F467750
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 598 | 302 | 588 | 183 |
Family's Representative Sequence
| Representative Sequence | 3300005367|Ga0070667_100000944|Ga0070667_10000094422 |
| Length | 206 |
| Sequence | MTAPAVSAPWLDPTTASPVPDSGIVNTIEPARIEPGGFRELGPLNWVIAKIGAKTIRAPRFTLFNVLGQHHLLFLTFLPYSGMLLGRSKLGLKDAELVILRVGHLRGSEYELQQHRRLARSRGVDAETQARIFEGPDADGLTDRQRVLITATDEFVITRSVSDQTWKSLASYLDRKQLIEFCLLAAQYDGLAATIATLRVPLDFPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 4 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 5 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 6 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 7 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 8 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 9 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 10 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 11 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 12 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 13 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 14 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 15 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 16 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 90 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 180 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 181 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 184 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 185 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 188 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 189 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 190 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 191 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 196 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 197 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 198 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 199 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 200 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 201 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 202 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 203 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 204 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 205 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 206 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 207 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 208 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 211 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 212 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 213 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 257 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 258 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 259 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 260 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 261 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 262 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 263 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 264 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 265 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 266 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 267 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 282 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 283 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 285 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 286 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 287 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 293 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 294 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 295 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 296 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 297 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 298 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 299 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 300 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 301 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 302 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.33 |
| Metatranscriptomes | 0 |
| Isolates | 1.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.72 |
| Nodule | 0.17 |
| Rhizoplane | 12.88 |
| Rhizosphere | 66.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1021658 | 3300002074 | Bacteria | 776 |
| 2 | JGI24749J21850_1044967 | 3300002076 | Bacteria | 651 |
| 3 | JGI24744J21845_10006371 | 3300002077 | Bacteria | 2450 |
| 4 | JGI24744J21845_10051303 | 3300002077 | Bacteria | 760 |
| 5 | JGI24742J22300_10009284 | 3300002244 | Bacteria | 1623 |
| 6 | JGI24751J29686_10005220 | 3300002459 | Bacteria | 2642 |
| 7 | Ga0055540_1000069 | 3300003792 | Bacteria | 119560 |
| 8 | Ga0055540_1001260 | 3300003792 | Bacteria | 15428 |
| 9 | Ga0055540_1004053 | 3300003792 | Bacteria | 6806 |
| 10 | Ga0055540_1004594 | 3300003792 | Bacteria | 6135 |
| 11 | Ga0070658_10511199 | 3300005327 | Bacteria | 1038 |
| 12 | Ga0070676_10003963 | 3300005328 | Bacteria | 7767 |
| 13 | Ga0070683_100330333 | 3300005329 | Bacteria | 1452 |
| 14 | Ga0070690_100009234 | 3300005330 | Bacteria | 5707 |
| 15 | Ga0070690_100121706 | 3300005330 | Bacteria | 1752 |
| 16 | Ga0068869_100023500 | 3300005334 | Bacteria | 4258 |
| 17 | Ga0068869_100632634 | 3300005334 | Bacteria | 907 |
| 18 | Ga0070666_10072822 | 3300005335 | Bacteria | 2340 |
| 19 | Ga0070682_100003677 | 3300005337 | Bacteria | 8514 |
| 20 | Ga0070682_100023610 | 3300005337 | Bacteria | 3653 |
| 21 | Ga0070682_100034675 | 3300005337 | Bacteria | 3075 |
| 22 | Ga0070682_100082726 | 3300005337 | Bacteria | 2082 |
| 23 | Ga0068868_100002600 | 3300005338 | Bacteria | 12513 |
| 24 | Ga0068868_100270514 | 3300005338 | Bacteria | 1435 |
| 25 | Ga0070660_100421131 | 3300005339 | Bacteria | 1106 |
| 26 | Ga0070660_100752844 | 3300005339 | Bacteria | 818 |
| 27 | Ga0070689_100016154 | 3300005340 | Bacteria | 5460 |
| 28 | Ga0070689_100690107 | 3300005340 | Bacteria | 891 |
| 29 | Ga0070691_10008626 | 3300005341 | Bacteria | 4665 |
| 30 | Ga0070692_10236015 | 3300005345 | Bacteria | 1088 |
| 31 | Ga0070668_100004990 | 3300005347 | Bacteria | 9830 |
| 32 | Ga0070668_100009899 | 3300005347 | Bacteria | 7059 |
| 33 | Ga0070669_100013393 | 3300005353 | Bacteria | 5831 |
| 34 | Ga0070671_100058365 | 3300005355 | Bacteria | 3213 |
| 35 | Ga0070671_100080582 | 3300005355 | Bacteria | 2722 |
| 36 | Ga0070674_100006416 | 3300005356 | Bacteria | 6860 |
| 37 | Ga0070674_100017420 | 3300005356 | Bacteria | 4519 |
| 38 | Ga0070674_101167170 | 3300005356 | Bacteria | 682 |
| 39 | Ga0070673_100227477 | 3300005364 | Bacteria | 1617 |
| 40 | Ga0070688_100160796 | 3300005365 | Bacteria | 1543 |
| 41 | Ga0070688_100635393 | 3300005365 | Bacteria | 820 |
| 42 | Ga0070659_100047018 | 3300005366 | Bacteria | 3383 |
| 43 | Ga0070659_100198442 | 3300005366 | Bacteria | 1651 |
| 44 | Ga0070659_100588875 | 3300005366 | Bacteria | 955 |
| 45 | Ga0070667_100000944 | 3300005367 | Bacteria | 26746 |
| 46 | Ga0070667_100005025 | 3300005367 | Bacteria | 11070 |
| 47 | Ga0070667_100257126 | 3300005367 | Bacteria | 1563 |
| 48 | Ga0070667_100561731 | 3300005367 | Bacteria | 1049 |
| 49 | Ga0070703_10274915 | 3300005406 | Bacteria | 693 |
| 50 | Ga0070709_10006545 | 3300005434 | Bacteria | 6353 |
| 51 | Ga0070709_10056358 | 3300005434 | Bacteria | 2485 |
| 52 | Ga0070714_100692430 | 3300005435 | Bacteria | 983 |
| 53 | Ga0070714_101058750 | 3300005435 | Bacteria | 790 |
| 54 | Ga0070710_10000645 | 3300005437 | Bacteria | 16624 |
| 55 | Ga0070710_10005502 | 3300005437 | Bacteria | 6022 |
| 56 | Ga0070701_10000931 | 3300005438 | Bacteria | 10590 |
| 57 | Ga0070701_10251777 | 3300005438 | Bacteria | 1067 |
| 58 | Ga0070711_100010668 | 3300005439 | Bacteria | 5691 |
| 59 | Ga0070711_100011474 | 3300005439 | Bacteria | 5505 |
| 60 | Ga0070705_100002344 | 3300005440 | Bacteria | 9550 |
| 61 | Ga0070694_100212468 | 3300005444 | Bacteria | 1447 |
| 62 | Ga0070663_100192690 | 3300005455 | Bacteria | 1587 |
| 63 | Ga0070663_100344878 | 3300005455 | Bacteria | 1204 |
| 64 | Ga0070663_100559335 | 3300005455 | Bacteria | 957 |
| 65 | Ga0070678_100000622 | 3300005456 | Bacteria | 17380 |
| 66 | Ga0070678_100017035 | 3300005456 | Bacteria | 4665 |
| 67 | Ga0070662_100043042 | 3300005457 | Bacteria | 3228 |
| 68 | Ga0070662_100199572 | 3300005457 | Bacteria | 1586 |
| 69 | Ga0070662_101148231 | 3300005457 | Bacteria | 667 |
| 70 | Ga0068867_100003304 | 3300005459 | Bacteria | 11360 |
| 71 | Ga0070685_10034127 | 3300005466 | Bacteria | 2863 |
| 72 | Ga0070685_10121412 | 3300005466 | Bacteria | 1623 |
| 73 | Ga0070685_10282394 | 3300005466 | Bacteria | 1112 |
