F467823

General Info

Members Datasets Scaffolds Average Seq Length
598 271 1196 187

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0213666|Ga0501068_0213666_407_1030
Length 207
Sequence MTGLVEMVVESVRVHMLSNRHVVILKDSDRDRYLPIWIGPWEASAIAMRLQGLTPERPLTHDLFAAAIDALGVRIERIVIAALAEETFHARLVLARPDGEVEIDARPSDALALAVRTNARIYAAEGVLEQAALGADSVLGEEGGEAEDEAIDAGGSRRRGRAAPLESFGDAIVDPRLDVFRDFVNSLDPDAGGGETGRGRGGRKKPD

Samples

Sample ID Description Type Environment
1 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
146 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
149 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
150 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
151 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
158 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
159 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
173 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
174 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
184 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
188 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
189 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
190 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
191 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
192 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
206 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
207 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
253 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
266 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 9.2
Rhizosphere 90.3
Stem 0
Stem Tuber 0
Unclassified 8.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501068_0213666 3300049584 Bacteria 1225
2 JGI25406J46586_10025699 3300003203 Bacteria 2282
3 rootH1_10043816 3300003323 Bacteria 2201
4 Ga0070683_100016244 3300005329 Bacteria 6559
5 Ga0070683_100322687 3300005329 Bacteria 1470
6 Ga0070690_100022718 3300005330 Bacteria 3840
7 Ga0070670_100012100 3300005331 Bacteria 7378
8 Ga0068869_100053762 3300005334 Bacteria 2929
9 Ga0068869_100250045 3300005334 Bacteria 1415
10 Ga0070680_100309641 3300005336 Bacteria 1340
11 Ga0070682_100013485 3300005337 Bacteria 4703
12 Ga0068868_100036277 3300005338 Bacteria 3815
13 Ga0068868_100523069 3300005338 Bacteria 1042
14 Ga0070660_100010582 3300005339 Bacteria 6520
15 Ga0070689_100013293 3300005340 Bacteria 5954
16 Ga0070689_100774606 3300005340 Bacteria 842
17 Ga0070689_100905540 3300005340 Bacteria 781
18 Ga0070691_10164182 3300005341 Bacteria 1147
19 Ga0070687_100001413 3300005343 Bacteria 8437
20 Ga0070687_100194388 3300005343 Bacteria 1225
21 Ga0070687_100522227 3300005343 Bacteria 803
22 Ga0070661_100028182 3300005344 Bacteria 4050
23 Ga0070669_100054523 3300005353 Bacteria 2928
24 Ga0070675_100037426 3300005354 Bacteria 3952
25 Ga0070675_100601608 3300005354 Bacteria 997
26 Ga0070675_101315688 3300005354 Bacteria 666
27 Ga0070674_100002898 3300005356 Bacteria 9496
28 Ga0070674_100053466 3300005356 Bacteria 2789
29 Ga0070674_100551593 3300005356 Bacteria 967
30 Ga0070673_100033947 3300005364 Bacteria 3856
31 Ga0070673_100059363 3300005364 Bacteria 3027
32 Ga0070688_100377142 3300005365 Bacteria 1044
33 Ga0070659_100007017 3300005366 Bacteria 8158
34 Ga0070659_100093187 3300005366 Bacteria 2417
35 Ga0070659_100490663 3300005366 Bacteria 1046
36 Ga0070701_10070177 3300005438 Bacteria 1871
37 Ga0070705_100028330 3300005440 Bacteria 3067
38 Ga0070705_100051334 3300005440 Bacteria 2404
39 Ga0070705_100096922 3300005440 Bacteria 1852
40 Ga0070705_100184356 3300005440 Bacteria 1417
41 Ga0070700_100019750 3300005441 Bacteria 3893
42 Ga0070700_100275271 3300005441 Bacteria 1218
43 Ga0070694_100002236 3300005444 Bacteria 11432
44 Ga0070694_100405092 3300005444 Bacteria 1069
45 Ga0070694_100608195 3300005444 Bacteria 881
46 Ga0070708_100013236 3300005445 Bacteria 6750
47 Ga0070708_100028405 3300005445 Bacteria 4813
48 Ga0070708_100062015 3300005445 Bacteria 3342
49 Ga0070708_100560973 3300005445 Bacteria 1077
50 Ga0070708_100911699 3300005445 Unclassified 825
51 Ga0070663_100016880 3300005455 Bacteria 4751
52 Ga0070678_100012307 3300005456 Bacteria 5313
53 Ga0070678_100038878 3300005456 Bacteria 3353
54 Ga0070678_100360840 3300005456 Bacteria 1252
55 Ga0070662_100015903 3300005457 Bacteria 5046
56 Ga0070681_10153348 3300005458 Bacteria 2229
57 Ga0070681_10613195 3300005458 Bacteria 1003
58 Ga0068867_100009671 3300005459 Bacteria 6796
59 Ga0070706_100000919 3300005467 Bacteria 32323
60 Ga0070706_100011739 3300005467 Bacteria 8128
61 Ga0070706_100034729 3300005467 Bacteria 4657
62 Ga0070707_100002815 3300005468 Bacteria 16544
63 Ga0070707_100239789 3300005468 Bacteria 1765
64 Ga0070707_100444222 3300005468 Bacteria 1257
65 Ga0070707_100740012 3300005468 Bacteria 947
66 Ga0070698_100072187 3300005471 Bacteria 3460
67 Ga0070698_100228104 3300005471 Bacteria 1796
68 Ga0070698_100384656 3300005471 Bacteria 1336
69 Ga0070699_100001063 3300005518 Bacteria 25533
70 Ga0070699_100408300 3300005518 Bacteria 1229
71 Ga0070699_100553431 3300005518 Bacteria 1047
72 Ga0070699_100880347 3300005518 Bacteria 820
73 Ga0070679_100359716 3300005530 Bacteria 1403
74 Ga0070684_100020136 3300005535 Bacteria 5535
75 Ga0070684_100032615 3300005535 Bacteria 4440
76 Ga0070684_101063619 3300005535 Bacteria 760
77 Ga0070697_100021331 3300005536 Bacteria 5132
78 Ga0070697_100024387 3300005536 Bacteria 4815
79 Ga0068853_100319893 3300005539 Bacteria 1438
80 Ga0070672_100016014 3300005543 Bacteria 5358
81 Ga0070686_100257935 3300005544 Bacteria 1276
82 Ga0070686_100280811 3300005544 Bacteria 1228
83 Ga0070686_100366462 3300005544 Bacteria 1087
84 Ga0070695_100016974 3300005545 Bacteria 4414
85 Ga0070695_100119061 3300005545 Bacteria 1804
86 Ga0070695_100294939 3300005545 Bacteria 1196
