 747
404 Ga0495670_0038672 3300046691 Bacteria 2379
405 Ga0495671_0126946 3300046692 Unclassified 1244
406 Ga0495589_0157792 3300046794 Bacteria 1081
407 Ga0495600_0002822 3300046809 Bacteria 10102
408 Ga0495581_0030577 3300047315 Bacteria 3120
409 Ga0495581_0170215 3300047315 Bacteria 1274
410 Ga0495604_0000756 3300047317 Bacteria 27197
411 Ga0495636_0071870 3300047318 Bacteria 1478
412 Ga0495674_0003849 3300047319 Bacteria 14580
413 Ga0495672_0362341 3300047320 Bacteria 671
414 Ga0495676_0094942 3300047321 Bacteria 2220
415 Ga0495680_0000217 3300047322 Bacteria 62734
416 Ga0495683_0186262 3300047323 Bacteria 945
417 Ga0495675_0004599 3300047444 Bacteria 8373
418 Ga0495677_0027103 3300047445 Bacteria 2079
419 Ga0495679_044390 3300047446 Unclassified 1362
420 Ga0495684_0075263 3300047471 Bacteria 2565
421 Ga0495684_0311524 3300047471 Bacteria 1128
422 Ga0495602_0012879 3300048088 Bacteria 8573
423 Ga0495602_0466203 3300048088 Bacteria 889
424 Ga0495614_0127600 3300048089 Bacteria 1124
425 Ga0495614_0153732 3300048089 Bacteria 1027
426 Ga0495615_0034509 3300048090 Unclassified 1232
427 Ga0496100_0008595 3300048903 Bacteria 5700
428 Ga0496100_0039174 3300048903 Bacteria 3008
429 Ga0496100_0069111 3300048903 Bacteria 2351
430 Ga0496100_0140543 3300048903 Bacteria 1711
431 Ga0496101_0005870 3300048904 Bacteria 7861
432 Ga0496101_0023494 3300048904 Bacteria 4260
433 Ga0496101_0277970 3300048904 Bacteria 1308
434 Ga0496102_0023546 3300048905 Bacteria 5471
435 Ga0496102_0153092 3300048905 Bacteria 2167
436 Ga0496102_0363986 3300048905 Unclassified 1361
437 Ga0496103_0004196 3300048906 Bacteria 8745
438 Ga0496103_0008548 3300048906 Bacteria 6084
439 Ga0496104_0010391 3300048907 Bacteria 8314
440 Ga0496104_0126575 3300048907 Bacteria 2453
441 Ga0496104_0130775 3300048907 Bacteria 2411
442 Ga0496105_0000533 3300048908 Bacteria 25165
443 Ga0496105_0026769 3300048908 Bacteria 4707
444 Ga0496105_0168363 3300048908 Bacteria 1797
445 Ga0496105_0371520 3300048908 Unclassified 1139
446 Ga0496106_0034597 3300048909 Bacteria 3774
447 Ga0496106_0038694 3300048909 Bacteria 3571
448 Ga0496106_0099556 3300048909 Bacteria 2254
449 Ga0496106_0145574 3300048909 Bacteria 1866
450 Ga0496107_0026899 3300048910 Bacteria 4082
451 Ga0496107_0040112 3300048910 Bacteria 3359
452 Ga0496107_0059220 3300048910 Bacteria 2771
453 Ga0496107_0066385 3300048910 Bacteria 2616
454 Ga0496108_0000562 3300048911 Bacteria 29121
455 Ga0496108_0018328 3300048911 Bacteria 5733
456 Ga0496109_0002555 3300048912 Bacteria 15233
457 Ga0496109_0064102 3300048912 Bacteria 3362
458 Ga0496109_0067127 3300048912 Bacteria 3285
459 Ga0496109_0350298 3300048912 Bacteria 1395
460 Ga0496109_0460766 3300048912 Bacteria 1201
461 Ga0496110_0070338 3300048913 Bacteria 3100
462 Ga0496110_0122334 3300048913 Bacteria 2345
463 Ga0496110_0207090 3300048913 Bacteria 1783
464 Ga0496110_0240562 3300048913 Bacteria 1647
465 Ga0496110_0277397 3300048913 Bacteria 1526
466 Ga0496111_0003149 3300048914 Bacteria 10153
467 Ga0496111_0013219 3300048914 Bacteria 5612
468 Ga0496111_0169121 3300048914 Bacteria 1624
469 Ga0496111_0188697 3300048914 Bacteria 1532