| 74 | Ga0070679_100985039 | 3300005530 | Bacteria | 787 |
| 75 | Ga0068853_100006099 | 3300005539 | Bacteria | 9543 |
| 76 | Ga0068853_100020960 | 3300005539 | Bacteria | 5440 |
| 77 | Ga0068853_100131019 | 3300005539 | Bacteria | 2245 |
| 78 | Ga0068853_100147086 | 3300005539 | Bacteria | 2118 |
| 79 | Ga0070672_100257148 | 3300005543 | Bacteria | 1472 |
| 80 | Ga0070686_100181544 | 3300005544 | Bacteria | 1495 |
| 81 | Ga0070686_100340511 | 3300005544 | Bacteria | 1124 |
| 82 | Ga0070695_100003039 | 3300005545 | Bacteria | 9772 |
| 83 | Ga0070696_100051969 | 3300005546 | Bacteria | 2851 |
| 84 | Ga0070696_100365673 | 3300005546 | Bacteria | 1121 |
| 85 | Ga0070693_100002346 | 3300005547 | Bacteria | 8699 |
| 86 | Ga0070693_100015757 | 3300005547 | Bacteria | 3899 |
| 87 | Ga0070665_100008523 | 3300005548 | Bacteria | 10371 |
| 88 | Ga0070665_100015799 | 3300005548 | Bacteria | 7582 |
| 89 | Ga0070665_100164165 | 3300005548 | Bacteria | 2223 |
| 90 | Ga0070665_101567020 | 3300005548 | Bacteria | 667 |
| 91 | Ga0070704_100002151 | 3300005549 | Bacteria | 10972 |
| 92 | Ga0070704_100093664 | 3300005549 | Bacteria | 2245 |
| 93 | Ga0068855_100596243 | 3300005563 | Bacteria | 1192 |
| 94 | Ga0068854_100016216 | 3300005578 | Bacteria | 4960 |
| 95 | Ga0068854_100247338 | 3300005578 | Bacteria | 1422 |
| 96 | Ga0068856_100290231 | 3300005614 | Bacteria | 1653 |
| 97 | Ga0068856_100886618 | 3300005614 | Bacteria | 911 |
| 98 | Ga0070702_100006886 | 3300005615 | Bacteria | 5411 |
| 99 | Ga0070702_100203453 | 3300005615 | Bacteria | 1312 |
| 100 | Ga0068852_100088692 | 3300005616 | Bacteria | 2763 |
| 101 | Ga0068859_100005667 | 3300005617 | Bacteria | 12713 |
| 102 | Ga0068859_100968782 | 3300005617 | Bacteria | 933 |
| 103 | Ga0068866_10000756 | 3300005718 | Bacteria | 14583 |
| 104 | Ga0068866_10595507 | 3300005718 | Bacteria | 746 |
| 105 | Ga0068866_10745523 | 3300005718 | Bacteria | 676 |
| 106 | Ga0068861_100002048 | 3300005719 | Bacteria | 13061 |
| 107 | Ga0068861_100118955 | 3300005719 | Bacteria | 2128 |
| 108 | Ga0068861_100185551 | 3300005719 | Bacteria | 1734 |
| 109 | Ga0068851_10094108 | 3300005834 | Bacteria | 1582 |
| 110 | Ga0068870_10119918 | 3300005840 | Bacteria | 1514 |
| 111 | Ga0068863_100052602 | 3300005841 | Bacteria | 3859 |
| 112 | Ga0068858_100019623 | 3300005842 | Bacteria | 6320 |
| 113 | Ga0068858_100054621 | 3300005842 | Bacteria | 3693 |
| 114 | Ga0068860_100079147 | 3300005843 | Bacteria | 3125 |
| 115 | Ga0068860_100898994 | 3300005843 | Bacteria | 901 |
| 116 | Ga0068862_100006801 | 3300005844 | Bacteria | 9482 |
| 117 | Ga0081455_10060979 | 3300005937 | Bacteria | 3176 |
| 118 | Ga0081455_10158768 | 3300005937 | Bacteria | 1736 |
| 119 | Ga0081538_10107119 | 3300005981 | Bacteria | 1385 |
| 120 | Ga0081538_10125506 | 3300005981 | Bacteria | 1221 |
| 121 | Ga0075365_10012814 | 3300006038 | Bacteria | 4993 |
| 122 | Ga0075365_10053865 | 3300006038 | Bacteria | 2666 |
| 123 | Ga0075365_10088972 | 3300006038 | Bacteria | 2102 |
| 124 | Ga0075363_100006732 | 3300006048 | Bacteria | 5245 |
| 125 | Ga0075363_100007027 | 3300006048 | Bacteria | 5147 |
| 126 | Ga0075363_100007612 | 3300006048 | Bacteria | 4990 |
| 127 | Ga0075363_100011994 | 3300006048 | Bacteria | 4168 |
| 128 | Ga0075363_100021612 | 3300006048 | Bacteria | 3244 |
| 129 | Ga0075363_100022180 | 3300006048 | Bacteria | 3208 |
| 130 | Ga0075363_100046445 | 3300006048 | Bacteria | 2304 |
| 131 | Ga0075363_100060771 | 3300006048 | Bacteria | 2035 |
| 132 | Ga0075363_100104478 | 3300006048 | Bacteria | 1570 |
| 133 | Ga0075363_100277709 | 3300006048 | Bacteria | 969 |
| 134 | Ga0075364_10037435 | 3300006051 | Bacteria | 3141 |
| 135 | Ga0075364_10084983 | 3300006051 | Bacteria | 2095 |
| 136 | Ga0075364_10171523 | 3300006051 | Bacteria | 1466 |
| 137 | Ga0070715_10030790 | 3300006163 | Bacteria | 2173 |
| 138 | Ga0070716_100018843 | 3300006173 | Bacteria | 3599 |
| 139 | Ga0070716_100319920 | 3300006173 | Bacteria | 1087 |
| 140 | Ga0070712_100001133 | 3300006175 | Bacteria | 16057 |
| 141 | Ga0070712_100164174 | 3300006175 | Bacteria | 1717 |
| 142 | Ga0075362_10082952 | 3300006177 | Bacteria | 1479 |
| 143 | Ga0075362_10167011 | 3300006177 | Bacteria | 1062 |
| 144 | Ga0075367_10009450 | 3300006178 | Bacteria | 5097 |
| 145 | Ga0075367_10066209 | 3300006178 | Bacteria | 2164 |
| 146 | Ga0075367_10103776 | 3300006178 | Bacteria | 1740 |
| 147 | Ga0075367_10205108 | 3300006178 | Bacteria | 1232 |
| 148 | Ga0075367_10250541 | 3300006178 | Bacteria | 1111 |
| 149 | Ga0075369_10003220 | 3300006186 | Bacteria | 5925 |
| 150 | Ga0075369_10003235 | 3300006186 | Bacteria | 5917 |
| 151 | Ga0075369_10006370 | 3300006186 | Bacteria | 4461 |
| 152 | Ga0075369_10013356 | 3300006186 | Bacteria | 3259 |
| 153 | Ga0075369_10046748 | 3300006186 | Bacteria | 1865 |
| 154 | Ga0075366_10041595 | 3300006195 | Bacteria | 2721 |
| 155 | Ga0097621_100021994 | 3300006237 | Bacteria | 4943 |
| 156 | Ga0097621_101130765 | 3300006237 | Bacteria | 736 |
| 157 | Ga0075370_10001730 | 3300006353 | Bacteria | 9708 |
| 158 | Ga0075370_10069773 | 3300006353 | Bacteria | 2009 |
| 159 | Ga0075370_10204949 | 3300006353 | Bacteria | 1164 |
| 160 | Ga0068871_100213781 | 3300006358 | Bacteria | 1669 |
| 161 | Ga0068871_100551703 | 3300006358 | Bacteria | 1044 |
| 162 | Ga0075428_100007609 | 3300006844 | Bacteria | 12007 |
| 163 | Ga0075430_100015847 | 3300006846 | Bacteria | 6420 |
| 164 | Ga0075431_100631371 | 3300006847 | Bacteria | 1053 |
| 165 | Ga0075434_100786084 | 3300006871 | Bacteria | 968 |
| 166 | Ga0075434_101048318 | 3300006871 | Bacteria | 829 |
| 167 | Ga0068865_100013935 | 3300006881 | Bacteria | 5098 |
| 168 | Ga0097620_100005667 | 3300006931 | Bacteria | 12713 |
| 169 | Ga0097620_100968713 | 3300006931 | Bacteria | 933 |
| 170 | Ga0099795_10021478 | 3300007788 | Bacteria | 2118 |
| 171 | Ga0105245_10023517 | 3300009098 | Bacteria | 5410 |
| 172 | Ga0105245_10172380 | 3300009098 | Bacteria | 2061 |
| 173 | Ga0105245_10835300 | 3300009098 | Bacteria | 961 |
| 174 | Ga0105247_10001481 | 3300009101 | Bacteria | 16883 |
| 175 | Ga0105247_10062423 | 3300009101 | Bacteria | 2312 |
| 176 | Ga0105247_10785381 | 3300009101 | Bacteria | 725 |
| 177 | Ga0114129_10348679 | 3300009147 | Bacteria | 1962 |
| 178 | Ga0105243_10001598 | 3300009148 | Bacteria | 19752 |
| 179 | Ga0105243_10346852 | 3300009148 | Bacteria | 1362 |
| 180 | Ga0105243_10536032 | 3300009148 | Bacteria | 1116 |
| 181 | Ga0105241_10115150 | 3300009174 | Bacteria | 2158 |
| 182 | Ga0105241_10622755 | 3300009174 | Bacteria | 977 |
| 183 | Ga0105242_10026490 | 3300009176 | Bacteria | 4597 |
| 184 | Ga0105242_11533632 | 3300009176 | Bacteria | 698 |
| 185 | Ga0105248_10018191 | 3300009177 | Bacteria | 7761 |
| 186 | Ga0105248_10032663 | 3300009177 | Bacteria | 5815 |
| 187 | Ga0105248_10117672 | 3300009177 | Bacteria | 2997 |
| 188 | Ga0105248_10290191 | 3300009177 | Bacteria | 1842 |
| 189 | Ga0105248_11563268 | 3300009177 | Bacteria | 747 |
| 190 | Ga0105237_10009243 | 3300009545 | Bacteria | 10569 |
| 191 | Ga0105237_10049359 | 3300009545 | Bacteria | 4231 |
| 192 | Ga0105238_10072625 | 3300009551 | Bacteria | 3436 |
| 193 | Ga0105249_10003095 | 3300009553 | Bacteria | 14361 |
| 194 | Ga0105249_10843607 | 3300009553 | Bacteria | 982 |
| 195 | Ga0105239_10001018 | 3300010375 | Bacteria | 39155 |
| 196 | Ga0105239_10107756 | 3300010375 | Bacteria | 3087 |
| 197 | Ga0105239_10108882 | 3300010375 | Bacteria | 3069 |
| 198 | Ga0105239_10226799 | 3300010375 | Bacteria | 2096 |
| 199 | Ga0105239_10395357 | 3300010375 | Bacteria | 1564 |
| 200 | Ga0105239_10707330 | 3300010375 | Bacteria | 1152 |
| 201 | Ga0105246_10024745 | 3300011119 | Bacteria | 3905 |
| 202 | Ga0105246_10548943 | 3300011119 | Bacteria | 990 |
| 203 | Ga0157369_10224956 | 3300013105 | Bacteria | 1963 |
| 204 | Ga0157374_10080946 | 3300013296 | Bacteria | 3081 |
| 205 | Ga0157374_10281356 | 3300013296 | Bacteria | 1642 |
| 206 | Ga0157378_10011978 | 3300013297 | Bacteria | 7593 |
| 207 | Ga0163162_10050817 | 3300013306 | Bacteria | 4158 |
| 208 | Ga0163162_10143195 | 3300013306 | Bacteria | 2505 |
| 209 | Ga0163162_10250845 | 3300013306 | Bacteria | 1902 |
| 210 | Ga0163162_10620518 | 3300013306 | Bacteria | 1206 |
| 211 | Ga0157372_10008420 | 3300013307 | Bacteria | 10948 |
| 212 | Ga0157375_10001902 | 3300013308 | Bacteria | 17961 |
| 213 | Ga0157375_10068914 | 3300013308 | Bacteria | 3542 |
| 214 | Ga0157375_10445174 | 3300013308 | Bacteria | 1461 |
| 215 | Ga0157375_10716601 | 3300013308 | Bacteria | 1153 |
| 216 | Ga0163163_10063814 | 3300014325 | Bacteria | 3654 |
| 217 | Ga0163163_11175625 | 3300014325 | Bacteria | 830 |
| 218 | Ga0157380_10014952 | 3300014326 | Bacteria | 5691 |