87 Ga0070695_100514126 3300005545 Bacteria 928
88 Ga0070696_100043654 3300005546 Bacteria 3102
89 Ga0070696_100119231 3300005546 Bacteria 1908
90 Ga0070696_100157937 3300005546 Bacteria 1669
91 Ga0070696_100307281 3300005546 Bacteria 1216
92 Ga0070696_100420863 3300005546 Bacteria 1049
93 Ga0070693_100281344 3300005547 Bacteria 1114
94 Ga0070693_100316075 3300005547 Bacteria 1058
95 Ga0070693_100318308 3300005547 Unclassified 1055
96 Ga0070704_100295715 3300005549 Bacteria 1347
97 Ga0068855_100124433 3300005563 Bacteria 2950
98 Ga0068855_100756246 3300005563 Unclassified 1036
99 Ga0068855_101056337 3300005563 Unclassified 851
100 Ga0070664_100336924 3300005564 Bacteria 1369
101 Ga0068857_100016620 3300005577 Bacteria 6446
102 Ga0068854_100280704 3300005578 Unclassified 1341
103 Ga0068854_100606919 3300005578 Bacteria 935
104 Ga0068854_100785321 3300005578 Bacteria 829
105 Ga0068856_100509189 3300005614 Bacteria 1225
106 Ga0070702_100010497 3300005615 Bacteria 4564
107 Ga0070702_100141465 3300005615 Bacteria 1533
108 Ga0070702_100197217 3300005615 Unclassified 1330
109 Ga0068859_100011193 3300005617 Bacteria 9019
110 Ga0068864_100091736 3300005618 Bacteria 2680
111 Ga0068861_100057765 3300005719 Bacteria 2964
112 Ga0068861_100214585 3300005719 Bacteria 1623
113 Ga0068870_10001460 3300005840 Bacteria 9571
114 Ga0068870_10132652 3300005840 Bacteria 1449
115 Ga0068870_10338900 3300005840 Bacteria 961
116 Ga0068863_100383398 3300005841 Bacteria 1373
117 Ga0068858_100029152 3300005842 Bacteria 5124
118 Ga0068858_100062427 3300005842 Bacteria 3445
119 Ga0068858_100721335 3300005842 Bacteria 970
120 Ga0068858_100856410 3300005842 Bacteria 888
121 Ga0068860_100363199 3300005843 Bacteria 1427
122 Ga0068860_100505081 3300005843 Unclassified 1207
123 Ga0068862_100515664 3300005844 Bacteria 1137
124 Ga0081538_10242295 3300005981 Bacteria 694
125 Ga0081539_10001388 3300005985 Bacteria 41708
126 Ga0081539_10003192 3300005985 Bacteria 20732
127 Ga0097621_100095580 3300006237 Bacteria 2493
128 Ga0068871_100405209 3300006358 Bacteria 1215
129 Ga0068871_100519779 3300006358 Bacteria 1075
130 Ga0075428_100000081 3300006844 Bacteria 80139
131 Ga0075428_100111995 3300006844 Bacteria 2973
132 Ga0075428_100257202 3300006844 Bacteria 1881
133 Ga0075428_101390996 3300006844 Bacteria 737
134 Ga0075431_100051209 3300006847 Bacteria 4259
135 Ga0075433_10155862 3300006852 Bacteria 2032
136 Ga0075433_10231222 3300006852 Bacteria 1642
137 Ga0075433_10372601 3300006852 Bacteria 1261
138 Ga0075433_10764794 3300006852 Bacteria 845
139 Ga0075434_100133872 3300006871 Bacteria 2498
140 Ga0075434_100500007 3300006871 Bacteria 1237
141 Ga0075434_100531451 3300006871 Bacteria 1196
142 Ga0068865_100002193 3300006881 Bacteria 11508
143 Ga0068865_100190441 3300006881 Bacteria 1586
144 Ga0075436_100515506 3300006914 Bacteria 876
145 Ga0097620_100011194 3300006931 Bacteria 9019
146 Ga0075435_100135492 3300007076 Bacteria 2063
147 Ga0075435_100314940 3300007076 Bacteria 1339
148 Ga0105244_10271710 3300009036 Unclassified 787
149 Ga0105240_10783155 3300009093 Bacteria 1034
150 Ga0111539_10025320 3300009094 Bacteria 7273
151 Ga0111539_10092950 3300009094 Bacteria 3543
152 Ga0111539_10095587 3300009094 Bacteria 3490
153 Ga0111539_10252700 3300009094 Bacteria 2052
154 Ga0111539_10475687 3300009094 Bacteria 1455
155 Ga0111539_11852869 3300009094 Bacteria 699
156 Ga0105245_10008737 3300009098 Bacteria 8832
157 Ga0105245_10073048 3300009098 Bacteria 3118
158 Ga0105245_10304540 3300009098 Bacteria 1565
159 Ga0105245_10420586 3300009098 Bacteria 1339
160 Ga0105245_10835302 3300009098 Bacteria 961
161 Ga0114129_10000284 3300009147 Bacteria 58368
162 Ga0114129_10047658 3300009147 Bacteria 6021
163 Ga0114129_10103676 3300009147 Bacteria 3932
164 Ga0114129_10173777 3300009147 Bacteria 2935
165 Ga0114129_10390017 3300009147 Bacteria 1837
166 Ga0105243_10003166 3300009148 Bacteria 13500
167 Ga0105243_10027348 3300009148 Bacteria 4370
168 Ga0105241_10128859 3300009174 Bacteria 2046
169 Ga0105241_10477661 3300009174 Bacteria 1107
170 Ga0105242_10071488 3300009176 Bacteria 2879
171 Ga0105242_10269294 3300009176 Bacteria 1542
172 Ga0105242_11139563 3300009176 Unclassified 796
173 Ga0105248_10137922 3300009177 Bacteria 2752
174 Ga0105248_10396341 3300009177 Bacteria 1554
175 Ga0105248_10946622 3300009177 Bacteria 973
176 Ga0105249_10002057 3300009553 Bacteria 17453
177 Ga0105249_10086290 3300009553 Bacteria 2927
178 Ga0105239_10157804 3300010375 Bacteria 2534
179 Ga0105239_10437602 3300010375 Bacteria 1483
180 Ga0105239_10610036 3300010375 Bacteria 1245
181 Ga0105239_11097016 3300010375 Bacteria 916
182 Ga0105246_10239107 3300011119 Bacteria 1434
183 Ga0157373_10647704 3300013100 Bacteria 771
184 Ga0157378_10061860 3300013297 Bacteria 3343
185 Ga0157378_10625073 3300013297 Bacteria 1090
186 Ga0157378_10626550 3300013297 Bacteria 1089
187 Ga0157378_11018453 3300013297 Bacteria 863
188 Ga0157378_11635054 3300013297 Bacteria 690
189 Ga0157372_11272373 3300013307 Unclassified 849
190 Ga0157375_10009572 3300013308 Bacteria 8509
191 Ga0157375_10061645 3300013308 Bacteria 3725
192 Ga0163163_10017918 3300014325 Bacteria 6615
193 Ga0163163_10073033 3300014325 Bacteria 3421
194 Ga0163163_10093615 3300014325 Bacteria 3022
195 Ga0163163_10567456 3300014325 Bacteria 1198
196 Ga0157380_10070137 3300014326 Bacteria 2831
197 Ga0157380_10171359 3300014326 Bacteria 1897
198 Ga0157380_10411225 3300014326 Bacteria 1287
199 Ga0157380_10441123 3300014326 Bacteria 1248
200 Ga0157380_10494579 3300014326 Bacteria 1186
201 Ga0157377_10003810 3300014745 Bacteria 6853
202 Ga0157377_10040447 3300014745 Bacteria 2581
203 Ga0157379_10063420 3300014968 Bacteria 3304
204 Ga0157379_10092914 3300014968 Bacteria 2706
205 Ga0157379_10233887 3300014968 Bacteria 1666