470 Ga0496112_0003111 3300048915 Bacteria 13600
471 Ga0496112_0134644 3300048915 Bacteria 2441
472 Ga0496112_0207009 3300048915 Bacteria 1919
473 Ga0496112_0534580 3300048915 Bacteria 1107
474 Ga0496113_0001226 3300048916 Bacteria 14084
475 Ga0496113_0008951 3300048916 Bacteria 6554
476 Ga0496113_0072602 3300048916 Bacteria 2619
477 Ga0496113_0727112 3300048916 Bacteria 791
478 Ga0496114_0035096 3300048917 Bacteria 4140
479 Ga0496114_0414280 3300048917 Bacteria 1193
480 Ga0496115_0076516 3300048918 Bacteria 2720
481 Ga0496115_0108349 3300048918 Bacteria 2281
482 Ga0496115_0227739 3300048918 Bacteria 1537
483 Ga0496115_0477685 3300048918 Bacteria 1004
484 Ga0496115_0517301 3300048918 Bacteria 957
485 Ga0501032_0654656 3300049569 Bacteria 667
486 Ga0501033_0182094 3300049570 Bacteria 1506
487 Ga0501036_0496177 3300049572 Bacteria 1016
488 Ga0501036_0682096 3300049572 Bacteria 850
489 Ga0501036_0731931 3300049572 Bacteria 816
490 Ga0501036_0789116 3300049572 Bacteria 782
491 Ga0501039_0804454 3300049575 Bacteria 733
492 Ga0501040_0064753 3300049576 Bacteria 2517
493 Ga0501040_0424029 3300049576 Bacteria 956
494 Ga0501041_0250236 3300049577 Bacteria 1114
495 Ga0501041_0254366 3300049577 Bacteria 1104
496 Ga0501041_0866588 3300049577 Bacteria 580
497 Ga0501043_0199397 3300049579 Bacteria 1554
498 Ga0501048_0214216 3300049582 Bacteria 1366
499 Ga0501067_0472579 3300049583 Bacteria 701
500 Ga0501070_0267487 3300049586 Bacteria 1397
501 Ga0501071_0091589 3300049587 Bacteria 2234
502 Ga0501071_0103610 3300049587 Bacteria 2100
503 Ga0501071_0617518 3300049587 Bacteria 834
504 Ga0501072_0114818 3300049588 Bacteria 2144
505 Ga0501072_0209341 3300049588 Bacteria 1554
506 Ga0501072_0319315 3300049588 Bacteria 1234
507 Ga0501072_0534320 3300049588 Bacteria 927
508 Ga0501072_0615709 3300049588 Bacteria 855
509 Ga0501073_0627599 3300049589 Bacteria 742
510 Ga0501074_0142263 3300049590 Bacteria 1716
511 Ga0501074_0325151 3300049590 Bacteria 1092
512 Ga0501075_0066268 3300049591 Bacteria 2725
513 Ga0501075_0135553 3300049591 Bacteria 1876
514 Ga0501075_0527436 3300049591 Bacteria 901
515 Ga0501076_0054240 3300049592 Bacteria 3177
516 Ga0501076_0160716 3300049592 Bacteria 1830
517 Ga0501076_0192610 3300049592 Bacteria 1664
518 Ga0501076_0629185 3300049592 Bacteria 885
519 Ga0501076_1022640 3300049592 Unclassified 681
520 Ga0501077_0054198 3300049593 Bacteria 2547
521 Ga0501077_0059847 3300049593 Bacteria 2418
522 Ga0501079_0072750 3300049741 Bacteria 2657
523 Ga0501079_0075042 3300049741 Bacteria 2615
524 Ga0501079_0131074 3300049741 Bacteria 1951
525 Ga0501079_0276699 3300049741 Bacteria 1312
526 Ga0501080_0107120 3300049742 Bacteria 2591
527 Ga0501081_0044569 3300049743 Bacteria 3045
528 Ga0501081_0143022 3300049743 Bacteria 1715
529 Ga0501081_0171374 3300049743 Bacteria 1567
530 Ga0501081_0370845 3300049743 Bacteria 1057
531 Ga0501081_0616170 3300049743 Bacteria 813
532 Ga0501035_0465493 3300049822 Bacteria 1044
533 Ga0501045_0085431 3300049824 Bacteria 2329
534 Ga0501045_0205027 3300049824 Bacteria 1469
535 Ga0501045_0657883 3300049824 Bacteria 774
536 nmdc:mga03n38_197027_c1 3300050490 Bacteria 1040
537 nmdc:mga00v17_168086_c1 3300050491 Bacteria 1413