| 219 | Ga0157380_10133694 | 3300014326 | Bacteria | 2120 |
| 220 | Ga0157380_10145695 | 3300014326 | Bacteria | 2041 |
| 221 | Ga0157377_10143130 | 3300014745 | Bacteria | 1471 |
| 222 | Ga0157379_10241954 | 3300014968 | Bacteria | 1637 |
| 223 | Ga0157379_10339071 | 3300014968 | Bacteria | 1375 |
| 224 | Ga0157379_10342422 | 3300014968 | Bacteria | 1368 |
| 225 | Ga0157379_10765006 | 3300014968 | Bacteria | 910 |
| 226 | Ga0157376_10017806 | 3300014969 | Bacteria | 5430 |
| 227 | Ga0157376_10087394 | 3300014969 | Bacteria | 2690 |
| 228 | Ga0157376_10412153 | 3300014969 | Bacteria | 1309 |
| 229 | Ga0163161_10001691 | 3300017792 | Bacteria | 16204 |
| 230 | Ga0209673_1020913 | 3300025273 | Bacteria | 2302 |
| 231 | Ga0209051_1000034 | 3300025303 | Bacteria | 371498 |
| 232 | Ga0209051_1000478 | 3300025303 | Bacteria | 51782 |
| 233 | Ga0209051_1002514 | 3300025303 | Bacteria | 13013 |
| 234 | Ga0209051_1007549 | 3300025303 | Bacteria | 5924 |
| 235 | Ga0207696_1073071 | 3300025711 | Bacteria | 952 |
| 236 | Ga0207653_10101397 | 3300025885 | Bacteria | 1018 |
| 237 | Ga0207692_10008286 | 3300025898 | Bacteria | 4300 |
| 238 | Ga0207692_10289649 | 3300025898 | Bacteria | 993 |
| 239 | Ga0207642_10000759 | 3300025899 | Bacteria | 9977 |
| 240 | Ga0207710_10015573 | 3300025900 | Bacteria | 3216 |
| 241 | Ga0207710_10178977 | 3300025900 | Bacteria | 1039 |
| 242 | Ga0207688_10000800 | 3300025901 | Bacteria | 15737 |
| 243 | Ga0207688_10001392 | 3300025901 | Bacteria | 12579 |
| 244 | Ga0207688_10082013 | 3300025901 | Bacteria | 1843 |
| 245 | Ga0207688_10257250 | 3300025901 | Bacteria | 1059 |
| 246 | Ga0207680_10020950 | 3300025903 | Bacteria | 3530 |
| 247 | Ga0207647_10209396 | 3300025904 | Bacteria | 1126 |
| 248 | Ga0207699_10186830 | 3300025906 | Bacteria | 1396 |
| 249 | Ga0207645_10008279 | 3300025907 | Bacteria | 7267 |
| 250 | Ga0207643_10025005 | 3300025908 | Bacteria | 3298 |
| 251 | Ga0207671_10007962 | 3300025914 | Bacteria | 9078 |
| 252 | Ga0207671_10160399 | 3300025914 | Bacteria | 1741 |
| 253 | Ga0207693_10004684 | 3300025915 | Bacteria | 11520 |
| 254 | Ga0207693_10019343 | 3300025915 | Bacteria | 5418 |
| 255 | Ga0207663_10003448 | 3300025916 | Bacteria | 7746 |
| 256 | Ga0207662_10116357 | 3300025918 | Bacteria | 1672 |
| 257 | Ga0207657_10219002 | 3300025919 | Bacteria | 1526 |
| 258 | Ga0207681_10025164 | 3300025923 | Bacteria | 3826 |
| 259 | Ga0207687_10029352 | 3300025927 | Bacteria | 3699 |
| 260 | Ga0207687_10388950 | 3300025927 | Bacteria | 1144 |
| 261 | Ga0207687_10451860 | 3300025927 | Bacteria | 1066 |
| 262 | Ga0207644_10013355 | 3300025931 | Bacteria | 5474 |
| 263 | Ga0207644_10176622 | 3300025931 | Bacteria | 1671 |
| 264 | Ga0207690_10671898 | 3300025932 | Bacteria | 850 |
| 265 | Ga0207706_10004948 | 3300025933 | Bacteria | 12449 |
| 266 | Ga0207706_10006772 | 3300025933 | Bacteria | 10595 |
| 267 | Ga0207686_10021012 | 3300025934 | Bacteria | 3739 |
| 268 | Ga0207686_10025138 | 3300025934 | Bacteria | 3460 |
| 269 | Ga0207709_10002953 | 3300025935 | Bacteria | 10370 |
| 270 | Ga0207709_10222120 | 3300025935 | Bacteria | 1363 |
| 271 | Ga0207669_10022587 | 3300025937 | Bacteria | 3344 |
| 272 | Ga0207704_10020736 | 3300025938 | Bacteria | 3484 |
| 273 | Ga0207665_10001283 | 3300025939 | Bacteria | 16977 |
| 274 | Ga0207665_10006794 | 3300025939 | Bacteria | 7581 |
| 275 | Ga0207691_10188716 | 3300025940 | Bacteria | 1798 |
| 276 | Ga0207711_10055328 | 3300025941 | Bacteria | 3406 |
| 277 | Ga0207711_10299405 | 3300025941 | Bacteria | 1483 |
| 278 | Ga0207711_10468186 | 3300025941 | Bacteria | 1174 |
| 279 | Ga0207689_10023810 | 3300025942 | Bacteria | 5136 |
| 280 | Ga0207661_10533234 | 3300025944 | Bacteria | 1074 |
| 281 | Ga0207667_10076280 | 3300025949 | Bacteria | 3479 |
| 282 | Ga0207667_10727683 | 3300025949 | Bacteria | 993 |
| 283 | Ga0207651_10130714 | 3300025960 | Bacteria | 1922 |
| 284 | Ga0207651_10367449 | 3300025960 | Bacteria | 1216 |
| 285 | Ga0207712_10056986 | 3300025961 | Bacteria | 2755 |
| 286 | Ga0207712_10125671 | 3300025961 | Bacteria | 1947 |
| 287 | Ga0207668_10002928 | 3300025972 | Bacteria | 10017 |
| 288 | Ga0207668_10042692 | 3300025972 | Bacteria | 3072 |
| 289 | Ga0207668_10516528 | 3300025972 | Bacteria | 1030 |
| 290 | Ga0207640_10003175 | 3300025981 | Bacteria | 8848 |
| 291 | Ga0207640_11076708 | 3300025981 | Bacteria | 710 |
| 292 | Ga0207658_10002139 | 3300025986 | Bacteria | 14674 |
| 293 | Ga0207658_10050918 | 3300025986 | Bacteria | 3049 |
| 294 | Ga0207658_10076485 | 3300025986 | Bacteria | 2550 |
| 295 | Ga0207658_10232524 | 3300025986 | Bacteria | 1557 |
| 296 | Ga0207658_10327781 | 3300025986 | Bacteria | 1327 |
| 297 | Ga0207677_10008137 | 3300026023 | Bacteria | 5839 |
| 298 | Ga0207677_10359725 | 3300026023 | Bacteria | 1222 |
| 299 | Ga0207703_10003076 | 3300026035 | Bacteria | 14111 |
| 300 | Ga0207703_10093069 | 3300026035 | Bacteria | 2538 |
| 301 | Ga0207703_10201322 | 3300026035 | Bacteria | 1770 |
| 302 | Ga0207703_10414246 | 3300026035 | Bacteria | 1253 |
| 303 | Ga0207639_10013377 | 3300026041 | Bacteria | 5743 |
| 304 | Ga0207639_10034452 | 3300026041 | Bacteria | 3742 |
| 305 | Ga0207639_10147672 | 3300026041 | Bacteria | 1966 |
| 306 | Ga0207639_10392549 | 3300026041 | Bacteria | 1248 |
| 307 | Ga0207678_10002992 | 3300026067 | Bacteria | 15285 |
| 308 | Ga0207678_10049345 | 3300026067 | Bacteria | 3638 |
| 309 | Ga0207678_10079587 | 3300026067 | Bacteria | 2806 |
| 310 | Ga0207678_10318717 | 3300026067 | Bacteria | 1337 |
| 311 | Ga0207708_10007438 | 3300026075 | Bacteria | 8096 |
| 312 | Ga0207708_10034824 | 3300026075 | Bacteria | 3830 |
| 313 | Ga0207702_10543826 | 3300026078 | Bacteria | 1135 |
| 314 | Ga0207702_10844443 | 3300026078 | Bacteria | 906 |
| 315 | Ga0207641_10019027 | 3300026088 | Bacteria | 5632 |
| 316 | Ga0207648_10001849 | 3300026089 | Bacteria | 23156 |
| 317 | Ga0207648_10019514 | 3300026089 | Bacteria | 6119 |
| 318 | Ga0207676_10087144 | 3300026095 | Bacteria | 2553 |
| 319 | Ga0207676_10367807 | 3300026095 | Bacteria | 1335 |
| 320 | Ga0207675_100009494 | 3300026118 | Bacteria | 9106 |
| 321 | Ga0207675_100201461 | 3300026118 | Bacteria | 1912 |
| 322 | Ga0207683_10004741 | 3300026121 | Bacteria | 11717 |
| 323 | Ga0207683_10401461 | 3300026121 | Bacteria | 1261 |
| 324 | Ga0207698_10047260 | 3300026142 | Bacteria | 3259 |
| 325 | Ga0207698_10450323 | 3300026142 | Bacteria | 1242 |
| 326 | Ga0207698_10478924 | 3300026142 | Bacteria | 1207 |
| 327 | Ga0268266_10002437 | 3300028379 | Bacteria | 19971 |
| 328 | Ga0268266_10063227 | 3300028379 | Bacteria | 3195 |
| 329 | Ga0268265_10160579 | 3300028380 | Bacteria | 1908 |
| 330 | Ga0268264_10002313 | 3300028381 | Bacteria | 16854 |
| 331 | Ga0268264_11482925 | 3300028381 | Bacteria | 689 |
| 332 | Ga0265327_10000863 | 3300031251 | Bacteria | 45090 |
| 333 | Ga0307413_10160587 | 3300031824 | Bacteria | 1578 |
| 334 | Ga0307410_10050557 | 3300031852 | Bacteria | 2796 |
| 335 | Ga0307410_10089870 | 3300031852 | Bacteria | 2177 |
| 336 | Ga0307410_10797242 | 3300031852 | Bacteria | 803 |
| 337 | Ga0307406_10154754 | 3300031901 | Bacteria | 1640 |
| 338 | Ga0307409_100021152 | 3300031995 | Bacteria | 4454 |
| 339 | Ga0307414_10309168 | 3300032004 | Bacteria | 1341 |
| 340 | Ga0307415_100275877 | 3300032126 | Bacteria | 1380 |
| 341 | Ga0373938_0079066 | 3300034957 | Bacteria | 798 |
| 342 | Ga0373940_0126999 | 3300035088 | Bacteria | 796 |
| 343 | Ga0373951_0024188 | 3300035091 | Bacteria | 1406 |
| 344 | Ga0373931_0101837 | 3300035691 | Bacteria | 1616 |
| 345 | Ga0373931_0176249 | 3300035691 | Bacteria | 1263 |
| 346 | Ga0373927_0715856 | 3300035695 | Bacteria | 661 |
| 347 | Ga0316582_0148085 | 3300036647 | Bacteria | 1586 |
| 348 | Ga0316584_0072288 | 3300036712 | Bacteria | 2585 |
| 349 | Ga0395901_0734921 | 3300038443 | Bacteria | 981 |
| 350 | Ga0436363_1376696 | 3300039450 | Bacteria | 2252 |
| 351 | Ga0439461_0000532 | 3300041410 | Bacteria | 5520 |
| 352 | Ga0439461_0007032 | 3300041410 | Bacteria | 1980 |
| 353 | Ga0439461_0010928 | 3300041410 | Bacteria | 1676 |
| 354 | Ga0439466_0003885 | 3300041411 | Bacteria | 5767 |
| 355 | Ga0439465_0002775 | 3300041413 | Bacteria | 5734 |
| 356 | Ga0439465_0004364 | 3300041413 | Bacteria | 4580 |
| 357 | Ga0451789_0587683 | 3300041443 | Bacteria | 804 |
| 358 | Ga0451793_1165290 | 3300041452 | Bacteria | 1137 |
| 359 | Ga0451795_0480540 | 3300041456 | Bacteria | 1674 |
| 360 | Ga0451807_2720499 | 3300041486 | Bacteria | 942 |
| 361 | Ga0451853_3778465 | 3300041512 | Bacteria | 635 |
| 362 | Ga0439431_0000332 | 3300041997 | Bacteria | 9833 |
| 363 | Ga0439431_0003038 | 3300041997 | Bacteria | 3681 |
| 364 | Ga0439442_008866 | 3300042002 | Bacteria | 2032 |
| 365 | Ga0439445_0020061 | 3300042004 | Bacteria | 1670 |