206 Ga0157379_11262185 3300014968 Bacteria 712
207 Ga0157376_10020479 3300014969 Bacteria 5116
208 Ga0157376_10631751 3300014969 Bacteria 1069
209 Ga0163161_10107816 3300017792 Bacteria 2079
210 Ga0163161_10247729 3300017792 Bacteria 1388
211 Ga0163161_10442497 3300017792 Bacteria 1049
212 Ga0207653_10058058 3300025885 Bacteria 1300
213 Ga0207710_10096255 3300025900 Bacteria 1392
214 Ga0207710_10261134 3300025900 Bacteria 868
215 Ga0207688_10013155 3300025901 Bacteria 4498
216 Ga0207688_10069388 3300025901 Bacteria 1997
217 Ga0207643_10000734 3300025908 Bacteria 20132
218 Ga0207684_10001815 3300025910 Bacteria 22316
219 Ga0207684_10003234 3300025910 Bacteria 15988
220 Ga0207684_10019084 3300025910 Bacteria 5866
221 Ga0207707_10293859 3300025912 Bacteria 1405
222 Ga0207671_10273905 3300025914 Unclassified 1330
223 Ga0207660_10372310 3300025917 Bacteria 1147
224 Ga0207662_10003061 3300025918 Bacteria 8536
225 Ga0207657_10020750 3300025919 Bacteria 6201
226 Ga0207649_10099118 3300025920 Bacteria 1924
227 Ga0207652_10026712 3300025921 Bacteria 4811
228 Ga0207646_10002040 3300025922 Bacteria 24260
229 Ga0207646_10075292 3300025922 Bacteria 3016
230 Ga0207646_10244885 3300025922 Bacteria 1619
231 Ga0207646_10248327 3300025922 Bacteria 1607
232 Ga0207681_10091323 3300025923 Bacteria 2175
233 Ga0207650_10027894 3300025925 Bacteria 4044
234 Ga0207659_10196439 3300025926 Bacteria 1608
235 Ga0207659_10267653 3300025926 Bacteria 1393
236 Ga0207659_10532113 3300025926 Unclassified 997
237 Ga0207687_10114308 3300025927 Bacteria 2009
238 Ga0207687_10184582 3300025927 Bacteria 1618
239 Ga0207687_10337658 3300025927 Bacteria 1224
240 Ga0207687_11044894 3300025927 Bacteria 701
241 Ga0207644_10471710 3300025931 Bacteria 1033
242 Ga0207690_10300562 3300025932 Bacteria 1256
243 Ga0207706_10003959 3300025933 Bacteria 14038
244 Ga0207706_10052907 3300025933 Bacteria 3585
245 Ga0207706_10058570 3300025933 Bacteria 3393
246 Ga0207686_10661455 3300025934 Unclassified 827
247 Ga0207709_10124814 3300025935 Bacteria 1744
248 Ga0207709_10289894 3300025935 Bacteria 1213
249 Ga0207670_10490309 3300025936 Bacteria 996
250 Ga0207670_10620475 3300025936 Bacteria 889
251 Ga0207669_10012703 3300025937 Bacteria 4150
252 Ga0207669_10467981 3300025937 Bacteria 1002
253 Ga0207704_10166078 3300025938 Bacteria 1577
254 Ga0207704_10174408 3300025938 Unclassified 1546
255 Ga0207665_10246527 3300025939 Bacteria 1318
256 Ga0207691_10005553 3300025940 Bacteria 12181
257 Ga0207711_10284008 3300025941 Bacteria 1524
258 Ga0207711_10284528 3300025941 Bacteria 1523
259 Ga0207689_10008092 3300025942 Bacteria 9171
260 Ga0207689_10086416 3300025942 Bacteria 2578
261 Ga0207689_10169302 3300025942 Bacteria 1800
262 Ga0207661_10163596 3300025944 Bacteria 1932
263 Ga0207661_10388113 3300025944 Unclassified 1264
264 Ga0207679_10065147 3300025945 Bacteria 2726
265 Ga0207679_10722864 3300025945 Bacteria 905
266 Ga0207667_10294198 3300025949 Bacteria 1659
267 Ga0207667_10879245 3300025949 Unclassified 889
268 Ga0207651_10136473 3300025960 Bacteria 1888
269 Ga0207712_10053493 3300025961 Bacteria 2833
270 Ga0207640_10286371 3300025981 Bacteria 1297
271 Ga0207677_10768197 3300026023 Bacteria 860
272 Ga0207703_10071583 3300026035 Bacteria 2864
273 Ga0207703_10254580 3300026035 Bacteria 1584
274 Ga0207703_10620835 3300026035 Bacteria 1024
275 Ga0207639_10552509 3300026041 Bacteria 1057
276 Ga0207678_10015048 3300026067 Bacteria 6807
277 Ga0207708_10033120 3300026075 Bacteria 3925
278 Ga0207641_10059913 3300026088 Bacteria 3244
279 Ga0207648_10005522 3300026089 Bacteria 12744
280 Ga0207676_10263001 3300026095 Bacteria 1559
281 Ga0207674_10016505 3300026116 Bacteria 8081
282 Ga0207675_100069811 3300026118 Bacteria 3283
283 Ga0207675_100124137 3300026118 Bacteria 2445
284 Ga0207675_100171134 3300026118 Bacteria 2076
285 Ga0207675_100269961 3300026118 Bacteria 1651
286 Ga0207675_100362448 3300026118 Bacteria 1422
287 Ga0207683_10002834 3300026121 Bacteria 15147
288 Ga0207683_10016440 3300026121 Bacteria 6298
289 Ga0207683_10864235 3300026121 Bacteria 840
290 Ga0209971_1050747 3300027682 Bacteria 1002
291 Ga0209974_10013188 3300027876 Bacteria 2755
292 Ga0207428_10290365 3300027907 Bacteria 1212
293 Ga0207428_10428089 3300027907 Bacteria 967
294 Ga0268265_10332657 3300028380 Bacteria 1380
295 Ga0268264_10109556 3300028381 Bacteria 2416
296 Ga0268264_10424871 3300028381 Bacteria 1282
297 Ga0265326_10000291 3300028558 Bacteria 22534
298 Ga0265326_10013363 3300028558 Bacteria 2403
299 Ga0265319_1001290 3300028563 Bacteria 15174
300 Ga0265319_1022789 3300028563 Unclassified 2276
301 Ga0265334_10037245 3300028573 Unclassified 1918
302 Ga0265318_10065413 3300028577 Bacteria 1352
303 Ga0265323_10013542 3300028653 Unclassified 3250
304 Ga0265322_10001138 3300028654 Bacteria 9127
305 Ga0265336_10021208 3300028666 Bacteria 2079
306 Ga0265336_10044160 3300028666 Unclassified 1356
307 Ga0265338_10248077 3300028800 Bacteria 1315
308 Ga0265324_10029457 3300029957 Unclassified 1930
309 Ga0265330_10030110 3300031235 Bacteria 2439
310 Ga0265330_10034739 3300031235 Bacteria 2251
311 Ga0265328_10040606 3300031239 Bacteria 1714
312 Ga0265328_10045030 3300031239 Bacteria 1623
313 Ga0265320_10004467 3300031240 Bacteria 9165
314 Ga0265320_10025017 3300031240 Bacteria 3146
315 Ga0265320_10235412 3300031240 Bacteria 814
316 Ga0265329_10008843 3300031242 Bacteria 3795
317 Ga0265329_10016753 3300031242 Bacteria 2534
318 Ga0265339_10023457 3300031249 Bacteria 3566
319 Ga0265339_10151989 3300031249 Bacteria 1170
320 Ga0265331_10018690 3300031250 Bacteria 3588
321 Ga0265316_10002000 3300031344 Bacteria 21468
322 Ga0265316_10117610 3300031344 Bacteria 2009
323 Ga0307408_100070444 3300031548 Bacteria 2582
324 Ga0307408_100226670 3300031548 Bacteria 1528