538 nmdc:mga0yw44_129214_c1 3300050492 Bacteria 1634
539 nmdc:mga0yw44_283365_c1 3300050492 Bacteria 1108
540 nmdc:mga0yw44_39744_c1 3300050492 Bacteria 2792
541 nmdc:mga06z11_130281_c1 3300050494 Bacteria 1412
542 nmdc:mga06z11_20454_c1 3300050494 Bacteria 3059
543 nmdc:mga07m45_115415_c1 3300050496 Unclassified 1548
544 nmdc:mga05p37_1199001_c1 3300050507 Bacteria 784
545 nmdc:mga05p37_1290287_c1 3300050507 Bacteria 745
546 nmdc:mga05p37_40413_c1 3300050507 Bacteria 5728
547 nmdc:mga05p37_57347_c1 3300050507 Bacteria 4797
548 nmdc:mga09592_29809_c1 3300050508 Bacteria 4538
549 nmdc:mga09592_392820_c1 3300050508 Bacteria 1199
550 nmdc:mga0qj67_102_c1 3300050509 Bacteria 56790
551 nmdc:mga0qj67_112361_c1 3300050509 Bacteria 2199
552 nmdc:mga0qj67_119287_c1 3300050509 Bacteria 2133
553 nmdc:mga0qj67_211519_c1 3300050509 Unclassified 1575
554 nmdc:mga0qj67_229793_c1 3300050509 Bacteria 1505
555 nmdc:mga0qj67_311945_c1 3300050509 Bacteria 1274
556 nmdc:mga06r32_133825_c1 3300050510 Bacteria 2453
557 nmdc:mga06r32_143253_c1 3300050510 Bacteria 2367
558 nmdc:mga06r32_23570_c1 3300050510 Bacteria 5698
559 nmdc:mga06r32_50950_c1 3300050510 Bacteria 3961
560 nmdc:mga06r32_700868_c1 3300050510 Bacteria 978
561 nmdc:mga06r32_98323_c1 3300050510 Bacteria 2869
562 nmdc:mga08y16_134904_c1 3300050511 Bacteria 2565
563 nmdc:mga08y16_287802_c1 3300050511 Unclassified 1694
564 nmdc:mga08y16_587696_c1 3300050511 Bacteria 1123
565 nmdc:mga08y16_73891_c1 3300050511 Bacteria 3552
566 nmdc:mga0n895_240954_c1 3300050512 Bacteria 1835
567 nmdc:mga0n895_243083_c1 3300050512 Bacteria 1827
568 nmdc:mga0n895_358021_c1 3300050512 Bacteria 1478
569 nmdc:mga0n895_375442_c1 3300050512 Bacteria 1439
570 nmdc:mga0n895_471282_c1 3300050512 Bacteria 1267
571 nmdc:mga0n895_532526_c1 3300050512 Bacteria 1181
572 nmdc:mga0n895_9544_c1 3300050512 Bacteria 8499
573 nmdc:mga0rr50_131556_c1 3300050513 Bacteria 2004
574 nmdc:mga0rr50_319993_c1 3300050513 Bacteria 1300
575 nmdc:mga0rr50_330331_c1 3300050513 Bacteria 1280
576 nmdc:mga0rr50_38036_c1 3300050513 Bacteria 3478
577 nmdc:mga0a205_11652_c1 3300050515 Bacteria 8107
578 nmdc:mga0a205_118558_c1 3300050515 Bacteria 2545
579 nmdc:mga0a205_159674_c1 3300050515 Bacteria 2151
580 Ga0495601_0005344 3300053077 Bacteria 7481
581 Ga0495601_0069260 3300053077 Unclassified 2250
582 Ga0495601_0221536 3300053077 Bacteria 1236
583 Ga0495601_0340062 3300053077 Bacteria 976
584 Ga0495612_0000436 3300053078 Bacteria 16662
585 Ga0495612_0127814 3300053078 Bacteria 1096
586 Ga0495595_0001158 3300053084 Bacteria 10212
587 Ga0495595_0050144 3300053084 Bacteria 1932
588 Ga0495619_0022067 3300053085 Bacteria 4069
589 Ga0495619_0129667 3300053085 Bacteria 1732
590 Ga0495619_0134323 3300053085 Bacteria 1701
591 Ga0501084_0079171 3300054114 Bacteria 2755
592 Ga0501084_1050319 3300054114 Bacteria 684
593 Ga0501082_0469727 3300060353 Bacteria 1099
594 Ga0530510_0015199 3300061734 Bacteria 5436
595 Ga0530510_0053392 3300061734 Bacteria 2921
596 Ga0530510_0070895 3300061734 Unclassified 2529
597 Ga0530510_0103251 3300061734 Bacteria 2085
598 Ga0530510_0222867 3300061734 Bacteria 1402