| 366 | Ga0439445_0096886 | 3300042004 | Bacteria | 835 |
| 367 | Ga0439448_0011971 | 3300042005 | Bacteria | 2591 |
| 368 | Ga0439434_0014234 | 3300042435 | Bacteria | 2366 |
| 369 | Ga0439434_0049932 | 3300042435 | Bacteria | 1295 |
| 370 | Ga0466972_0002627 | 3300044658 | Bacteria | 8898 |
| 371 | Ga0466972_0006124 | 3300044658 | Bacteria | 6043 |
| 372 | Ga0466972_0034430 | 3300044658 | Bacteria | 2482 |
| 373 | Ga0466965_0002380 | 3300044683 | Bacteria | 7969 |
| 374 | Ga0466965_0005113 | 3300044683 | Bacteria | 5889 |
| 375 | Ga0466965_0010952 | 3300044683 | Bacteria | 4241 |
| 376 | Ga0466965_0068328 | 3300044683 | Bacteria | 1784 |
| 377 | Ga0466961_0090477 | 3300044693 | Bacteria | 1932 |
| 378 | Ga0466963_0161652 | 3300044694 | Bacteria | 1559 |
| 379 | Ga0466964_0282290 | 3300044706 | Bacteria | 830 |
| 380 | Ga0466964_0595192 | 3300044706 | Bacteria | 606 |
| 381 | Ga0466971_0134383 | 3300044719 | Bacteria | 1150 |
| 382 | Ga0466968_0000598 | 3300044735 | Bacteria | 12287 |
| 383 | Ga0466968_0113853 | 3300044735 | Unclassified | 1218 |
| 384 | Ga0466970_0056240 | 3300044765 | Bacteria | 2102 |
| 385 | Ga0466970_0130368 | 3300044765 | Bacteria | 1381 |
| 386 | Ga0466957_0269842 | 3300044842 | Bacteria | 1136 |
| 387 | Ga0466960_0000572 | 3300044901 | Bacteria | 12763 |
| 388 | Ga0466959_0115525 | 3300045049 | Bacteria | 1912 |
| 389 | Ga0466958_0021717 | 3300045836 | Bacteria | 3754 |
| 390 | Ga0466967_0023563 | 3300045976 | Bacteria | 5048 |
| 391 | Ga0466967_0036973 | 3300045976 | Bacteria | 4174 |
| 392 | Ga0466967_0216469 | 3300045976 | Bacteria | 1818 |
| 393 | Ga0466967_0495914 | 3300045976 | Bacteria | 1198 |
| 394 | Ga0466967_1223308 | 3300045976 | Bacteria | 748 |
| 395 | Ga0466967_1671988 | 3300045976 | Bacteria | 634 |
| 396 | Ga0466967_1837017 | 3300045976 | Bacteria | 603 |
| 397 | Ga0495603_0068308 | 3300046455 | Bacteria | 2091 |
| 398 | Ga0495590_0141688 | 3300046457 | Bacteria | 868 |
| 399 | Ga0495629_0053911 | 3300046459 | Bacteria | 2812 |
| 400 | Ga0495638_0002750 | 3300046460 | Bacteria | 14133 |
| 401 | Ga0495641_0024960 | 3300046461 | Bacteria | 2940 |
| 402 | Ga0495582_0146806 | 3300046473 | Bacteria | 1338 |
| 403 | Ga0495583_0060721 | 3300046506 | Bacteria | 1689 |
| 404 | Ga0495630_0361216 | 3300046517 | Bacteria | 1112 |
| 405 | Ga0495632_0227157 | 3300046519 | Bacteria | 843 |
| 406 | Ga0495648_0002742 | 3300046524 | Bacteria | 15910 |
| 407 | Ga0495654_0137008 | 3300046530 | Bacteria | 1094 |
| 408 | Ga0495665_0084544 | 3300046531 | Bacteria | 1668 |
| 409 | Ga0495640_0088987 | 3300046533 | Bacteria | 2040 |
| 410 | Ga0495640_0254276 | 3300046533 | Bacteria | 1099 |
| 411 | Ga0495668_0032174 | 3300046616 | Bacteria | 2953 |
| 412 | Ga0495634_0398731 | 3300046642 | Bacteria | 818 |
| 413 | Ga0495611_0245270 | 3300046648 | Bacteria | 831 |
| 414 | Ga0495635_0085490 | 3300046663 | Bacteria | 2158 |
| 415 | Ga0495658_0011681 | 3300046683 | Bacteria | 4425 |
| 416 | Ga0495613_0340263 | 3300046689 | Bacteria | 1032 |
| 417 | Ga0495624_0204588 | 3300046690 | Bacteria | 1198 |
| 418 | Ga0495581_0052610 | 3300047315 | Bacteria | 2352 |
| 419 | Ga0495672_0002921 | 3300047320 | Bacteria | 15104 |
| 420 | Ga0495672_0075972 | 3300047320 | Bacteria | 1888 |
| 421 | Ga0495672_0140634 | 3300047320 | Bacteria | 1261 |
| 422 | Ga0495676_0291791 | 3300047321 | Bacteria | 1102 |
| 423 | Ga0495673_0001467 | 3300047469 | Bacteria | 18689 |
| 424 | Ga0495686_0008890 | 3300047472 | Bacteria | 7306 |
| 425 | Ga0495686_0089225 | 3300047472 | Bacteria | 1873 |
| 426 | Ga0495626_0022103 | 3300048091 | Bacteria | 3144 |
| 427 | Ga0496100_0000175 | 3300048903 | Bacteria | 35727 |
| 428 | Ga0496100_0004450 | 3300048903 | Bacteria | 7434 |
| 429 | Ga0496100_0014240 | 3300048903 | Bacteria | 4613 |
| 430 | Ga0496100_0051247 | 3300048903 | Bacteria | 2678 |
| 431 | Ga0496100_0163002 | 3300048903 | Bacteria | 1600 |
| 432 | Ga0496100_0333880 | 3300048903 | Bacteria | 1141 |
| 433 | Ga0496101_0000014 | 3300048904 | Bacteria | 253487 |
| 434 | Ga0496101_0000140 | 3300048904 | Bacteria | 63955 |
| 435 | Ga0496101_0003353 | 3300048904 | Bacteria | 9977 |
| 436 | Ga0496101_0004665 | 3300048904 | Bacteria | 8673 |
| 437 | Ga0496101_0026851 | 3300048904 | Bacteria | 4004 |
| 438 | Ga0496101_0090391 | 3300048904 | Bacteria | 2277 |
| 439 | Ga0496101_0651277 | 3300048904 | Bacteria | 832 |
| 440 | Ga0496102_0000041 | 3300048905 | Bacteria | 196634 |
| 441 | Ga0496102_0007297 | 3300048905 | Bacteria | 9435 |
| 442 | Ga0496102_0007713 | 3300048905 | Bacteria | 9194 |
| 443 | Ga0496102_0009843 | 3300048905 | Bacteria | 8220 |
| 444 | Ga0496102_0127430 | 3300048905 | Bacteria | 2380 |
| 445 | Ga0496102_0262656 | 3300048905 | Bacteria | 1628 |
| 446 | Ga0496102_0410497 | 3300048905 | Bacteria | 1272 |
| 447 | Ga0496103_0000058 | 3300048906 | Bacteria | 141099 |
| 448 | Ga0496103_0000183 | 3300048906 | Bacteria | 63106 |
| 449 | Ga0496103_0044212 | 3300048906 | Bacteria | 2744 |
| 450 | Ga0496103_0118286 | 3300048906 | Bacteria | 1687 |
| 451 | Ga0496103_0177331 | 3300048906 | Bacteria | 1369 |
| 452 | Ga0496104_0008084 | 3300048907 | Bacteria | 9333 |
| 453 | Ga0496104_0060614 | 3300048907 | Bacteria | 3585 |
| 454 | Ga0496104_0108110 | 3300048907 | Bacteria | 2665 |
| 455 | Ga0496104_0132311 | 3300048907 | Bacteria | 2396 |
| 456 | Ga0496104_0183810 | 3300048907 | Bacteria | 2001 |
| 457 | Ga0496105_0003856 | 3300048908 | Bacteria | 11203 |
| 458 | Ga0496105_0264487 | 3300048908 | Bacteria | 1390 |
| 459 | Ga0496105_0396548 | 3300048908 | Bacteria | 1096 |
| 460 | Ga0496105_0821401 | 3300048908 | Bacteria | 705 |
| 461 | Ga0496106_0001516 | 3300048909 | Bacteria | 17471 |
| 462 | Ga0496106_0007881 | 3300048909 | Bacteria | 7874 |
| 463 | Ga0496106_0014123 | 3300048909 | Bacteria | 5900 |
| 464 | Ga0496106_0016728 | 3300048909 | Bacteria | 5426 |
| 465 | Ga0496107_0000145 | 3300048910 | Bacteria | 35595 |
| 466 | Ga0496107_0011115 | 3300048910 | Bacteria | 6263 |
| 467 | Ga0496107_0044133 | 3300048910 | Bacteria | 3204 |
| 468 | Ga0496107_0046533 | 3300048910 | Bacteria | 3122 |
| 469 | Ga0496107_0059843 | 3300048910 | Bacteria | 2757 |
| 470 | Ga0496107_0419333 | 3300048910 | Bacteria | 995 |
| 471 | Ga0496108_0002334 | 3300048911 | Bacteria | 15200 |
| 472 | Ga0496108_0013556 | 3300048911 | Bacteria | 6653 |
| 473 | Ga0496108_0048734 | 3300048911 | Bacteria | 3542 |
| 474 | Ga0496108_0147441 | 3300048911 | Bacteria | 2029 |
| 475 | Ga0496109_0000161 | 3300048912 | Bacteria | 65633 |
| 476 | Ga0496109_0056521 | 3300048912 | Bacteria | 3581 |
| 477 | Ga0496109_0092452 | 3300048912 | Bacteria | 2798 |
| 478 | Ga0496109_0093377 | 3300048912 | Bacteria | 2785 |
| 479 | Ga0496109_0225818 | 3300048912 | Bacteria | 1761 |
| 480 | Ga0496109_0488629 | 3300048912 | Bacteria | 1162 |
| 481 | Ga0496109_1581695 | 3300048912 | Bacteria | 590 |
| 482 | Ga0496110_0010152 | 3300048913 | Bacteria | 7650 |
| 483 | Ga0496110_0030964 | 3300048913 | Bacteria | 4614 |
| 484 | Ga0496111_0006072 | 3300048914 | Bacteria | 7807 |
| 485 | Ga0496111_0057053 | 3300048914 | Bacteria | 2827 |
| 486 | Ga0496111_0188621 | 3300048914 | Bacteria | 1533 |
| 487 | Ga0496111_0266590 | 3300048914 | Bacteria | 1270 |
| 488 | Ga0496112_0006436 | 3300048915 | Bacteria | 10312 |
| 489 | Ga0496112_0012706 | 3300048915 | Bacteria | 7744 |
| 490 | Ga0496113_0006742 | 3300048916 | Bacteria | 7318 |
| 491 | Ga0496113_0096160 | 3300048916 | Bacteria | 2290 |
| 492 | Ga0496113_0132344 | 3300048916 | Bacteria | 1958 |
| 493 | Ga0496114_0001744 | 3300048917 | Bacteria | 16517 |
| 494 | Ga0496114_0008198 | 3300048917 | Bacteria | 8282 |
| 495 | Ga0496114_0022796 | 3300048917 | Bacteria | 5103 |
| 496 | Ga0496114_0088739 | 3300048917 | Bacteria | 2623 |
| 497 | Ga0496115_0006154 | 3300048918 | Bacteria | 8778 |
| 498 | Ga0496115_0006640 | 3300048918 | Bacteria | 8489 |
| 499 | Ga0496115_0106818 | 3300048918 | Bacteria | 2298 |
| 500 | Ga0496116_0000098 | 3300048919 | Bacteria | 196497 |
| 501 | Ga0496116_0001872 | 3300048919 | Bacteria | 22739 |
| 502 | Ga0496117_0000096 | 3300048920 | Bacteria | 196788 |
| 503 | Ga0496118_0000073 | 3300048921 | Bacteria | 196712 |
| 504 | Ga0496118_0009422 | 3300048921 | Bacteria | 9861 |
| 505 | Ga0496119_0006822 | 3300048922 | Bacteria | 10468 |
| 506 | Ga0496119_0114735 | 3300048922 | Bacteria | 1489 |
| 507 | Ga0496120_0101653 | 3300048923 | Bacteria | 1517 |
| 508 | Ga0496120_0146039 | 3300048923 | Bacteria | 1194 |
| 509 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 510 | Ga0496121_0000354 | 3300048924 | Bacteria | 94725 |
| 511 | Ga0496121_0392835 | 3300048924 | Bacteria | 911 |
| 512 | Ga0496122_0001055 | 3300048925 | Bacteria | 48077 |
| 513 | Ga0496122_0096805 | 3300048925 | Bacteria | 1988 |