325 Ga0265313_10112525 3300031595 Bacteria 1195
326 Ga0265314_10013946 3300031711 Bacteria 6463
327 Ga0265314_10034206 3300031711 Bacteria 3717
328 Ga0265314_10163869 3300031711 Bacteria 1350
329 Ga0265342_10173989 3300031712 Bacteria 1182
330 Ga0307413_10238855 3300031824 Bacteria 1340
331 Ga0307413_10281120 3300031824 Bacteria 1252
332 Ga0307413_10351387 3300031824 Unclassified 1138
333 Ga0307406_10573816 3300031901 Bacteria 926
334 Ga0307406_10734219 3300031901 Bacteria 827
335 Ga0307407_10111049 3300031903 Unclassified 1721
336 Ga0307407_10380175 3300031903 Bacteria 1008
337 Ga0307409_100333177 3300031995 Bacteria 1425
338 Ga0307416_100001675 3300032002 Bacteria 12248
339 Ga0307416_101287420 3300032002 Bacteria 837
340 Ga0307411_10099471 3300032005 Bacteria 2053
341 Ga0307411_10274882 3300032005 Bacteria 1338
342 Ga0307415_100001929 3300032126 Bacteria 10209
343 Ga0307415_100219903 3300032126 Bacteria 1522
344 Ga0307415_101170403 3300032126 Bacteria 723
345 Ga0373928_0051826 3300035084 Unclassified 971
346 Ga0373929_0019559 3300035085 Unclassified 1357
347 Ga0373960_0004856 3300035121 Bacteria 3095
348 Ga0373943_0109890 3300035170 Bacteria 1453
349 Ga0373946_0034158 3300035171 Bacteria 2052
350 Ga0373946_0088300 3300035171 Bacteria 1370
351 Ga0373962_0014623 3300035242 Bacteria 2002
352 Ga0373931_0044916 3300035691 Bacteria 2331
353 Ga0373931_0436998 3300035691 Unclassified 835
354 Ga0373935_0312623 3300035692 Bacteria 1113
355 Ga0373947_0225725 3300035725 Bacteria 1232
356 Ga0395905_0212179 3300037471 Bacteria 1814
357 Ga0395901_0609850 3300038443 Bacteria 1100
358 Ga0242420_065179 3300038996 Bacteria 733
359 Ga0451787_384929 3300041441 Bacteria 871
360 Ga0451853_4090504 3300041512 Unclassified 800
361 Ga0439431_0041789 3300041997 Bacteria 1170
362 Ga0450922_021512 3300042124 Bacteria 667
363 Ga0450910_008771 3300042147 Bacteria 1426
364 Ga0450910_023468 3300042147 Bacteria 943
365 Ga0439446_0185851 3300042156 Bacteria 696
366 Ga0450909_017663 3300042185 Bacteria 1057
367 Ga0439434_0291475 3300042435 Bacteria 563
368 Ga0450916_011925 3300042530 Bacteria 1104
369 Ga0466972_0250674 3300044658 Unclassified 828
370 Ga0451576_0416067 3300045051 Bacteria 1410
371 Ga0495603_0037085 3300046455 Bacteria 2925
372 Ga0495590_0066322 3300046457 Bacteria 1264
373 Ga0495608_0188778 3300046511 Bacteria 1302
374 Ga0495628_0286219 3300046516 Bacteria 1223
375 Ga0495628_0486396 3300046516 Unclassified 893
376 Ga0495630_0122169 3300046517 Bacteria 1976
377 Ga0495630_0603908 3300046517 Unclassified 841
378 Ga0495630_0718304 3300046517 Unclassified 764
379 Ga0495652_0680388 3300046529 Unclassified 694
380 Ga0495586_0138771 3300046535 Bacteria 1364
381 Ga0495667_0349507 3300046559 Bacteria 934
382 Ga0495656_0322479 3300046615 Bacteria 796
383 Ga0495657_0105669 3300046675 Bacteria 1789
384 Ga0495647_0084853 3300046681 Bacteria 1290
385 Ga0495624_0257980 3300046690 Bacteria 1054
386 Ga0495600_0311174 3300046809 Bacteria 992
387 Ga0495581_0445194 3300047315 Unclassified 755
388 Ga0495604_0267965 3300047317 Bacteria 1158
389 Ga0495676_0198851 3300047321 Bacteria 1394
390 Ga0495602_0865318 3300048088 Unclassified 603
391 Ga0496100_0076964 3300048903 Bacteria 2242
392 Ga0496101_0136015 3300048904 Bacteria 1870
393 Ga0496101_0203501 3300048904 Bacteria 1531
394 Ga0496101_0229529 3300048904 Bacteria 1442
395 Ga0496101_0285031 3300048904 Bacteria 1292
396 Ga0496101_0345935 3300048904 Bacteria 1168
397 Ga0496102_0008347 3300048905 Bacteria 8868
398 Ga0496102_0188119 3300048905 Bacteria 1946
399 Ga0496102_0521117 3300048905 Bacteria 1111
400 Ga0496102_0621273 3300048905 Bacteria 1004
401 Ga0496102_0980557 3300048905 Bacteria 766
402 Ga0496103_0002033 3300048906 Bacteria 12984
403 Ga0496103_0018876 3300048906 Bacteria 4141
404 Ga0496103_0235382 3300048906 Bacteria 1178
405 Ga0496104_0061891 3300048907 Bacteria 3548
406 Ga0496104_0068559 3300048907 Bacteria 3371
407 Ga0496104_0068589 3300048907 Bacteria 3370
408 Ga0496104_0693820 3300048907 Bacteria 926
409 Ga0496105_0011371 3300048908 Bacteria 7031
410 Ga0496105_0012889 3300048908 Bacteria 6625
411 Ga0496105_0057535 3300048908 Bacteria 3210
412 Ga0496106_0043335 3300048909 Bacteria 3376
413 Ga0496106_0083354 3300048909 Bacteria 2459
414 Ga0496106_0199133 3300048909 Bacteria 1594
415 Ga0496106_0375078 3300048909 Bacteria 1143
416 Ga0496107_0065723 3300048910 Bacteria 2630
417 Ga0496107_0151977 3300048910 Bacteria 1713
418 Ga0496107_0170958 3300048910 Unclassified 1613
419 Ga0496107_0898110 3300048910 Bacteria 646
420 Ga0496108_0017035 3300048911 Bacteria 5940
421 Ga0496108_0088749 3300048911 Bacteria 2627
422 Ga0496108_0196383 3300048911 Bacteria 1750
423 Ga0496108_0213947 3300048911 Bacteria 1673
424 Ga0496109_0028733 3300048912 Bacteria 4977
425 Ga0496109_0039547 3300048912 Bacteria 4269
426 Ga0496109_0047743 3300048912 Bacteria 3894
427 Ga0496109_0076007 3300048912 Bacteria 3089
428 Ga0496109_0099777 3300048912 Bacteria 2693
429 Ga0496110_0074993 3300048913 Bacteria 3005
430 Ga0496110_0414222 3300048913 Bacteria 1228
431 Ga0496111_0013108 3300048914 Bacteria 5631
432 Ga0496111_0056139 3300048914 Bacteria 2849
433 Ga0496111_0062880 3300048914 Bacteria 2692
434 Ga0496112_0077079 3300048915 Bacteria 3296
435 Ga0496112_0203754 3300048915 Bacteria 1937
436 Ga0496112_0282167 3300048915 Bacteria 1608
437 Ga0496112_0513636 3300048915 Bacteria 1133
438 Ga0496112_0531790 3300048915 Unclassified 1110
439 Ga0496112_1317866 3300048915 Unclassified 637
440 Ga0496113_0007201 3300048916 Bacteria 7128
441 Ga0496113_0012067 3300048916 Bacteria 5796
442 Ga0496113_0026928 3300048916 Bacteria 4115
443 Ga0496114_0013269 3300048917 Bacteria 6604
444 Ga0496114_0534741 3300048917 Unclassified 1036
445 Ga0501031_0021753 3300049568 Bacteria 4180