599 Ga0530510_0312845 3300061734 Bacteria 1176
600 Ga0496112_0255238
601 JGI24746J21847_1009384
602 JGI24747J21853_1024653
603 JGI24744J21845_10013903
604 JGI24034J26672_10004896
605 JGI24742J22300_10002110
606 Ga0070658_10110778
607 Ga0070676_10043785
608 Ga0070690_100066795
609 Ga0070690_100089087
610 Ga0070670_100003320
611 Ga0070670_100424345
612 Ga0070677_10043250
613 Ga0070666_10037885
614 Ga0070682_100197877
615 Ga0068868_100067478
616 Ga0070660_100050021
617 Ga0070689_100002615
618 Ga0070689_100184595
619 Ga0070689_100348925
620 Ga0070691_10139132
621 Ga0070687_100010268
622 Ga0070687_100025652
623 Ga0070661_100014636
624 Ga0070692_10012657
625 Ga0070668_100020744
626 Ga0070669_100784777
627 Ga0070669_100809077
628 Ga0070675_100287379
629 Ga0070675_101137868
630 Ga0070671_100004085
631 Ga0070673_100180513
632 Ga0070688_100117556
633 Ga0070659_100049191
634 Ga0070667_100739231
635 Ga0070703_10011669
636 Ga0070709_10178477
637 Ga0070714_100040717
638 Ga0070714_100098844
639 Ga0070713_100065968
640 Ga0070713_100089268
641 Ga0070713_100125990
642 Ga0070713_100493092
643 Ga0070710_10022554
644 Ga0070710_10272073
645 Ga0070701_10018697
646 Ga0070711_100010990
647 Ga0070711_100069018
648 Ga0070711_100407415
649 Ga0070711_100422097
650 Ga0070705_100265342
651 Ga0070705_100354531
652 Ga0070705_100603823
653 Ga0070700_100043890
654 Ga0070694_100144822
655 Ga0070678_100255377
656 Ga0070678_100604368
657 Ga0070662_100082291
658 Ga0070681_10532657
659 Ga0068867_100046225
660 Ga0070685_10070557
661 Ga0070699_100028449
662 Ga0070679_100775750
663 Ga0070684_100203055
664 Ga0070697_100419374
665 Ga0070697_100954748
666 Ga0068853_100019266
667 Ga0070672_100587004
668 Ga0070686_100091386
669 Ga0070696_100162828
670 Ga0070696_100208613
671 Ga0070704_100686643
672 Ga0070664_100100332
673 Ga0070664_100166804
674 Ga0068857_100076467
675 Ga0068856_100377880
676 Ga0070702_100131722
677 Ga0070702_100155698
678 Ga0068852_100194377
679 Ga0068859_100014185
680 Ga0068864_100021408
681 Ga0068864_100871159
682 Ga0068866_10012258
683 Ga0068861_100022917
684 Ga0068851_10456093
685 Ga0068870_10014844
686 Ga0068858_100078609
687 Ga0068858_100145773
688 Ga0068860_100285093
689 Ga0068860_100405344
690 Ga0068862_100298083
691 Ga0081455_10000577
692 Ga0081455_10001167
693 Ga0081455_10021228
694 Ga0081455_10034625
695 Ga0081455_10043051
696 Ga0081455_10086526
697 Ga0081455_10105338
698 Ga0081538_10021356
699 Ga0081538_10052272
700 Ga0081540_1000310
701 Ga0081540_1001623
702 Ga0081540_1049609
703 Ga0081540_1123526
704 Ga0081539_10114366
705 Ga0070717_10041471
706 Ga0070717_10056544
707 Ga0070717_10166751
708 Ga0070717_10363572
709 Ga0075365_10011389
710 Ga0075365_10237416
711 Ga0075432_10118912
712 Ga0070715_10000883
713 Ga0070715_10022770
714 Ga0070715_10230369
715 Ga0070716_100005227
716 Ga0070716_100167621
717 Ga0070716_100431217
718 Ga0070712_100000278
719 Ga0070712_100402100
720 Ga0075362_10166991
721 Ga0075367_10057304
722 Ga0097621_100117015
723 Ga0075370_10169353
724 Ga0068871_100043160
725 Ga0075428_100045964
726 Ga0075428_100061894
727 Ga0075428_100090478
728 Ga0075428_100120569
729 Ga0075428_100368358
730 Ga0075428_100489731