| 514 | Ga0496122_0185277 | 3300048925 | Bacteria | 1236 |
| 515 | Ga0496123_0004209 | 3300048926 | Bacteria | 15361 |
| 516 | Ga0496123_0055470 | 3300048926 | Bacteria | 2599 |
| 517 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 518 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 519 | Ga0496126_0000009 | 3300048929 | Bacteria | 750350 |
| 520 | Ga0496126_0001057 | 3300048929 | Bacteria | 46555 |
| 521 | Ga0496126_0002185 | 3300048929 | Bacteria | 27192 |
| 522 | Ga0496126_0129440 | 3300048929 | Bacteria | 2182 |
| 523 | Ga0501032_0016653 | 3300049569 | Bacteria | 5168 |
| 524 | Ga0501033_0344770 | 3300049570 | Bacteria | 1044 |
| 525 | Ga0501034_0055117 | 3300049571 | Bacteria | 4001 |
| 526 | Ga0501036_0004272 | 3300049572 | Bacteria | 11531 |
| 527 | Ga0501037_0001645 | 3300049573 | Bacteria | 16251 |
| 528 | Ga0501038_0026442 | 3300049574 | Bacteria | 5168 |
| 529 | Ga0501039_0000415 | 3300049575 | Bacteria | 30627 |
| 530 | Ga0501040_0663000 | 3300049576 | Bacteria | 754 |
| 531 | Ga0501043_0001031 | 3300049579 | Bacteria | 24463 |
| 532 | Ga0501047_0013760 | 3300049581 | Bacteria | 7684 |
| 533 | Ga0501047_0096689 | 3300049581 | Bacteria | 2832 |
| 534 | Ga0501068_0093339 | 3300049584 | Bacteria | 1859 |
| 535 | Ga0501070_0000517 | 3300049586 | Bacteria | 35418 |
| 536 | Ga0501070_0097477 | 3300049586 | Bacteria | 2432 |
| 537 | Ga0501073_0101235 | 3300049589 | Bacteria | 2000 |
| 538 | Ga0501044_0211389 | 3300049823 | Bacteria | 1894 |
| 539 | nmdc:mga03683_299986_c1 | 3300050489 | Bacteria | 753 |
| 540 | nmdc:mga03683_50048_c1 | 3300050489 | Bacteria | 1741 |
| 541 | nmdc:mga03n38_105_c2 | 3300050490 | Bacteria | 16032 |
| 542 | nmdc:mga03n38_18613_c1 | 3300050490 | Bacteria | 2745 |
| 543 | nmdc:mga03n38_37714_c1 | 3300050490 | Bacteria | 2086 |
| 544 | nmdc:mga03n38_75125_c1 | 3300050490 | Bacteria | 1573 |
| 545 | nmdc:mga03n38_988_c1 | 3300050490 | Bacteria | 7761 |
| 546 | nmdc:mga00v17_14597_c1 | 3300050491 | Bacteria | 4389 |
| 547 | nmdc:mga00v17_160552_c1 | 3300050491 | Bacteria | 1447 |
| 548 | nmdc:mga00v17_210840_c1 | 3300050491 | Bacteria | 1257 |
| 549 | nmdc:mga00v17_242369_c1 | 3300050491 | Bacteria | 1169 |
| 550 | nmdc:mga00v17_2895_c1 | 3300050491 | Bacteria | 8802 |
| 551 | nmdc:mga00v17_2898_c1 | 3300050491 | Bacteria | 8795 |
| 552 | nmdc:mga0yw44_211392_c1 | 3300050492 | Bacteria | 1283 |
| 553 | nmdc:mga0yw44_33090_c1 | 3300050492 | Bacteria | 3018 |
| 554 | nmdc:mga0yw44_367000_c1 | 3300050492 | Bacteria | 971 |
| 555 | nmdc:mga0yw44_73034_c1 | 3300050492 | Bacteria | 2133 |
| 556 | nmdc:mga0k408_52408_c1 | 3300050493 | Bacteria | 2365 |
| 557 | nmdc:mga06z11_102046_c1 | 3300050494 | Bacteria | 986 |
| 558 | nmdc:mga06z11_105582_c1 | 3300050494 | Bacteria | 1552 |
| 559 | nmdc:mga06z11_11854_c1 | 3300050494 | Bacteria | 3772 |
| 560 | nmdc:mga06z11_373876_c1 | 3300050494 | Bacteria | 855 |
| 561 | nmdc:mga06z11_58903_c1 | 3300050494 | Bacteria | 1994 |
| 562 | nmdc:mga07m45_24226_c1 | 3300050496 | Bacteria | 3323 |
| 563 | nmdc:mga07m45_251625_c1 | 3300050496 | Bacteria | 1028 |
| 564 | nmdc:mga07m45_447232_c1 | 3300050496 | Bacteria | 749 |
| 565 | nmdc:mga07m45_479723_c1 | 3300050496 | Bacteria | 720 |
| 566 | nmdc:mga07m45_562253_c1 | 3300050496 | Bacteria | 659 |
| 567 | nmdc:mga07m45_781_c1 | 3300050496 | Bacteria | 13679 |
| 568 | nmdc:mga05p37_118759_c1 | 3300050507 | Bacteria | 3249 |
| 569 | nmdc:mga0qj67_27151_c1 | 3300050509 | Bacteria | 4434 |
| 570 | nmdc:mga06r32_151410_c1 | 3300050510 | Bacteria | 2298 |
| 571 | nmdc:mga0sz30_16563_c1 | 3300050516 | Bacteria | 2929 |
| 572 | nmdc:mga0sz30_177101_c1 | 3300050516 | Bacteria | 945 |
| 573 | nmdc:mga0sz30_30161_c1 | 3300050516 | Bacteria | 2239 |
| 574 | nmdc:mga0sz30_39146_c1 | 3300050516 | Bacteria | 1988 |
| 575 | nmdc:mga0sz30_40019_c1 | 3300050516 | Bacteria | 1969 |
| 576 | nmdc:mga0sz30_43208_c1 | 3300050516 | Bacteria | 1897 |
| 577 | nmdc:mga0sz30_68145_c1 | 3300050516 | Bacteria | 1528 |
| 578 | Ga0500610_0013266 | 3300053079 | Bacteria | 3829 |
| 579 | Ga0500641_0013855 | 3300053096 | Bacteria | 2967 |
| 580 | Ga0500650_0129247 | 3300053098 | Bacteria | 1175 |
| 581 | Ga0500562_004189 | 3300053108 | Bacteria | 3642 |
| 582 | Ga0500595_107564 | 3300053119 | Bacteria | 795 |
| 583 | Ga0500608_034736 | 3300053122 | Bacteria | 2403 |
| 584 | Ga0500642_0101457 | 3300053130 | Bacteria | 1339 |
| 585 | Ga0500658_0420096 | 3300053134 | Bacteria | 611 |
| 586 | Ga0500577_0028326 | 3300053142 | Bacteria | 1929 |
| 587 | Ga0500616_0011053 | 3300053153 | Bacteria | 5368 |
| 588 | Ga0500627_0015617 | 3300053158 | Bacteria | 2940 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100004990 | Ga0070668_10000499010 | 166 |
| 2 | iso_pu_bacteria | 2842134933 | 2842135120 | 173 |
| 3 | 3300050496 | nmdc:mga07m45_562253_c1 | nmdc:mga07m45_562253_c1_16_546 | 176 |
| 4 | 3300003792 | Ga0055540_1000069 | Ga0055540_100006917 | 177 |
| 5 | 3300005356 | Ga0070674_101167170 | Ga0070674_1011671701 | 177 |
| 6 | 3300005718 | Ga0068866_10745523 | Ga0068866_107455232 | 177 |
| 7 | 3300006038 | Ga0075365_10053865 | Ga0075365_100538655 | 177 |
| 8 | 3300006048 | Ga0075363_100006732 | Ga0075363_1000067324 | 177 |
| 9 | 3300006048 | Ga0075363_100007027 | Ga0075363_1000070272 | 177 |
| 10 | 3300006048 | Ga0075363_100021612 | Ga0075363_1000216124 | 177 |
| 11 | 3300006048 | Ga0075363_100046445 | Ga0075363_1000464454 | 177 |
| 12 | 3300006048 | Ga0075363_100060771 | Ga0075363_1000607712 | 177 |
| 13 | 3300006051 | Ga0075364_10084983 | Ga0075364_100849834 | 177 |
| 14 | 3300006051 | Ga0075364_10171523 | Ga0075364_101715232 | 177 |
| 15 | 3300006177 | Ga0075362_10082952 | Ga0075362_100829522 | 177 |
| 16 | 3300006178 | Ga0075367_10009450 | Ga0075367_100094504 | 177 |
| 17 | 3300006178 | Ga0075367_10205108 | Ga0075367_102051082 | 177 |
| 18 | 3300006195 | Ga0075366_10041595 | Ga0075366_100415954 | 177 |
| 19 | 3300006353 | Ga0075370_10001730 | Ga0075370_100017309 | 177 |
| 20 | 3300006353 | Ga0075370_10204949 | Ga0075370_102049492 | 177 |
| 21 | 3300009148 | Ga0105243_10346852 | Ga0105243_103468523 | 177 |
| 22 | 3300009148 | Ga0105243_10536032 | Ga0105243_105360322 | 177 |
| 23 | 3300009545 | Ga0105237_10009243 | Ga0105237_1000924310 | 177 |
| 24 | 3300010375 | Ga0105239_10226799 | Ga0105239_102267993 | 177 |
| 25 | 3300025303 | Ga0209051_1000034 | Ga0209051_1000034260 | 177 |
| 26 | 3300025914 | Ga0207671_10007962 | Ga0207671_100079622 | 177 |
| 27 | 3300025927 | Ga0207687_10388950 | Ga0207687_103889501 | 177 |
| 28 | 3300025935 | Ga0207709_10222120 | Ga0207709_102221203 | 177 |
| 29 | 3300025972 | Ga0207668_10516528 | Ga0207668_105165282 | 177 |
| 30 | 3300031251 | Ga0265327_10000863 | Ga0265327_1000086329 | 177 |
| 31 | 3300036647 | Ga0316582_0148085 | Ga0316582_0148085_796_1332 | 177 |
| 32 | 3300036712 | Ga0316584_0072288 | Ga0316584_0072288_424_960 | 177 |
| 33 | 3300042005 | Ga0439448_0011971 | Ga0439448_0011971_148_696 | 177 |
| 34 | 3300044658 | Ga0466972_0002627 | Ga0466972_0002627_3915_4451 | 177 |
| 35 | 3300044683 | Ga0466965_0005113 | Ga0466965_0005113_3946_4482 | 177 |
| 36 | 3300044683 | Ga0466965_0010952 | Ga0466965_0010952_196_744 | 177 |
| 37 | 3300044706 | Ga0466964_0595192 | Ga0466964_0595192_56_592 | 177 |
| 38 | 3300044719 | Ga0466971_0134383 | Ga0466971_0134383_226_762 | 177 |
| 39 | 3300044735 | Ga0466968_0000598 | Ga0466968_0000598_9527_10063 | 177 |
| 40 | 3300044765 | Ga0466970_0056240 | Ga0466970_0056240_1217_1753 | 177 |
| 41 | 3300045836 | Ga0466958_0021717 | Ga0466958_0021717_1272_1808 | 177 |
| 42 | 3300045976 | Ga0466967_0023563 | Ga0466967_0023563_651_1187 | 177 |
| 43 | 3300045976 | Ga0466967_1223308 | Ga0466967_1223308_127_675 | 177 |
| 44 | 3300046457 | Ga0495590_0141688 | Ga0495590_0141688_110_655 | 177 |
| 45 | 3300046519 | Ga0495632_0227157 | Ga0495632_0227157_130_675 | 177 |
| 46 | 3300047472 | Ga0495686_0089225 | Ga0495686_0089225_138_677 | 177 |
| 47 | 3300048903 | Ga0496100_0000175 | Ga0496100_0000175_23348_23896 | 177 |
| 48 | 3300048904 | Ga0496101_0000140 | Ga0496101_0000140_45737_46285 | 177 |
| 49 | 3300048904 | Ga0496101_0026851 | Ga0496101_0026851_3428_3964 | 177 |
| 50 | 3300048905 | Ga0496102_0007713 | Ga0496102_0007713_8322_8870 | 177 |
| 51 | 3300048906 | Ga0496103_0000183 | Ga0496103_0000183_45540_46088 | 177 |
| 52 | 3300048909 | Ga0496106_0001516 | Ga0496106_0001516_10492_11040 | 177 |
| 53 | 3300048910 | Ga0496107_0000145 | Ga0496107_0000145_17591_18139 | 177 |
| 54 | 3300048911 | Ga0496108_0002334 | Ga0496108_0002334_7578_8126 | 177 |
| 55 | 3300048912 | Ga0496109_0000161 | Ga0496109_0000161_47453_48001 | 177 |
| 56 | 3300048912 | Ga0496109_1581695 | Ga0496109_1581695_26_562 | 177 |
| 57 | 3300048913 | Ga0496110_0030964 | Ga0496110_0030964_780_1328 | 177 |