446 Ga0501031_0031721 3300049568 Bacteria 3447
447 Ga0501032_0016699 3300049569 Bacteria 5159
448 Ga0501033_0147638 3300049570 Bacteria 1698
449 Ga0501033_0181132 3300049570 Bacteria 1510
450 Ga0501036_0020433 3300049572 Bacteria 5563
451 Ga0501036_0130056 3300049572 Bacteria 2126
452 Ga0501036_0214634 3300049572 Unclassified 1616
453 Ga0501037_0375413 3300049573 Bacteria 978
454 Ga0501038_0013883 3300049574 Bacteria 7340
455 Ga0501038_0068464 3300049574 Bacteria 3017
456 Ga0501038_0684552 3300049574 Bacteria 770
457 Ga0501039_0035137 3300049575 Bacteria 3868
458 Ga0501039_0095209 3300049575 Bacteria 2321
459 Ga0501039_0212720 3300049575 Bacteria 1520
460 Ga0501039_0411848 3300049575 Bacteria 1062
461 Ga0501039_1195386 3300049575 Bacteria 588
462 Ga0501040_0122212 3300049576 Bacteria 1827
463 Ga0501040_0487024 3300049576 Unclassified 889
464 Ga0501041_0016420 3300049577 Bacteria 4401
465 Ga0501041_0022839 3300049577 Bacteria 3747
466 Ga0501041_0128460 3300049577 Bacteria 1579
467 Ga0501041_0211088 3300049577 Bacteria 1218
468 Ga0501041_0290655 3300049577 Bacteria 1029
469 Ga0501041_0322272 3300049577 Unclassified 975
470 Ga0501041_0987328 3300049577 Archaea 542
471 Ga0501042_0055355 3300049578 Bacteria 2830
472 Ga0501042_0117278 3300049578 Bacteria 1917
473 Ga0501042_0291728 3300049578 Bacteria 1178
474 Ga0501042_0292220 3300049578 Bacteria 1177
475 Ga0501043_0229186 3300049579 Bacteria 1435
476 Ga0501046_0019112 3300049580 Bacteria 5684
477 Ga0501046_0023036 3300049580 Bacteria 5127
478 Ga0501046_0042680 3300049580 Bacteria 3615
479 Ga0501046_0195742 3300049580 Bacteria 1506
480 Ga0501048_0063220 3300049582 Bacteria 2618
481 Ga0501048_0094264 3300049582 Bacteria 2111
482 Ga0501048_0213120 3300049582 Bacteria 1370
483 Ga0501048_0216482 3300049582 Bacteria 1358
484 Ga0501067_0030478 3300049583 Bacteria 2991
485 Ga0501067_0065658 3300049583 Bacteria 2009
486 Ga0501067_0068235 3300049583 Bacteria 1969
487 Ga0501067_0079266 3300049583 Bacteria 1820
488 Ga0501067_0183029 3300049583 Bacteria 1167
489 Ga0501068_0002549 3300049584 Bacteria 9671
490 Ga0501068_0007237 3300049584 Bacteria 6144
491 Ga0501068_0021389 3300049584 Bacteria 3776
492 Ga0501068_0243279 3300049584 Bacteria 1145
493 Ga0501068_0491005 3300049584 Unclassified 796
494 Ga0501069_0053964 3300049585 Bacteria 2238
495 Ga0501069_0093560 3300049585 Bacteria 1701
496 Ga0501069_0159598 3300049585 Bacteria 1298
497 Ga0501069_0164338 3300049585 Bacteria 1279
498 Ga0501069_0215444 3300049585 Bacteria 1115
499 Ga0501070_0255025 3300049586 Bacteria 1434
500 Ga0501071_0154867 3300049587 Bacteria 1711
501 Ga0501071_0156282 3300049587 Bacteria 1703
502 Ga0501071_0159068 3300049587 Bacteria 1688
503 Ga0501071_0206327 3300049587 Bacteria 1477
504 Ga0501071_0312381 3300049587 Bacteria 1193
505 Ga0501072_0040664 3300049588 Bacteria 3651
506 Ga0501072_0074931 3300049588 Bacteria 2676
507 Ga0501072_0116329 3300049588 Bacteria 2129
508 Ga0501072_0180458 3300049588 Bacteria 1684
509 Ga0501072_0212875 3300049588 Bacteria 1540
510 Ga0501072_0216762 3300049588 Bacteria 1525
511 Ga0501072_0360076 3300049588 Bacteria 1155
512 Ga0501072_0421852 3300049588 Bacteria 1057
513 Ga0501074_0039909 3300049590 Bacteria 3399
514 Ga0501074_0071903 3300049590 Bacteria 2486
515 Ga0501074_0160916 3300049590 Bacteria 1603
516 Ga0501074_0449150 3300049590 Unclassified 914
517 Ga0501075_0173753 3300049591 Bacteria 1644
518 Ga0501075_0535755 3300049591 Bacteria 893
519 Ga0501075_0660668 3300049591 Bacteria 797
520 Ga0501076_0066706 3300049592 Bacteria 2872
521 Ga0501076_0080829 3300049592 Bacteria 2609
522 Ga0501076_0082416 3300049592 Bacteria 2582
523 Ga0501076_0089436 3300049592 Unclassified 2475
524 Ga0501076_0093880 3300049592 Bacteria 2415
525 Ga0501076_0119563 3300049592 Unclassified 2133
526 Ga0501077_0077880 3300049593 Bacteria 2100
527 Ga0501077_0201253 3300049593 Bacteria 1265
528 Ga0501077_0266952 3300049593 Bacteria 1088
529 Ga0501217_087382 3300049661 Bacteria 871
530 Ga0501217_164003 3300049661 Unclassified 672
531 Ga0501079_0006849 3300049741 Bacteria 8582
532 Ga0501079_0037656 3300049741 Bacteria 3728
533 Ga0501079_0081762 3300049741 Bacteria 2498
534 Ga0501079_0100711 3300049741 Bacteria 2240
535 Ga0501079_0244893 3300049741 Bacteria 1401
536 Ga0501079_0277342 3300049741 Bacteria 1311
537 Ga0501079_0532975 3300049741 Bacteria 923
538 Ga0501080_0023713 3300049742 Bacteria 5685
539 Ga0501080_0093534 3300049742 Bacteria 2791
540 Ga0501080_0299454 3300049742 Bacteria 1459
541 Ga0501081_0017270 3300049743 Bacteria 4773
542 Ga0501081_0020280 3300049743 Bacteria 4430
543 Ga0501081_0064302 3300049743 Bacteria 2548
544 Ga0501081_0128984 3300049743 Unclassified 1806
545 Ga0501081_0213626 3300049743 Bacteria 1401
546 Ga0501081_0623977 3300049743 Bacteria 807
547 Ga0501083_0794306 3300049744 Bacteria 616
548 Ga0501035_0017110 3300049822 Bacteria 6680
549 Ga0501044_0097235 3300049823 Bacteria 2966
550 Ga0501045_0032864 3300049824 Bacteria 3760
551 Ga0501045_0066401 3300049824 Bacteria 2649
552 Ga0501045_0086735 3300049824 Bacteria 2310
553 Ga0501045_0387050 3300049824 Unclassified 1041
554 Ga0501045_0467553 3300049824 Bacteria 937
555 nmdc:mga0yw44_430418_c1 3300050492 Bacteria 894
556 nmdc:mga05p37_156051_c1 3300050507 Bacteria 2789
557 nmdc:mga05p37_158794_c1 3300050507 Bacteria 2762
558 nmdc:mga05p37_270506_c1 3300050507 Bacteria 2031
559 nmdc:mga05p37_335160_c1 3300050507 Bacteria 1785
560 nmdc:mga05p37_7_c1 3300050507 Bacteria 154761
561 nmdc:mga06r32_140429_c1 3300050510 Bacteria 2391
562 nmdc:mga06r32_914343_c1 3300050510 Unclassified 833
563 nmdc:mga08y16_211442_c1 3300050511 Bacteria 2009
564 nmdc:mga08y16_219891_c1 3300050511 Bacteria 1966
565 nmdc:mga08y16_42127_c1 3300050511 Bacteria 4782
566 nmdc:mga08y16_439173_c1 3300050511 Bacteria 1332