731 Ga0075430_100000484
732 Ga0075430_100022906
733 Ga0075430_100166675
734 Ga0075430_100267069
735 Ga0075430_100768670
736 Ga0075431_100039684
737 Ga0075431_100039830
738 Ga0075431_100200008
739 Ga0075431_100320284
740 Ga0075431_100323095
741 Ga0075431_100334562
742 Ga0075431_100769483
743 Ga0075431_101221700
744 Ga0075433_10866087
745 Ga0075434_100014205
746 Ga0075434_100046340
747 Ga0075434_100074476
748 Ga0075434_100160155
749 Ga0075434_100398723
750 Ga0075434_100487505
751 Ga0075429_100213192
752 Ga0075429_100425502
753 Ga0075436_100238495
754 Ga0097620_100014184
755 Ga0075435_100013264
756 Ga0075435_100074726
757 Ga0075435_100339508
758 Ga0099795_10000273
759 Ga0099795_10016326
760 Ga0105251_10075198
761 Ga0105244_10093411
762 Ga0111539_10035223
763 Ga0111539_10113911
764 Ga0111539_10305394
765 Ga0105245_10026643
766 Ga0105245_10123350
767 Ga0105247_10039865
768 Ga0105247_10171102
769 Ga0114129_10003967
770 Ga0114129_10006691
771 Ga0114129_10043219
772 Ga0114129_10077703
773 Ga0114129_10081800
774 Ga0114129_10249513
775 Ga0114129_11168331
776 Ga0114129_11551093
777 Ga0105243_10064698
778 Ga0105241_10123382
779 Ga0105242_10066154
780 Ga0105248_10009335
781 Ga0105249_10018033
782 Ga0105249_10321880
783 Ga0105249_10446974
784 Ga0099796_10000177
785 Ga0105239_10790101
786 Ga0105239_11821306
787 Ga0105246_10017550
788 Ga0105246_10109003
789 Ga0105246_10519694
790 Ga0157369_10434317
791 Ga0157374_10057433
792 Ga0157378_10034000
793 Ga0157378_10278147
794 Ga0157378_10291126
795 Ga0163162_10541421
796 Ga0163163_10165623
797 Ga0157380_10099434
798 Ga0157377_10316676
799 Ga0157379_10063978
800 Ga0157379_10798955
801 Ga0157376_10080223
802 Ga0157376_10195772
803 Ga0157376_11502258
804 Ga0213872_10154864
805 Ga0213876_10359066
806 Ga0207697_10087936
807 Ga0207656_10051330
808 Ga0207692_10004790
809 Ga0207692_10013852
810 Ga0207688_10000751
811 Ga0207680_10031162
812 Ga0207647_10006982
813 Ga0207685_10018624
814 Ga0207699_10078244
815 Ga0207699_10359802
816 Ga0207645_10014476
817 Ga0207643_10006143
818 Ga0207684_10054648
819 Ga0207654_10484131
820 Ga0207693_10001646
821 Ga0207693_10004306
822 Ga0207693_10016457
823 Ga0207693_10037761
824 Ga0207663_10310578
825 Ga0207663_10358177
826 Ga0207662_10014665
827 Ga0207662_10025114
828 Ga0207657_10102858
829 Ga0207681_10132616
830 Ga0207681_10232611
831 Ga0207650_10201788
832 Ga0207659_10669779
833 Ga0207659_11294980
834 Ga0207687_10045899
835 Ga0207687_10202142
836 Ga0207700_10025241
837 Ga0207700_10046943
838 Ga0207700_10141843
839 Ga0207700_10197732
840 Ga0207700_10349292
841 Ga0207700_11002372
842 Ga0207664_10333991
843 Ga0207664_10449190
844 Ga0207706_10020515
845 Ga0207686_10070003
846 Ga0207709_10083776
847 Ga0207670_10015101
848 Ga0207670_10106767
849 Ga0207704_10056485
850 Ga0207665_10000840
851 Ga0207665_10300793
852 Ga0207665_10368530
853 Ga0207691_10001910
854 Ga0207711_10065325
855 Ga0207689_10547895
856 Ga0207651_10049176
857 Ga0207668_10139954
858 Ga0207658_10045522
859 Ga0207677_10046219
860 Ga0207703_10166535
861 Ga0207703_10554981
862 Ga0207639_11372165
863 Ga0207708_10000124
864 Ga0207702_10044086
865 Ga0207702_10355163
866 Ga0207648_10006081