| 58 | 3300048914 | Ga0496111_0006072 | Ga0496111_0006072_968_1516 | 177 |
| 59 | 3300048916 | Ga0496113_0132344 | Ga0496113_0132344_1124_1672 | 177 |
| 60 | 3300048917 | Ga0496114_0022796 | Ga0496114_0022796_2978_3526 | 177 |
| 61 | 3300048918 | Ga0496115_0106818 | Ga0496115_0106818_1158_1706 | 177 |
| 62 | 3300048919 | Ga0496116_0001872 | Ga0496116_0001872_10288_10836 | 177 |
| 63 | 3300048921 | Ga0496118_0009422 | Ga0496118_0009422_993_1541 | 177 |
| 64 | 3300048922 | Ga0496119_0006822 | Ga0496119_0006822_9418_9966 | 177 |
| 65 | 3300048924 | Ga0496121_0000002 | Ga0496121_0000002_586138_586686 | 177 |
| 66 | 3300048924 | Ga0496121_0392835 | Ga0496121_0392835_70_609 | 177 |
| 67 | 3300048925 | Ga0496122_0001055 | Ga0496122_0001055_17648_18196 | 177 |
| 68 | 3300048926 | Ga0496123_0004209 | Ga0496123_0004209_14089_14637 | 177 |
| 69 | 3300048927 | Ga0496124_0000002 | Ga0496124_0000002_907903_908451 | 177 |
| 70 | 3300048928 | Ga0496125_0000002 | Ga0496125_0000002_586138_586686 | 177 |
| 71 | 3300048929 | Ga0496126_0000009 | Ga0496126_0000009_163665_164213 | 177 |
| 72 | 3300048929 | Ga0496126_0129440 | Ga0496126_0129440_735_1274 | 177 |
| 73 | 3300049581 | Ga0501047_0013760 | Ga0501047_0013760_4742_5281 | 177 |
| 74 | 3300049823 | Ga0501044_0211389 | Ga0501044_0211389_1254_1790 | 177 |
| 75 | 3300050489 | nmdc:mga03683_299986_c1 | nmdc:mga03683_299986_c1_185_727 | 177 |
| 76 | 3300050489 | nmdc:mga03683_50048_c1 | nmdc:mga03683_50048_c1_965_1513 | 177 |
| 77 | 3300050490 | nmdc:mga03n38_105_c2 | nmdc:mga03n38_105_c2_8593_9135 | 177 |
| 78 | 3300050490 | nmdc:mga03n38_37714_c1 | nmdc:mga03n38_37714_c1_1120_1668 | 177 |
| 79 | 3300050491 | nmdc:mga00v17_160552_c1 | nmdc:mga00v17_160552_c1_534_1082 | 177 |
| 80 | 3300050491 | nmdc:mga00v17_242369_c1 | nmdc:mga00v17_242369_c1_34_570 | 177 |
| 81 | 3300050491 | nmdc:mga00v17_2898_c1 | nmdc:mga00v17_2898_c1_3405_3947 | 177 |
| 82 | 3300050492 | nmdc:mga0yw44_211392_c1 | nmdc:mga0yw44_211392_c1_369_911 | 177 |
| 83 | 3300050492 | nmdc:mga0yw44_33090_c1 | nmdc:mga0yw44_33090_c1_2075_2623 | 177 |
| 84 | 3300050492 | nmdc:mga0yw44_73034_c1 | nmdc:mga0yw44_73034_c1_571_1119 | 177 |
| 85 | 3300050493 | nmdc:mga0k408_52408_c1 | nmdc:mga0k408_52408_c1_910_1458 | 177 |
| 86 | 3300050494 | nmdc:mga06z11_11854_c1 | nmdc:mga06z11_11854_c1_2415_2963 | 177 |
| 87 | 3300050494 | nmdc:mga06z11_373876_c1 | nmdc:mga06z11_373876_c1_288_830 | 177 |
| 88 | 3300050496 | nmdc:mga07m45_24226_c1 | nmdc:mga07m45_24226_c1_1401_1949 | 177 |
| 89 | 3300050496 | nmdc:mga07m45_447232_c1 | nmdc:mga07m45_447232_c1_190_738 | 177 |
| 90 | 3300050496 | nmdc:mga07m45_781_c1 | nmdc:mga07m45_781_c1_4359_4901 | 177 |
| 91 | 3300050516 | nmdc:mga0sz30_68145_c1 | nmdc:mga0sz30_68145_c1_336_884 | 177 |
| 92 | 3300053096 | Ga0500641_0013855 | Ga0500641_0013855_469_1008 | 177 |
| 93 | 3300053119 | Ga0500595_107564 | Ga0500595_107564_172_711 | 177 |
| 94 | 3300053122 | Ga0500608_034736 | Ga0500608_034736_570_1109 | 177 |
| 95 | 3300053130 | Ga0500642_0101457 | Ga0500642_0101457_359_898 | 177 |
| 96 | 3300053158 | Ga0500627_0015617 | Ga0500627_0015617_1555_2094 | 177 |
| 97 | iso_pu_bacteria | 2643221687 | 2644487305 | 177 |
| 98 | iso_pu_bacteria | 2643221715 | 2644638919 | 177 |
| 99 | iso_pu_bacteria | 2738541264 | 2738665826 | 177 |
| 100 | iso_pu_bacteria | 2738541356 | 2739144960 | 177 |
| 101 | iso_pu_bacteria | 2902792274 | 2902794467 | 177 |
| 102 | iso_pu_bacteria | 2902810491 | 2902814044 | 177 |
| 103 | iso_pu_bacteria | 2902837492 | 2902839411 | 177 |
| 104 | iso_pu_bacteria | 2939582691 | 2939587067 | 177 |
| 105 | iso_pu_bacteria | 2929212328 | 2929213215 | 178 |
| 106 | 3300005435 | Ga0070714_100692430 | Ga0070714_1006924302 | 179 |
| 107 | 3300014968 | Ga0157379_10342422 | Ga0157379_103424222 | 179 |
| 108 | 3300031901 | Ga0307406_10154754 | Ga0307406_101547543 | 179 |
| 109 | 3300041410 | Ga0439461_0000532 | Ga0439461_0000532_4875_5423 | 179 |
| 110 | 3300041411 | Ga0439466_0003885 | Ga0439466_0003885_2877_3425 | 179 |
| 111 | 3300041997 | Ga0439431_0000332 | Ga0439431_0000332_560_1108 | 179 |
| 112 | 3300042004 | Ga0439445_0020061 | Ga0439445_0020061_970_1518 | 179 |
| 113 | 3300042435 | Ga0439434_0014234 | Ga0439434_0014234_1459_2007 | 179 |
| 114 | 3300045976 | Ga0466967_0216469 | Ga0466967_0216469_864_1436 | 179 |
| 115 | 3300049586 | Ga0501070_0097477 | Ga0501070_0097477_1001_1546 | 179 |
| 116 | 3300002074 | JGI24748J21848_1021658 | JGI24748J21848_10216581 | 180 |
| 117 | 3300002076 | JGI24749J21850_1044967 | JGI24749J21850_10449671 | 180 |
| 118 | 3300002077 | JGI24744J21845_10006371 | JGI24744J21845_100063714 | 180 |
| 119 | 3300002077 | JGI24744J21845_10051303 | JGI24744J21845_100513031 | 180 |
| 120 | 3300002244 | JGI24742J22300_10009284 | JGI24742J22300_100092842 | 180 |
| 121 | 3300002459 | JGI24751J29686_10005220 | JGI24751J29686_100052202 | 180 |
| 122 | 3300003792 | Ga0055540_1001260 | Ga0055540_10012604 | 180 |
| 123 | 3300003792 | Ga0055540_1004053 | Ga0055540_10040535 | 180 |
| 124 | 3300003792 | Ga0055540_1004594 | Ga0055540_10045943 | 180 |
| 125 | 3300005327 | Ga0070658_10511199 | Ga0070658_105111992 | 180 |
| 126 | 3300005328 | Ga0070676_10003963 | Ga0070676_100039633 | 180 |
| 127 | 3300005329 | Ga0070683_100330333 | Ga0070683_1003303332 | 180 |
| 128 | 3300005330 | Ga0070690_100009234 | Ga0070690_1000092343 | 180 |
| 129 | 3300005330 | Ga0070690_100121706 | Ga0070690_1001217062 | 180 |
| 130 | 3300005334 | Ga0068869_100023500 | Ga0068869_1000235003 | 180 |
| 131 | 3300005334 | Ga0068869_100632634 | Ga0068869_1006326341 | 180 |
| 132 | 3300005335 | Ga0070666_10072822 | Ga0070666_100728223 | 180 |
| 133 | 3300005337 | Ga0070682_100003677 | Ga0070682_1000036776 | 180 |
| 134 | 3300005337 | Ga0070682_100023610 | Ga0070682_1000236102 | 180 |
| 135 | 3300005337 | Ga0070682_100034675 | Ga0070682_1000346752 | 180 |
| 136 | 3300005337 | Ga0070682_100082726 | Ga0070682_1000827262 | 180 |
| 137 | 3300005338 | Ga0068868_100002600 | Ga0068868_10000260011 | 180 |
| 138 | 3300005338 | Ga0068868_100270514 | Ga0068868_1002705142 | 180 |
| 139 | 3300005339 | Ga0070660_100421131 | Ga0070660_1004211312 | 180 |
| 140 | 3300005339 | Ga0070660_100752844 | Ga0070660_1007528441 | 180 |
| 141 | 3300005340 | Ga0070689_100016154 | Ga0070689_1000161544 | 180 |
| 142 | 3300005340 | Ga0070689_100690107 | Ga0070689_1006901071 | 180 |
| 143 | 3300005341 | Ga0070691_10008626 | Ga0070691_100086264 | 180 |
| 144 | 3300005345 | Ga0070692_10236015 | Ga0070692_102360151 | 180 |
| 145 | 3300005347 | Ga0070668_100009899 | Ga0070668_1000098993 | 180 |
| 146 | 3300005353 | Ga0070669_100013393 | Ga0070669_1000133934 | 180 |
| 147 | 3300005355 | Ga0070671_100058365 | Ga0070671_1000583652 | 180 |
| 148 | 3300005355 | Ga0070671_100080582 | Ga0070671_1000805822 | 180 |
| 149 | 3300005356 | Ga0070674_100006416 | Ga0070674_1000064163 | 180 |
| 150 | 3300005356 | Ga0070674_100017420 | Ga0070674_1000174203 | 180 |
| 151 | 3300005364 | Ga0070673_100227477 | Ga0070673_1002274772 | 180 |
| 152 | 3300005365 | Ga0070688_100160796 | Ga0070688_1001607963 | 180 |
| 153 | 3300005365 | Ga0070688_100635393 | Ga0070688_1006353931 | 180 |
| 154 | 3300005366 | Ga0070659_100047018 | Ga0070659_1000470184 | 180 |
| 155 | 3300005366 | Ga0070659_100198442 | Ga0070659_1001984421 | 180 |
| 156 | 3300005366 | Ga0070659_100588875 | Ga0070659_1005888751 | 180 |
| 157 | 3300005367 | Ga0070667_100000944 | Ga0070667_10000094422 | 180 |
| 158 | 3300005367 | Ga0070667_100005025 | Ga0070667_1000050253 | 180 |
| 159 | 3300005367 | Ga0070667_100257126 | Ga0070667_1002571262 | 180 |
| 160 | 3300005367 | Ga0070667_100561731 | Ga0070667_1005617312 | 180 |
| 161 | 3300005406 | Ga0070703_10274915 | Ga0070703_102749151 | 180 |
| 162 | 3300005434 | Ga0070709_10006545 | Ga0070709_100065457 | 180 |
| 163 | 3300005434 | Ga0070709_10056358 | Ga0070709_100563584 | 180 |
| 164 | 3300005435 | Ga0070714_101058750 | Ga0070714_1010587502 | 180 |
| 165 | 3300005437 | Ga0070710_10000645 | Ga0070710_1000064514 | 180 |
| 166 | 3300005437 | Ga0070710_10005502 | Ga0070710_100055021 | 180 |
| 167 | 3300005438 | Ga0070701_10000931 | Ga0070701_100009317 | 180 |
| 168 | 3300005438 | Ga0070701_10251777 | Ga0070701_102517771 | 180 |
| 169 | 3300005439 | Ga0070711_100010668 | Ga0070711_1000106685 | 180 |
| 170 | 3300005439 | Ga0070711_100011474 | Ga0070711_1000114744 | 180 |
| 171 | 3300005440 | Ga0070705_100002344 | Ga0070705_1000023443 | 180 |
| 172 | 3300005444 | Ga0070694_100212468 | Ga0070694_1002124682 | 180 |
| 173 | 3300005455 | Ga0070663_100192690 | Ga0070663_1001926902 | 180 |
| 174 | 3300005455 | Ga0070663_100344878 | Ga0070663_1003448781 | 180 |
| 175 | 3300005455 | Ga0070663_100559335 | Ga0070663_1005593352 | 180 |