567 nmdc:mga08y16_692615_c1 3300050511 Unclassified 1020
568 nmdc:mga0n895_1638733_c1 3300050512 Bacteria 607
569 nmdc:mga0n895_164390_c1 3300050512 Bacteria 2251
570 nmdc:mga0rr50_38433_c1 3300050513 Bacteria 3463
571 nmdc:mga0rr50_608307_c1 3300050513 Bacteria 932
572 nmdc:mga08x19_463748_c1 3300050514 Bacteria 892
573 nmdc:mga0a205_211324_c1 3300050515 Bacteria 1828
574 nmdc:mga0a205_275345_c1 3300050515 Bacteria 1559
575 nmdc:mga0a205_31083_c1 3300050515 Bacteria 5114
576 nmdc:mga0a205_358022_c1 3300050515 Bacteria 1326
577 Ga0495601_0053194 3300053077 Bacteria 2559
578 Ga0495612_0000134 3300053078 Bacteria 31375
579 Ga0495619_0090516 3300053085 Unclassified 2071
580 Ga0495619_0107355 3300053085 Bacteria 1904
581 Ga0501084_0008534 3300054114 Bacteria 8470
582 Ga0501084_0030157 3300054114 Bacteria 4536
583 Ga0501084_0078401 3300054114 Bacteria 2769
584 Ga0501084_0236690 3300054114 Bacteria 1541
585 Ga0501084_0648717 3300054114 Bacteria 891
586 Ga0501084_0705784 3300054114 Bacteria 851
587 Ga0501084_1103315 3300054114 Unclassified 666
588 Ga0590071_017631 3300059421 Bacteria 1677
589 Ga0501082_0056892 3300060353 Bacteria 3369
590 Ga0501082_0073305 3300060353 Bacteria 2949
591 Ga0501082_0235907 3300060353 Bacteria 1592
592 Ga0530510_0004363 3300061734 Bacteria 9791
593 Ga0530510_0049351 3300061734 Bacteria 3041
594 Ga0530510_0059661 3300061734 Bacteria 2760
595 Ga0530510_0134920 3300061734 Bacteria 1817
596 Ga0530510_0174829 3300061734 Bacteria 1591
597 Ga0530510_0507098 3300061734 Bacteria 915
598 Ga0530510_0865119 3300061734 Unclassified 690
599 Ga0501068_0213666
600 JGI25406J46586_10025699
601 rootH1_10043816
602 Ga0070683_100016244
603 Ga0070683_100322687
604 Ga0070690_100022718
605 Ga0070670_100012100
606 Ga0068869_100053762
607 Ga0068869_100250045
608 Ga0070680_100309641
609 Ga0070682_100013485
610 Ga0068868_100036277
611 Ga0068868_100523069
612 Ga0070660_100010582
613 Ga0070689_100013293
614 Ga0070689_100774606
615 Ga0070689_100905540
616 Ga0070691_10164182
617 Ga0070687_100001413
618 Ga0070687_100194388
619 Ga0070687_100522227
620 Ga0070661_100028182
621 Ga0070669_100054523
622 Ga0070675_100037426
623 Ga0070675_100601608
624 Ga0070675_101315688
625 Ga0070674_100002898
626 Ga0070674_100053466
627 Ga0070674_100551593
628 Ga0070673_100033947
629 Ga0070673_100059363
630 Ga0070688_100377142
631 Ga0070659_100007017
632 Ga0070659_100093187
633 Ga0070659_100490663
634 Ga0070701_10070177
635 Ga0070705_100028330
636 Ga0070705_100051334
637 Ga0070705_100096922
638 Ga0070705_100184356
639 Ga0070700_100019750
640 Ga0070700_100275271
641 Ga0070694_100002236
642 Ga0070694_100405092
643 Ga0070694_100608195
644 Ga0070708_100013236
645 Ga0070708_100028405
646 Ga0070708_100062015
647 Ga0070708_100560973
648 Ga0070708_100911699
649 Ga0070663_100016880
650 Ga0070678_100012307
651 Ga0070678_100038878
652 Ga0070678_100360840
653 Ga0070662_100015903
654 Ga0070681_10153348
655 Ga0070681_10613195
656 Ga0068867_100009671
657 Ga0070706_100000919
658 Ga0070706_100011739
659 Ga0070706_100034729
660 Ga0070707_100002815
661 Ga0070707_100239789
662 Ga0070707_100444222
663 Ga0070707_100740012
664 Ga0070698_100072187
665 Ga0070698_100228104
666 Ga0070698_100384656
667 Ga0070699_100001063
668 Ga0070699_100408300
669 Ga0070699_100553431
670 Ga0070699_100880347
671 Ga0070679_100359716
672 Ga0070684_100020136
673 Ga0070684_100032615
674 Ga0070684_101063619
675 Ga0070697_100021331
676 Ga0070697_100024387
677 Ga0068853_100319893
678 Ga0070672_100016014
679 Ga0070686_100257935
680 Ga0070686_100280811
681 Ga0070686_100366462
682 Ga0070695_100016974
683 Ga0070695_100119061
684 Ga0070695_100294939
685 Ga0070695_100514126
686 Ga0070696_100043654
687 Ga0070696_100119231
688 Ga0070696_100157937
689 Ga0070696_100307281
690 Ga0070696_100420863
691 Ga0070693_100281344
692 Ga0070693_100316075
693 Ga0070693_100318308
694 Ga0070704_100295715
695 Ga0068855_100124433
696 Ga0068855_100756246
697 Ga0068855_101056337
698 Ga0070664_100336924
699 Ga0068857_100016620
700 Ga0068854_100280704
701 Ga0068854_100606919
702 Ga0068854_100785321
703 Ga0068856_100509189
704 Ga0070702_100010497
705 Ga0070702_100141465
706 Ga0070702_100197217
707 Ga0068859_100011193
708 Ga0068864_100091736
709 Ga0068861_100057765
710 Ga0068861_100214585
711 Ga0068870_10001460
712 Ga0068870_10132652
713 Ga0068870_10338900
714 Ga0068863_100383398
715 Ga0068858_100029152
716 Ga0068858_100062427
717 Ga0068858_100721335
718 Ga0068858_100856410
719 Ga0068860_100363199
720 Ga0068860_100505081
721 Ga0068862_100515664
722 Ga0081538_10242295
723 Ga0081539_10001388
724 Ga0081539_10003192
725 Ga0097621_100095580
726 Ga0068871_100405209
727 Ga0068871_100519779
728 Ga0075428_100000081
729 Ga0075428_100111995
730 Ga0075428_100257202
731 Ga0075428_101390996
732 Ga0075431_100051209
733 Ga0075433_10155862
734 Ga0075433_10231222
735 Ga0075433_10372601
736 Ga0075433_10764794
737 Ga0075434_100133872
738 Ga0075434_100500007
739 Ga0075434_100531451
740 Ga0068865_100002193
741 Ga0068865_100190441
742 Ga0075436_100515506
743 Ga0097620_100011194
744 Ga0075435_100135492
745 Ga0075435_100314940
746 Ga0105244_10271710
747 Ga0105240_10783155
748 Ga0111539_10025320
749 Ga0111539_10092950
750 Ga0111539_10095587
751 Ga0111539_10252700
752 Ga0111539_10475687
753 Ga0111539_11852869
754 Ga0105245_10008737
755 Ga0105245_10073048
756 Ga0105245_10304540
757 Ga0105245_10420586
758 Ga0105245_10835302
759 Ga0114129_10000284
760 Ga0114129_10047658
761 Ga0114129_10103676
762 Ga0114129_10173777
763 Ga0114129_10390017
764 Ga0105243_10003166
765 Ga0105243_10027348
766 Ga0105241_10128859
767 Ga0105241_10477661
768 Ga0105242_10071488
769 Ga0105242_10269294
770 Ga0105242_11139563
771 Ga0105248_10137922
772 Ga0105248_10396341
773 Ga0105248_10946622
774 Ga0105249_10002057