867 Ga0207676_10006898
868 Ga0207676_10802307
869 Ga0207675_100001163
870 Ga0207683_10425888
871 Ga0207428_10229459
872 Ga0207428_10578945
873 Ga0268266_10145355
874 Ga0268265_10051381
875 Ga0268265_10964335
876 Ga0268264_10235252
877 Ga0268264_10328616
878 Ga0265330_10169983
879 Ga0265329_10066644
880 Ga0265329_10093969
881 Ga0265316_10137517
882 Ga0307408_100905202
883 Ga0265313_10102596
884 Ga0316579_10207239
885 Ga0265314_10167481
886 Ga0265342_10090199
887 Ga0265342_10248968
888 Ga0316576_10384047
889 Ga0307407_10446613
890 Ga0307416_100196262
891 Ga0316585_10042786
892 Ga0373940_0025756
893 Ga0373951_0022106
894 Ga0373923_0004038
895 Ga0373923_0088779
896 Ga0373936_0065019
897 Ga0373936_0118015
898 Ga0373945_0274892
899 Ga0373954_0327227
900 Ga0373956_0004133
901 Ga0373956_0024887
902 Ga0373960_0079890
903 Ga0373943_0352630
904 Ga0373946_0123436
905 Ga0373955_0009335
906 Ga0316574_0010281
907 Ga0373935_0053110
908 Ga0373935_0080604
909 Ga0373935_0319134
910 Ga0373935_0498466
911 Ga0373927_0007120
912 Ga0373927_0056102
913 Ga0373927_0287070
914 Ga0373933_0185420
915 Ga0373947_0007205
916 Ga0373947_0042867
917 Ga0373947_0538501
918 Ga0373937_0003943
919 Ga0373937_0003978
920 Ga0316584_0031962
921 Ga0373925_0017072
922 Ga0373925_0074452
923 Ga0373925_0759239
924 Ga0395898_0076185
925 Ga0436364_1061712
926 Ga0436364_1363571
927 Ga0395901_0339380
928 Ga0242420_030225
929 Ga0436365_0221195
930 Ga0436365_0267214
931 Ga0436365_0986594
932 Ga0436360_1161193
933 Ga0436361_0493509
934 Ga0436361_0748337
935 Ga0466968_0242910
936 Ga0466967_1351823
937 Ga0495627_064020
938 Ga0495592_0023048
939 Ga0495592_0190187
940 Ga0495603_0196419
941 Ga0495603_0260236
942 Ga0495590_0102863
943 Ga0495629_0043251
944 Ga0495629_0064183
945 Ga0495641_0077076
946 Ga0495651_0001133
947 Ga0495653_0040599
948 Ga0495653_0185508
949 Ga0495580_0082961
950 Ga0495582_0152929
951 Ga0495605_0060574
952 Ga0495605_0293723
953 Ga0495639_0014557
954 Ga0495662_0419803
955 Ga0495664_0136328
956 Ga0495584_0043040
957 Ga0495584_0086753
958 Ga0495585_0030552
959 Ga0495594_0101237
960 Ga0495594_0470520
961 Ga0495596_0078471
962 Ga0495607_0134008
963 Ga0495608_0000983
964 Ga0495616_0052310
965 Ga0495616_0184883
966 Ga0495618_0004200
967 Ga0495618_0085693
968 Ga0495620_0044802
969 Ga0495628_0043901
970 Ga0495630_0394241
971 Ga0495630_0427760
972 Ga0495631_0041756
973 Ga0495643_0177104
974 Ga0495663_0031957
975 Ga0495666_0059767
976 Ga0495652_0019400
977 Ga0495640_0005034
978 Ga0495587_0009183
979 Ga0495598_0006057
980 Ga0495598_0009637
981 Ga0495645_0034093
982 Ga0495633_0033550
983 Ga0495667_0002720
984 Ga0495656_0015367
985 Ga0495656_0032876
986 Ga0495656_0240444
987 Ga0495656_0495572
988 Ga0495634_0127101
989 Ga0495635_0002740
990 Ga0495635_0272407
991 Ga0495659_0009105
992 Ga0495588_0042877
993 Ga0495599_0038045
994 Ga0495623_0002422
995 Ga0495646_0027519
996 Ga0495647_0058572
997 Ga0495647_0263501
998 Ga0495647_0302301
999 Ga0495658_0007724
1000 Ga0495624_0100874
1001 Ga0495624_0115468
1002 Ga0495624_0476907
1003 Ga0495670_0038672
1004 Ga0495671_0126946
1005 Ga0495589_0157792
1006 Ga0495600_0002822
1007 Ga0495581_0030577
1008 Ga0495581_0170215