| 176 | 3300005456 | Ga0070678_100000622 | Ga0070678_1000006227 | 180 |
| 177 | 3300005456 | Ga0070678_100017035 | Ga0070678_1000170353 | 180 |
| 178 | 3300005457 | Ga0070662_100043042 | Ga0070662_1000430422 | 180 |
| 179 | 3300005457 | Ga0070662_100199572 | Ga0070662_1001995723 | 180 |
| 180 | 3300005457 | Ga0070662_101148231 | Ga0070662_1011482311 | 180 |
| 181 | 3300005459 | Ga0068867_100003304 | Ga0068867_10000330413 | 180 |
| 182 | 3300005466 | Ga0070685_10034127 | Ga0070685_100341272 | 180 |
| 183 | 3300005466 | Ga0070685_10121412 | Ga0070685_101214122 | 180 |
| 184 | 3300005466 | Ga0070685_10282394 | Ga0070685_102823942 | 180 |
| 185 | 3300005530 | Ga0070679_100985039 | Ga0070679_1009850391 | 180 |
| 186 | 3300005539 | Ga0068853_100006099 | Ga0068853_1000060996 | 180 |
| 187 | 3300005539 | Ga0068853_100020960 | Ga0068853_1000209604 | 180 |
| 188 | 3300005539 | Ga0068853_100131019 | Ga0068853_1001310192 | 180 |
| 189 | 3300005539 | Ga0068853_100147086 | Ga0068853_1001470862 | 180 |
| 190 | 3300005543 | Ga0070672_100257148 | Ga0070672_1002571484 | 180 |
| 191 | 3300005544 | Ga0070686_100181544 | Ga0070686_1001815442 | 180 |
| 192 | 3300005544 | Ga0070686_100340511 | Ga0070686_1003405111 | 180 |
| 193 | 3300005545 | Ga0070695_100003039 | Ga0070695_1000030397 | 180 |
| 194 | 3300005546 | Ga0070696_100051969 | Ga0070696_1000519694 | 180 |
| 195 | 3300005546 | Ga0070696_100365673 | Ga0070696_1003656732 | 180 |
| 196 | 3300005547 | Ga0070693_100002346 | Ga0070693_1000023464 | 180 |
| 197 | 3300005547 | Ga0070693_100015757 | Ga0070693_1000157573 | 180 |
| 198 | 3300005548 | Ga0070665_100008523 | Ga0070665_1000085234 | 180 |
| 199 | 3300005548 | Ga0070665_100015799 | Ga0070665_1000157994 | 180 |
| 200 | 3300005548 | Ga0070665_100164165 | Ga0070665_1001641652 | 180 |
| 201 | 3300005548 | Ga0070665_101567020 | Ga0070665_1015670201 | 180 |
| 202 | 3300005549 | Ga0070704_100002151 | Ga0070704_10000215110 | 180 |
| 203 | 3300005549 | Ga0070704_100093664 | Ga0070704_1000936642 | 180 |
| 204 | 3300005563 | Ga0068855_100596243 | Ga0068855_1005962433 | 180 |
| 205 | 3300005578 | Ga0068854_100016216 | Ga0068854_1000162164 | 180 |
| 206 | 3300005578 | Ga0068854_100247338 | Ga0068854_1002473382 | 180 |
| 207 | 3300005614 | Ga0068856_100290231 | Ga0068856_1002902313 | 180 |
| 208 | 3300005614 | Ga0068856_100886618 | Ga0068856_1008866182 | 180 |
| 209 | 3300005615 | Ga0070702_100006886 | Ga0070702_1000068863 | 180 |
| 210 | 3300005615 | Ga0070702_100203453 | Ga0070702_1002034532 | 180 |
| 211 | 3300005616 | Ga0068852_100088692 | Ga0068852_1000886925 | 180 |
| 212 | 3300005617 | Ga0068859_100005667 | Ga0068859_1000056679 | 180 |
| 213 | 3300005617 | Ga0068859_100968782 | Ga0068859_1009687822 | 180 |
| 214 | 3300005718 | Ga0068866_10000756 | Ga0068866_100007567 | 180 |
| 215 | 3300005718 | Ga0068866_10595507 | Ga0068866_105955072 | 180 |
| 216 | 3300005719 | Ga0068861_100002048 | Ga0068861_1000020487 | 180 |
| 217 | 3300005719 | Ga0068861_100118955 | Ga0068861_1001189552 | 180 |
| 218 | 3300005719 | Ga0068861_100185551 | Ga0068861_1001855512 | 180 |
| 219 | 3300005834 | Ga0068851_10094108 | Ga0068851_100941082 | 180 |
| 220 | 3300005840 | Ga0068870_10119918 | Ga0068870_101199182 | 180 |
| 221 | 3300005841 | Ga0068863_100052602 | Ga0068863_1000526023 | 180 |
| 222 | 3300005842 | Ga0068858_100019623 | Ga0068858_1000196237 | 180 |
| 223 | 3300005842 | Ga0068858_100054621 | Ga0068858_1000546217 | 180 |
| 224 | 3300005843 | Ga0068860_100079147 | Ga0068860_1000791473 | 180 |
| 225 | 3300005843 | Ga0068860_100898994 | Ga0068860_1008989942 | 180 |
| 226 | 3300005844 | Ga0068862_100006801 | Ga0068862_1000068019 | 180 |
| 227 | 3300005937 | Ga0081455_10060979 | Ga0081455_100609793 | 180 |
| 228 | 3300005937 | Ga0081455_10158768 | Ga0081455_101587683 | 180 |
| 229 | 3300005981 | Ga0081538_10107119 | Ga0081538_101071192 | 180 |
| 230 | 3300005981 | Ga0081538_10125506 | Ga0081538_101255062 | 180 |
| 231 | 3300006038 | Ga0075365_10012814 | Ga0075365_100128143 | 180 |
| 232 | 3300006038 | Ga0075365_10088972 | Ga0075365_100889724 | 180 |
| 233 | 3300006048 | Ga0075363_100007612 | Ga0075363_1000076124 | 180 |
| 234 | 3300006048 | Ga0075363_100011994 | Ga0075363_1000119943 | 180 |
| 235 | 3300006048 | Ga0075363_100022180 | Ga0075363_1000221804 | 180 |
| 236 | 3300006048 | Ga0075363_100104478 | Ga0075363_1001044782 | 180 |
| 237 | 3300006048 | Ga0075363_100277709 | Ga0075363_1002777092 | 180 |
| 238 | 3300006051 | Ga0075364_10037435 | Ga0075364_100374352 | 180 |
| 239 | 3300006163 | Ga0070715_10030790 | Ga0070715_100307902 | 180 |
| 240 | 3300006173 | Ga0070716_100018843 | Ga0070716_1000188433 | 180 |
| 241 | 3300006173 | Ga0070716_100319920 | Ga0070716_1003199202 | 180 |
| 242 | 3300006175 | Ga0070712_100001133 | Ga0070712_1000011335 | 180 |
| 243 | 3300006175 | Ga0070712_100164174 | Ga0070712_1001641742 | 180 |
| 244 | 3300006177 | Ga0075362_10167011 | Ga0075362_101670112 | 180 |
| 245 | 3300006178 | Ga0075367_10066209 | Ga0075367_100662091 | 180 |
| 246 | 3300006178 | Ga0075367_10103776 | Ga0075367_101037762 | 180 |
| 247 | 3300006178 | Ga0075367_10250541 | Ga0075367_102505412 | 180 |
| 248 | 3300006186 | Ga0075369_10003220 | Ga0075369_100032205 | 180 |
| 249 | 3300006186 | Ga0075369_10003235 | Ga0075369_100032352 | 180 |
| 250 | 3300006186 | Ga0075369_10006370 | Ga0075369_100063707 | 180 |
| 251 | 3300006186 | Ga0075369_10013356 | Ga0075369_100133562 | 180 |
| 252 | 3300006186 | Ga0075369_10046748 | Ga0075369_100467484 | 180 |
| 253 | 3300006237 | Ga0097621_100021994 | Ga0097621_1000219943 | 180 |
| 254 | 3300006237 | Ga0097621_101130765 | Ga0097621_1011307651 | 180 |
| 255 | 3300006353 | Ga0075370_10069773 | Ga0075370_100697733 | 180 |
| 256 | 3300006358 | Ga0068871_100213781 | Ga0068871_1002137812 | 180 |
| 257 | 3300006358 | Ga0068871_100551703 | Ga0068871_1005517031 | 180 |
| 258 | 3300006844 | Ga0075428_100007609 | Ga0075428_1000076094 | 180 |
| 259 | 3300006846 | Ga0075430_100015847 | Ga0075430_1000158472 | 180 |
| 260 | 3300006847 | Ga0075431_100631371 | Ga0075431_1006313712 | 180 |
| 261 | 3300006871 | Ga0075434_100786084 | Ga0075434_1007860841 | 180 |
| 262 | 3300006871 | Ga0075434_101048318 | Ga0075434_1010483182 | 180 |
| 263 | 3300006881 | Ga0068865_100013935 | Ga0068865_1000139353 | 180 |
| 264 | 3300006931 | Ga0097620_100005667 | Ga0097620_1000056679 | 180 |
| 265 | 3300006931 | Ga0097620_100968713 | Ga0097620_1009687132 | 180 |
| 266 | 3300007788 | Ga0099795_10021478 | Ga0099795_100214783 | 180 |
| 267 | 3300009098 | Ga0105245_10023517 | Ga0105245_100235174 | 180 |
| 268 | 3300009098 | Ga0105245_10172380 | Ga0105245_101723804 | 180 |
| 269 | 3300009098 | Ga0105245_10835300 | Ga0105245_108353002 | 180 |
| 270 | 3300009101 | Ga0105247_10001481 | Ga0105247_1000148113 | 180 |
| 271 | 3300009101 | Ga0105247_10062423 | Ga0105247_100624236 | 180 |
| 272 | 3300009101 | Ga0105247_10785381 | Ga0105247_107853812 | 180 |
| 273 | 3300009147 | Ga0114129_10348679 | Ga0114129_103486794 | 180 |
| 274 | 3300009148 | Ga0105243_10001598 | Ga0105243_1000159811 | 180 |
| 275 | 3300009174 | Ga0105241_10115150 | Ga0105241_101151502 | 180 |
| 276 | 3300009174 | Ga0105241_10622755 | Ga0105241_106227552 | 180 |
| 277 | 3300009176 | Ga0105242_10026490 | Ga0105242_100264903 | 180 |
| 278 | 3300009176 | Ga0105242_11533632 | Ga0105242_115336321 | 180 |
| 279 | 3300009177 | Ga0105248_10018191 | Ga0105248_100181916 | 180 |
| 280 | 3300009177 | Ga0105248_10032663 | Ga0105248_100326638 | 180 |
| 281 | 3300009177 | Ga0105248_10117672 | Ga0105248_101176722 | 180 |
| 282 | 3300009177 | Ga0105248_10290191 | Ga0105248_102901912 | 180 |
| 283 | 3300009177 | Ga0105248_11563268 | Ga0105248_115632681 | 180 |
| 284 | 3300009545 | Ga0105237_10049359 | Ga0105237_100493597 | 180 |
| 285 | 3300009551 | Ga0105238_10072625 | Ga0105238_100726253 | 180 |
| 286 | 3300009553 | Ga0105249_10003095 | Ga0105249_100030957 | 180 |
| 287 | 3300009553 | Ga0105249_10843607 | Ga0105249_108436072 | 180 |
| 288 | 3300010375 | Ga0105239_10001018 | Ga0105239_100010189 | 180 |
| 289 | 3300010375 | Ga0105239_10107756 | Ga0105239_101077562 | 180 |
| 290 | 3300010375 | Ga0105239_10108882 | Ga0105239_101088822 | 180 |
| 291 | 3300010375 | Ga0105239_10395357 | Ga0105239_103953574 | 180 |
| 292 | 3300010375 | Ga0105239_10707330 | Ga0105239_107073301 | 180 |
| 293 | 3300011119 | Ga0105246_10024745 | Ga0105246_100247453 | 180 |
| 294 | 3300011119 | Ga0105246_10548943 | Ga0105246_105489431 | 180 |
| 295 | 3300013105 | Ga0157369_10224956 | Ga0157369_102249562 | 180 |
| 296 | 3300013296 | Ga0157374_10080946 | Ga0157374_100809466 | 180 |
| 297 | 3300013296 | Ga0157374_10281356 | Ga0157374_102813562 | 180 |
| 298 | 3300013297 | Ga0157378_10011978 | Ga0157378_100119786 | 180 |