775 Ga0105249_10086290
776 Ga0105239_10157804
777 Ga0105239_10437602
778 Ga0105239_10610036
779 Ga0105239_11097016
780 Ga0105246_10239107
781 Ga0157373_10647704
782 Ga0157378_10061860
783 Ga0157378_10625073
784 Ga0157378_10626550
785 Ga0157378_11018453
786 Ga0157378_11635054
787 Ga0157372_11272373
788 Ga0157375_10009572
789 Ga0157375_10061645
790 Ga0163163_10017918
791 Ga0163163_10073033
792 Ga0163163_10093615
793 Ga0163163_10567456
794 Ga0157380_10070137
795 Ga0157380_10171359
796 Ga0157380_10411225
797 Ga0157380_10441123
798 Ga0157380_10494579
799 Ga0157377_10003810
800 Ga0157377_10040447
801 Ga0157379_10063420
802 Ga0157379_10092914
803 Ga0157379_10233887
804 Ga0157379_11262185
805 Ga0157376_10020479
806 Ga0157376_10631751
807 Ga0163161_10107816
808 Ga0163161_10247729
809 Ga0163161_10442497
810 Ga0207653_10058058
811 Ga0207710_10096255
812 Ga0207710_10261134
813 Ga0207688_10013155
814 Ga0207688_10069388
815 Ga0207643_10000734
816 Ga0207684_10001815
817 Ga0207684_10003234
818 Ga0207684_10019084
819 Ga0207707_10293859
820 Ga0207671_10273905
821 Ga0207660_10372310
822 Ga0207662_10003061
823 Ga0207657_10020750
824 Ga0207649_10099118
825 Ga0207652_10026712
826 Ga0207646_10002040
827 Ga0207646_10075292
828 Ga0207646_10244885
829 Ga0207646_10248327
830 Ga0207681_10091323
831 Ga0207650_10027894
832 Ga0207659_10196439
833 Ga0207659_10267653
834 Ga0207659_10532113
835 Ga0207687_10114308
836 Ga0207687_10184582
837 Ga0207687_10337658
838 Ga0207687_11044894
839 Ga0207644_10471710
840 Ga0207690_10300562
841 Ga0207706_10003959
842 Ga0207706_10052907
843 Ga0207706_10058570
844 Ga0207686_10661455
845 Ga0207709_10124814
846 Ga0207709_10289894
847 Ga0207670_10490309
848 Ga0207670_10620475
849 Ga0207669_10012703
850 Ga0207669_10467981
851 Ga0207704_10166078
852 Ga0207704_10174408
853 Ga0207665_10246527
854 Ga0207691_10005553
855 Ga0207711_10284008
856 Ga0207711_10284528
857 Ga0207689_10008092
858 Ga0207689_10086416
859 Ga0207689_10169302
860 Ga0207661_10163596
861 Ga0207661_10388113
862 Ga0207679_10065147
863 Ga0207679_10722864
864 Ga0207667_10294198
865 Ga0207667_10879245
866 Ga0207651_10136473
867 Ga0207712_10053493
868 Ga0207640_10286371
869 Ga0207677_10768197
870 Ga0207703_10071583
871 Ga0207703_10254580
872 Ga0207703_10620835
873 Ga0207639_10552509
874 Ga0207678_10015048
875 Ga0207708_10033120
876 Ga0207641_10059913
877 Ga0207648_10005522
878 Ga0207676_10263001
879 Ga0207674_10016505
880 Ga0207675_100069811
881 Ga0207675_100124137
882 Ga0207675_100171134
883 Ga0207675_100269961
884 Ga0207675_100362448
885 Ga0207683_10002834
886 Ga0207683_10016440
887 Ga0207683_10864235
888 Ga0209971_1050747
889 Ga0209974_10013188
890 Ga0207428_10290365
891 Ga0207428_10428089
892 Ga0268265_10332657
893 Ga0268264_10109556
894 Ga0268264_10424871
895 Ga0265326_10000291
896 Ga0265326_10013363
897 Ga0265319_1001290
898 Ga0265319_1022789
899 Ga0265334_10037245
900 Ga0265318_10065413
901 Ga0265323_10013542
902 Ga0265322_10001138
903 Ga0265336_10021208
904 Ga0265336_10044160
905 Ga0265338_10248077
906 Ga0265324_10029457
907 Ga0265330_10030110
908 Ga0265330_10034739
909 Ga0265328_10040606
910 Ga0265328_10045030
911 Ga0265320_10004467
912 Ga0265320_10025017
913 Ga0265320_10235412
914 Ga0265329_10008843
915 Ga0265329_10016753
916 Ga0265339_10023457
917 Ga0265339_10151989
918 Ga0265331_10018690
919 Ga0265316_10002000
920 Ga0265316_10117610
921 Ga0307408_100070444
922 Ga0307408_100226670
923 Ga0265313_10112525
924 Ga0265314_10013946
925 Ga0265314_10034206
926 Ga0265314_10163869
927 Ga0265342_10173989
928 Ga0307413_10238855
929 Ga0307413_10281120
930 Ga0307413_10351387
931 Ga0307406_10573816
932 Ga0307406_10734219
933 Ga0307407_10111049
934 Ga0307407_10380175
935 Ga0307409_100333177
936 Ga0307416_100001675
937 Ga0307416_101287420
938 Ga0307411_10099471
939 Ga0307411_10274882
940 Ga0307415_100001929
941 Ga0307415_100219903
942 Ga0307415_101170403
943 Ga0373928_0051826
944 Ga0373929_0019559
945 Ga0373960_0004856
946 Ga0373943_0109890
947 Ga0373946_0034158
948 Ga0373946_0088300
949 Ga0373962_0014623
950 Ga0373931_0044916
951 Ga0373931_0436998
952 Ga0373935_0312623
953 Ga0373947_0225725
954 Ga0395905_0212179
955 Ga0395901_0609850
956 Ga0242420_065179
957 Ga0451787_384929
958 Ga0451853_4090504
959 Ga0439431_0041789
960 Ga0450922_021512
961 Ga0450910_008771
962 Ga0450910_023468
963 Ga0439446_0185851
964 Ga0450909_017663
965 Ga0439434_0291475
966 Ga0450916_011925
967 Ga0466972_0250674
968 Ga0451576_0416067
969 Ga0495603_0037085
970 Ga0495590_0066322
971 Ga0495608_0188778
972 Ga0495628_0286219
973 Ga0495628_0486396
974 Ga0495630_0122169
975 Ga0495630_0603908
976 Ga0495630_0718304
977 Ga0495652_0680388
978 Ga0495586_0138771
979 Ga0495667_0349507
980 Ga0495656_0322479
981 Ga0495657_0105669
982 Ga0495647_0084853
983 Ga0495624_0257980
984 Ga0495600_0311174
985 Ga0495581_0445194
986 Ga0495604_0267965
987 Ga0495676_0198851
988 Ga0495602_0865318
989 Ga0496100_0076964
990 Ga0496101_0136015
991 Ga0496101_0203501
992 Ga0496101_0229529
993 Ga0496101_0285031
994 Ga0496101_0345935
995 Ga0496102_0008347
996 Ga0496102_0188119
997 Ga0496102_0521117
998 Ga0496102_0621273
999 Ga0496102_0980557
1000 Ga0496103_0002033
1001 Ga0496103_0018876
1002 Ga0496103_0235382
1003 Ga0496104_0061891
1004 Ga0496104_0068559
1005 Ga0496104_0068589
1006 Ga0496104_0693820
1007 Ga0496105_0011371
1008 Ga0496105_0012889
1009 Ga0496105_0057535
1010 Ga0496106_0043335
1011 Ga0496106_0083354
1012 Ga0496106_0199133
1013 Ga0496106_0375078
1014 Ga0496107_0065723
1015 Ga0496107_0151977
1016 Ga0496107_0170958
1017 Ga0496107_0898110
1018 Ga0496108_0017035
1019 Ga0496108_0088749
1020 Ga0496108_0196383
1021 Ga0496108_0213947
1022 Ga0496109_0028733
1023 Ga0496109_0039547
1024 Ga0496109_0047743
1025 Ga0496109_0076007
1026 Ga0496109_0099777
1027 Ga0496110_0074993