1009 Ga0495604_0000756
1010 Ga0495636_0071870
1011 Ga0495674_0003849
1012 Ga0495672_0362341
1013 Ga0495676_0094942
1014 Ga0495680_0000217
1015 Ga0495683_0186262
1016 Ga0495675_0004599
1017 Ga0495677_0027103
1018 Ga0495679_044390
1019 Ga0495684_0075263
1020 Ga0495684_0311524
1021 Ga0495602_0012879
1022 Ga0495602_0466203
1023 Ga0495614_0127600
1024 Ga0495614_0153732
1025 Ga0495615_0034509
1026 Ga0496100_0008595
1027 Ga0496100_0039174
1028 Ga0496100_0069111
1029 Ga0496100_0140543
1030 Ga0496101_0005870
1031 Ga0496101_0023494
1032 Ga0496101_0277970
1033 Ga0496102_0023546
1034 Ga0496102_0153092
1035 Ga0496102_0363986
1036 Ga0496103_0004196
1037 Ga0496103_0008548
1038 Ga0496104_0010391
1039 Ga0496104_0126575
1040 Ga0496104_0130775
1041 Ga0496105_0000533
1042 Ga0496105_0026769
1043 Ga0496105_0168363
1044 Ga0496105_0371520
1045 Ga0496106_0034597
1046 Ga0496106_0038694
1047 Ga0496106_0099556
1048 Ga0496106_0145574
1049 Ga0496107_0026899
1050 Ga0496107_0040112
1051 Ga0496107_0059220
1052 Ga0496107_0066385
1053 Ga0496108_0000562
1054 Ga0496108_0018328
1055 Ga0496109_0002555
1056 Ga0496109_0064102
1057 Ga0496109_0067127
1058 Ga0496109_0350298
1059 Ga0496109_0460766
1060 Ga0496110_0070338
1061 Ga0496110_0122334
1062 Ga0496110_0207090
1063 Ga0496110_0240562
1064 Ga0496110_0277397
1065 Ga0496111_0003149
1066 Ga0496111_0013219
1067 Ga0496111_0169121
1068 Ga0496111_0188697
1069 Ga0496112_0003111
1070 Ga0496112_0134644
1071 Ga0496112_0207009
1072 Ga0496112_0534580
1073 Ga0496113_0001226
1074 Ga0496113_0008951
1075 Ga0496113_0072602
1076 Ga0496113_0727112
1077 Ga0496114_0035096
1078 Ga0496114_0414280
1079 Ga0496115_0076516
1080 Ga0496115_0108349
1081 Ga0496115_0227739
1082 Ga0496115_0477685
1083 Ga0496115_0517301
1084 Ga0501032_0654656
1085 Ga0501033_0182094
1086 Ga0501036_0496177
1087 Ga0501036_0682096
1088 Ga0501036_0731931
1089 Ga0501036_0789116
1090 Ga0501039_0804454
1091 Ga0501040_0064753
1092 Ga0501040_0424029
1093 Ga0501041_0250236
1094 Ga0501041_0254366
1095 Ga0501041_0866588
1096 Ga0501043_0199397
1097 Ga0501048_0214216
1098 Ga0501067_0472579
1099 Ga0501070_0267487
1100 Ga0501071_0091589
1101 Ga0501071_0103610
1102 Ga0501071_0617518
1103 Ga0501072_0114818
1104 Ga0501072_0209341
1105 Ga0501072_0319315
1106 Ga0501072_0534320
1107 Ga0501072_0615709
1108 Ga0501073_0627599
1109 Ga0501074_0142263
1110 Ga0501074_0325151
1111 Ga0501075_0066268
1112 Ga0501075_0135553
1113 Ga0501075_0527436
1114 Ga0501076_0054240
1115 Ga0501076_0160716
1116 Ga0501076_0192610
1117 Ga0501076_0629185
1118 Ga0501076_1022640
1119 Ga0501077_0054198
1120 Ga0501077_0059847
1121 Ga0501079_0072750
1122 Ga0501079_0075042
1123 Ga0501079_0131074
1124 Ga0501079_0276699
1125 Ga0501080_0107120
1126 Ga0501081_0044569
1127 Ga0501081_0143022
1128 Ga0501081_0171374
1129 Ga0501081_0370845
1130 Ga0501081_0616170
1131 Ga0501035_0465493
1132 Ga0501045_0085431
1133 Ga0501045_0205027
1134 Ga0501045_0657883
1135 nmdc:mga03n38_197027_c1
1136 nmdc:mga00v17_168086_c1
1137 nmdc:mga0yw44_129214_c1
1138 nmdc:mga0yw44_283365_c1
1139 nmdc:mga0yw44_39744_c1
1140 nmdc:mga06z11_130281_c1
1141 nmdc:mga06z11_20454_c1
1142 nmdc:mga07m45_115415_c1
1143 nmdc:mga05p37_1199001_c1