1028 Ga0496110_0414222
1029 Ga0496111_0013108
1030 Ga0496111_0056139
1031 Ga0496111_0062880
1032 Ga0496112_0077079
1033 Ga0496112_0203754
1034 Ga0496112_0282167
1035 Ga0496112_0513636
1036 Ga0496112_0531790
1037 Ga0496112_1317866
1038 Ga0496113_0007201
1039 Ga0496113_0012067
1040 Ga0496113_0026928
1041 Ga0496114_0013269
1042 Ga0496114_0534741
1043 Ga0501031_0021753
1044 Ga0501031_0031721
1045 Ga0501032_0016699
1046 Ga0501033_0147638
1047 Ga0501033_0181132
1048 Ga0501036_0020433
1049 Ga0501036_0130056
1050 Ga0501036_0214634
1051 Ga0501037_0375413
1052 Ga0501038_0013883
1053 Ga0501038_0068464
1054 Ga0501038_0684552
1055 Ga0501039_0035137
1056 Ga0501039_0095209
1057 Ga0501039_0212720
1058 Ga0501039_0411848
1059 Ga0501039_1195386
1060 Ga0501040_0122212
1061 Ga0501040_0487024
1062 Ga0501041_0016420
1063 Ga0501041_0022839
1064 Ga0501041_0128460
1065 Ga0501041_0211088
1066 Ga0501041_0290655
1067 Ga0501041_0322272
1068 Ga0501041_0987328
1069 Ga0501042_0055355
1070 Ga0501042_0117278
1071 Ga0501042_0291728
1072 Ga0501042_0292220
1073 Ga0501043_0229186
1074 Ga0501046_0019112
1075 Ga0501046_0023036
1076 Ga0501046_0042680
1077 Ga0501046_0195742
1078 Ga0501048_0063220
1079 Ga0501048_0094264
1080 Ga0501048_0213120
1081 Ga0501048_0216482
1082 Ga0501067_0030478
1083 Ga0501067_0065658
1084 Ga0501067_0068235
1085 Ga0501067_0079266
1086 Ga0501067_0183029
1087 Ga0501068_0002549
1088 Ga0501068_0007237
1089 Ga0501068_0021389
1090 Ga0501068_0243279
1091 Ga0501068_0491005
1092 Ga0501069_0053964
1093 Ga0501069_0093560
1094 Ga0501069_0159598
1095 Ga0501069_0164338
1096 Ga0501069_0215444
1097 Ga0501070_0255025
1098 Ga0501071_0154867
1099 Ga0501071_0156282
1100 Ga0501071_0159068
1101 Ga0501071_0206327
1102 Ga0501071_0312381
1103 Ga0501072_0040664
1104 Ga0501072_0074931
1105 Ga0501072_0116329
1106 Ga0501072_0180458
1107 Ga0501072_0212875
1108 Ga0501072_0216762
1109 Ga0501072_0360076
1110 Ga0501072_0421852
1111 Ga0501074_0039909
1112 Ga0501074_0071903
1113 Ga0501074_0160916
1114 Ga0501074_0449150
1115 Ga0501075_0173753
1116 Ga0501075_0535755
1117 Ga0501075_0660668
1118 Ga0501076_0066706
1119 Ga0501076_0080829
1120 Ga0501076_0082416
1121 Ga0501076_0089436
1122 Ga0501076_0093880
1123 Ga0501076_0119563
1124 Ga0501077_0077880
1125 Ga0501077_0201253
1126 Ga0501077_0266952
1127 Ga0501217_087382
1128 Ga0501217_164003
1129 Ga0501079_0006849
1130 Ga0501079_0037656
1131 Ga0501079_0081762
1132 Ga0501079_0100711
1133 Ga0501079_0244893
1134 Ga0501079_0277342
1135 Ga0501079_0532975
1136 Ga0501080_0023713
1137 Ga0501080_0093534
1138 Ga0501080_0299454
1139 Ga0501081_0017270
1140 Ga0501081_0020280
1141 Ga0501081_0064302
1142 Ga0501081_0128984
1143 Ga0501081_0213626
1144 Ga0501081_0623977
1145 Ga0501083_0794306
1146 Ga0501035_0017110
1147 Ga0501044_0097235
1148 Ga0501045_0032864
1149 Ga0501045_0066401
1150 Ga0501045_0086735
1151 Ga0501045_0387050
1152 Ga0501045_0467553
1153 nmdc:mga0yw44_430418_c1
1154 nmdc:mga05p37_156051_c1
1155 nmdc:mga05p37_158794_c1
1156 nmdc:mga05p37_270506_c1
1157 nmdc:mga05p37_335160_c1
1158 nmdc:mga05p37_7_c1
1159 nmdc:mga06r32_140429_c1
1160 nmdc:mga06r32_914343_c1
1161 nmdc:mga08y16_211442_c1
1162 nmdc:mga08y16_219891_c1
1163 nmdc:mga08y16_42127_c1
1164 nmdc:mga08y16_439173_c1
1165 nmdc:mga08y16_692615_c1
1166 nmdc:mga0n895_1638733_c1
1167 nmdc:mga0n895_164390_c1
1168 nmdc:mga0rr50_38433_c1
1169 nmdc:mga0rr50_608307_c1
1170 nmdc:mga08x19_463748_c1
1171 nmdc:mga0a205_211324_c1
1172 nmdc:mga0a205_275345_c1
1173 nmdc:mga0a205_31083_c1
1174 nmdc:mga0a205_358022_c1
1175 Ga0495601_0053194
1176 Ga0495612_0000134
1177 Ga0495619_0090516
1178 Ga0495619_0107355
1179 Ga0501084_0008534
1180 Ga0501084_0030157
1181 Ga0501084_0078401
1182 Ga0501084_0236690
1183 Ga0501084_0648717
1184 Ga0501084_0705784
1185 Ga0501084_1103315
1186 Ga0590071_017631
1187 Ga0501082_0056892
1188 Ga0501082_0073305
1189 Ga0501082_0235907
1190 Ga0530510_0004363
1191 Ga0530510_0049351
1192 Ga0530510_0059661
1193 Ga0530510_0134920
1194 Ga0530510_0174829
1195 Ga0530510_0507098
1196 Ga0530510_0865119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02577

BFN_dom

Bifunctional nuclease domain

23

136

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sj5-assembly1.cif.gz_A crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 2.8 a resolution 0.9389 5 135
1vjl-assembly1.cif.gz_A crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution 0.9371 5 134
1vjl-assembly1.cif.gz_B crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution 0.9286 5 135
1sj5-assembly1.cif.gz_B crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 2.8 a resolution 0.9205 5 135
1vjl-assembly1.cif.gz_B crystal structure of a duf151 family protein (tm0160) from thermotoga maritima at 1.90 a resolution 0.8838 5 135
ID Description Score Start End Superfamily
1sj5A00 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.9389 5 135 3.10.690.10
af_Q9FWS6_123_258_3.10.690.10 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.9372 23 136 3.10.690.10
af_A0A1D6MW07_142_273_3.10.690.10 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.9196 23 124 3.10.690.10
af_P9WLR5_1_139_3.10.690.10 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.904 6 145 3.10.690.10
af_I1LI65_127_259_3.10.690.10 Alpha Beta;Roll;Bifunctional nuclease domain;Bifunctional nuclease domain 0.8964 23 134 3.10.690.10
ID Description Score Start End GO Terms
AF-X0RSL3-F1-model_v4 BFN domain-containing protein 0.9726 62 131 GO:0004518
AF-A0A538GW99-F1-model_v4 Bifunctional nuclease family protein 0.9657 6 135 GO:0004518
AF-A0A7Y6CDH6-F1-model_v4 Bifunctional nuclease family protein 0.9651 6 135 GO:0004518
AF-A0A533S0D2-F1-model_v4 Bifunctional nuclease family protein 0.9643 5 134 GO:0004518
AF-A0A7C2CZU9-F1-model_v4 Bifunctional nuclease family protein 0.9643 6 115 GO:0004518

Map