1144 nmdc:mga05p37_1290287_c1
1145 nmdc:mga05p37_40413_c1
1146 nmdc:mga05p37_57347_c1
1147 nmdc:mga09592_29809_c1
1148 nmdc:mga09592_392820_c1
1149 nmdc:mga0qj67_102_c1
1150 nmdc:mga0qj67_112361_c1
1151 nmdc:mga0qj67_119287_c1
1152 nmdc:mga0qj67_211519_c1
1153 nmdc:mga0qj67_229793_c1
1154 nmdc:mga0qj67_311945_c1
1155 nmdc:mga06r32_133825_c1
1156 nmdc:mga06r32_143253_c1
1157 nmdc:mga06r32_23570_c1
1158 nmdc:mga06r32_50950_c1
1159 nmdc:mga06r32_700868_c1
1160 nmdc:mga06r32_98323_c1
1161 nmdc:mga08y16_134904_c1
1162 nmdc:mga08y16_287802_c1
1163 nmdc:mga08y16_587696_c1
1164 nmdc:mga08y16_73891_c1
1165 nmdc:mga0n895_240954_c1
1166 nmdc:mga0n895_243083_c1
1167 nmdc:mga0n895_358021_c1
1168 nmdc:mga0n895_375442_c1
1169 nmdc:mga0n895_471282_c1
1170 nmdc:mga0n895_532526_c1
1171 nmdc:mga0n895_9544_c1
1172 nmdc:mga0rr50_131556_c1
1173 nmdc:mga0rr50_319993_c1
1174 nmdc:mga0rr50_330331_c1
1175 nmdc:mga0rr50_38036_c1
1176 nmdc:mga0a205_11652_c1
1177 nmdc:mga0a205_118558_c1
1178 nmdc:mga0a205_159674_c1
1179 Ga0495601_0005344
1180 Ga0495601_0069260
1181 Ga0495601_0221536
1182 Ga0495601_0340062
1183 Ga0495612_0000436
1184 Ga0495612_0127814
1185 Ga0495595_0001158
1186 Ga0495595_0050144
1187 Ga0495619_0022067
1188 Ga0495619_0129667
1189 Ga0495619_0134323
1190 Ga0501084_0079171
1191 Ga0501084_1050319
1192 Ga0501082_0469727
1193 Ga0530510_0015199
1194 Ga0530510_0053392
1195 Ga0530510_0070895
1196 Ga0530510_0103251
1197 Ga0530510_0222867
1198 Ga0530510_0312845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06742

DUF1214

Protein of unknown function (DUF1214)

89

181

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3u07-assembly3.cif.gz_C crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.789 74 189
3u07-assembly2.cif.gz_B crystal structure of the vpa0106 protein from vibrio parahaemolyticus. northeast structural genomics consortium target vpr106. 0.7831 74 187
3vb9-assembly2.cif.gz_D crystal structure of vpa0735 from vibrio parahaemolyticus in monoclinic form, northeast structural genomics target vpr109 0.7696 73 189
6ans-assembly2.cif.gz_B crystal structure of a putative uncharacterized protein from burkholderia cenocepacia 0.6751 74 188
6nob-assembly1.cif.gz_A structure of glycoside hydrolase family 32 from bifidobacterium adolescentis 0.6674 87 163
ID Description Score Start End Superfamily
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.6846 74 185 2.60.120.1600
3u07C02 Mainly Beta;Sandwich;Jelly Rolls; 0.6642 74 185 2.60.120.1600
af_I6XHH2_45_177_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.6556 68 188 3.40.47.10
3vb9A04 Mainly Beta;Sandwich;Jelly Rolls;Domain of unknown function DUF1214, C-terminal domain 0.6407 54 185 2.60.120.600
af_U4PBJ9_364_449_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6356 86 143 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A3M1YUY4-F1-model_v4 DUF1214 domain-containing protein 0.8461 75 191
AF-A0A529KC85-F1-model_v4 DUF1214 domain-containing protein 0.8446 74 192
AF-A0A381WSC5-F1-model_v4 DUF1214 domain-containing protein 0.8349 74 188
AF-A0A4Q3ISD4-F1-model_v4 deleted 0.8241 79 192
AF-A0A4Q3ISD4-F1-model_v4 deleted 0.8111 79 192

Map