| 299 | 3300013306 | Ga0163162_10050817 | Ga0163162_100508173 | 180 |
| 300 | 3300013306 | Ga0163162_10143195 | Ga0163162_101431952 | 180 |
| 301 | 3300013306 | Ga0163162_10250845 | Ga0163162_102508452 | 180 |
| 302 | 3300013306 | Ga0163162_10620518 | Ga0163162_106205182 | 180 |
| 303 | 3300013307 | Ga0157372_10008420 | Ga0157372_100084204 | 180 |
| 304 | 3300013308 | Ga0157375_10001902 | Ga0157375_100019027 | 180 |
| 305 | 3300013308 | Ga0157375_10068914 | Ga0157375_100689142 | 180 |
| 306 | 3300013308 | Ga0157375_10445174 | Ga0157375_104451741 | 180 |
| 307 | 3300013308 | Ga0157375_10716601 | Ga0157375_107166012 | 180 |
| 308 | 3300014325 | Ga0163163_10063814 | Ga0163163_100638144 | 180 |
| 309 | 3300014325 | Ga0163163_11175625 | Ga0163163_111756252 | 180 |
| 310 | 3300014326 | Ga0157380_10014952 | Ga0157380_100149526 | 180 |
| 311 | 3300014326 | Ga0157380_10133694 | Ga0157380_101336943 | 180 |
| 312 | 3300014326 | Ga0157380_10145695 | Ga0157380_101456952 | 180 |
| 313 | 3300014745 | Ga0157377_10143130 | Ga0157377_101431302 | 180 |
| 314 | 3300014968 | Ga0157379_10241954 | Ga0157379_102419542 | 180 |
| 315 | 3300014968 | Ga0157379_10339071 | Ga0157379_103390713 | 180 |
| 316 | 3300014968 | Ga0157379_10765006 | Ga0157379_107650062 | 180 |
| 317 | 3300014969 | Ga0157376_10017806 | Ga0157376_100178063 | 180 |
| 318 | 3300014969 | Ga0157376_10087394 | Ga0157376_100873943 | 180 |
| 319 | 3300014969 | Ga0157376_10412153 | Ga0157376_104121532 | 180 |
| 320 | 3300017792 | Ga0163161_10001691 | Ga0163161_1000169110 | 180 |
| 321 | 3300025273 | Ga0209673_1020913 | Ga0209673_10209133 | 180 |
| 322 | 3300025303 | Ga0209051_1000478 | Ga0209051_100047842 | 180 |
| 323 | 3300025303 | Ga0209051_1002514 | Ga0209051_10025143 | 180 |
| 324 | 3300025303 | Ga0209051_1007549 | Ga0209051_10075496 | 180 |
| 325 | 3300025711 | Ga0207696_1073071 | Ga0207696_10730711 | 180 |
| 326 | 3300025885 | Ga0207653_10101397 | Ga0207653_101013972 | 180 |
| 327 | 3300025898 | Ga0207692_10008286 | Ga0207692_100082862 | 180 |
| 328 | 3300025898 | Ga0207692_10289649 | Ga0207692_102896492 | 180 |
| 329 | 3300025899 | Ga0207642_10000759 | Ga0207642_100007593 | 180 |
| 330 | 3300025900 | Ga0207710_10015573 | Ga0207710_100155732 | 180 |
| 331 | 3300025900 | Ga0207710_10178977 | Ga0207710_101789772 | 180 |
| 332 | 3300025901 | Ga0207688_10000800 | Ga0207688_100008003 | 180 |
| 333 | 3300025901 | Ga0207688_10001392 | Ga0207688_1000139210 | 180 |
| 334 | 3300025901 | Ga0207688_10082013 | Ga0207688_100820132 | 180 |
| 335 | 3300025901 | Ga0207688_10257250 | Ga0207688_102572502 | 180 |
| 336 | 3300025903 | Ga0207680_10020950 | Ga0207680_100209503 | 180 |
| 337 | 3300025904 | Ga0207647_10209396 | Ga0207647_102093962 | 180 |
| 338 | 3300025906 | Ga0207699_10186830 | Ga0207699_101868302 | 180 |
| 339 | 3300025907 | Ga0207645_10008279 | Ga0207645_100082796 | 180 |
| 340 | 3300025908 | Ga0207643_10025005 | Ga0207643_100250052 | 180 |
| 341 | 3300025914 | Ga0207671_10160399 | Ga0207671_101603992 | 180 |
| 342 | 3300025915 | Ga0207693_10004684 | Ga0207693_100046846 | 180 |
| 343 | 3300025915 | Ga0207693_10019343 | Ga0207693_100193435 | 180 |
| 344 | 3300025916 | Ga0207663_10003448 | Ga0207663_100034484 | 180 |
| 345 | 3300025918 | Ga0207662_10116357 | Ga0207662_101163573 | 180 |
| 346 | 3300025919 | Ga0207657_10219002 | Ga0207657_102190023 | 180 |
| 347 | 3300025923 | Ga0207681_10025164 | Ga0207681_100251643 | 180 |
| 348 | 3300025927 | Ga0207687_10029352 | Ga0207687_100293523 | 180 |
| 349 | 3300025927 | Ga0207687_10451860 | Ga0207687_104518602 | 180 |
| 350 | 3300025931 | Ga0207644_10013355 | Ga0207644_100133555 | 180 |
| 351 | 3300025931 | Ga0207644_10176622 | Ga0207644_101766222 | 180 |
| 352 | 3300025932 | Ga0207690_10671898 | Ga0207690_106718982 | 180 |
| 353 | 3300025933 | Ga0207706_10004948 | Ga0207706_100049485 | 180 |
| 354 | 3300025933 | Ga0207706_10006772 | Ga0207706_1000677213 | 180 |
| 355 | 3300025934 | Ga0207686_10021012 | Ga0207686_100210125 | 180 |
| 356 | 3300025934 | Ga0207686_10025138 | Ga0207686_100251383 | 180 |
| 357 | 3300025935 | Ga0207709_10002953 | Ga0207709_1000295312 | 180 |
| 358 | 3300025937 | Ga0207669_10022587 | Ga0207669_100225873 | 180 |
| 359 | 3300025938 | Ga0207704_10020736 | Ga0207704_100207363 | 180 |
| 360 | 3300025939 | Ga0207665_10001283 | Ga0207665_100012834 | 180 |
| 361 | 3300025939 | Ga0207665_10006794 | Ga0207665_1000679410 | 180 |
| 362 | 3300025940 | Ga0207691_10188716 | Ga0207691_101887164 | 180 |
| 363 | 3300025941 | Ga0207711_10055328 | Ga0207711_100553283 | 180 |
| 364 | 3300025941 | Ga0207711_10299405 | Ga0207711_102994052 | 180 |
| 365 | 3300025941 | Ga0207711_10468186 | Ga0207711_104681864 | 180 |
| 366 | 3300025942 | Ga0207689_10023810 | Ga0207689_100238104 | 180 |
| 367 | 3300025944 | Ga0207661_10533234 | Ga0207661_105332342 | 180 |
| 368 | 3300025949 | Ga0207667_10076280 | Ga0207667_100762803 | 180 |
| 369 | 3300025949 | Ga0207667_10727683 | Ga0207667_107276832 | 180 |
| 370 | 3300025960 | Ga0207651_10130714 | Ga0207651_101307143 | 180 |
| 371 | 3300025960 | Ga0207651_10367449 | Ga0207651_103674492 | 180 |
| 372 | 3300025961 | Ga0207712_10056986 | Ga0207712_100569862 | 180 |
| 373 | 3300025961 | Ga0207712_10125671 | Ga0207712_101256712 | 180 |
| 374 | 3300025972 | Ga0207668_10002928 | Ga0207668_1000292810 | 180 |
| 375 | 3300025972 | Ga0207668_10042692 | Ga0207668_100426921 | 180 |
| 376 | 3300025981 | Ga0207640_10003175 | Ga0207640_100031759 | 180 |
| 377 | 3300025981 | Ga0207640_11076708 | Ga0207640_110767081 | 180 |
| 378 | 3300025986 | Ga0207658_10002139 | Ga0207658_100021397 | 180 |
| 379 | 3300025986 | Ga0207658_10050918 | Ga0207658_100509183 | 180 |
| 380 | 3300025986 | Ga0207658_10076485 | Ga0207658_100764852 | 180 |
| 381 | 3300025986 | Ga0207658_10232524 | Ga0207658_102325242 | 180 |
| 382 | 3300025986 | Ga0207658_10327781 | Ga0207658_103277812 | 180 |
| 383 | 3300026023 | Ga0207677_10008137 | Ga0207677_100081375 | 180 |
| 384 | 3300026023 | Ga0207677_10359725 | Ga0207677_103597252 | 180 |
| 385 | 3300026035 | Ga0207703_10003076 | Ga0207703_1000307612 | 180 |
| 386 | 3300026035 | Ga0207703_10093069 | Ga0207703_100930694 | 180 |
| 387 | 3300026035 | Ga0207703_10201322 | Ga0207703_102013222 | 180 |
| 388 | 3300026035 | Ga0207703_10414246 | Ga0207703_104142462 | 180 |
| 389 | 3300026041 | Ga0207639_10013377 | Ga0207639_100133773 | 180 |
| 390 | 3300026041 | Ga0207639_10034452 | Ga0207639_100344523 | 180 |
| 391 | 3300026041 | Ga0207639_10147672 | Ga0207639_101476722 | 180 |
| 392 | 3300026041 | Ga0207639_10392549 | Ga0207639_103925492 | 180 |
| 393 | 3300026067 | Ga0207678_10002992 | Ga0207678_100029924 | 180 |
| 394 | 3300026067 | Ga0207678_10049345 | Ga0207678_100493454 | 180 |
| 395 | 3300026067 | Ga0207678_10079587 | Ga0207678_100795874 | 180 |
| 396 | 3300026067 | Ga0207678_10318717 | Ga0207678_103187172 | 180 |
| 397 | 3300026075 | Ga0207708_10007438 | Ga0207708_100074389 | 180 |
| 398 | 3300026075 | Ga0207708_10034824 | Ga0207708_100348243 | 180 |
| 399 | 3300026078 | Ga0207702_10543826 | Ga0207702_105438262 | 180 |
| 400 | 3300026078 | Ga0207702_10844443 | Ga0207702_108444432 | 180 |
| 401 | 3300026088 | Ga0207641_10019027 | Ga0207641_100190272 | 180 |
| 402 | 3300026089 | Ga0207648_10001849 | Ga0207648_1000184913 | 180 |
| 403 | 3300026089 | Ga0207648_10019514 | Ga0207648_100195145 | 180 |
| 404 | 3300026095 | Ga0207676_10087144 | Ga0207676_100871442 | 180 |
| 405 | 3300026095 | Ga0207676_10367807 | Ga0207676_103678073 | 180 |
| 406 | 3300026118 | Ga0207675_100009494 | Ga0207675_1000094946 | 180 |
| 407 | 3300026118 | Ga0207675_100201461 | Ga0207675_1002014614 | 180 |
| 408 | 3300026121 | Ga0207683_10004741 | Ga0207683_100047414 | 180 |
| 409 | 3300026121 | Ga0207683_10401461 | Ga0207683_104014612 | 180 |
| 410 | 3300026142 | Ga0207698_10047260 | Ga0207698_100472603 | 180 |
| 411 | 3300026142 | Ga0207698_10450323 | Ga0207698_104503232 | 180 |
| 412 | 3300026142 | Ga0207698_10478924 | Ga0207698_104789242 | 180 |
| 413 | 3300028379 | Ga0268266_10002437 | Ga0268266_1000243716 | 180 |
| 414 | 3300028379 | Ga0268266_10063227 | Ga0268266_100632273 | 180 |
| 415 | 3300028380 | Ga0268265_10160579 | Ga0268265_101605793 | 180 |
| 416 | 3300028381 | Ga0268264_10002313 | Ga0268264_100023132 | 180 |
| 417 | 3300028381 | Ga0268264_11482925 | Ga0268264_114829251 | 180 |
| 418 | 3300031824 | Ga0307413_10160587 | Ga0307413_101605872 | 180 |
| 419 | 3300031852 | Ga0307410_10050557 | Ga0307410_100505572 | 180 |
| 420 | 3300031852 | Ga0307410_10089870 | Ga0307410_100898701 | 180 |
| 421 | 3300031852 | Ga0307410_10797242 | Ga0307410_107972421 | 180 |
| 422 | 3300031995 | Ga0307409_100021152 | Ga0307409_1000211522 | 180 |
| 423 | 3300032004 | Ga0307414_10309168 | Ga0307414_103091681 | 180 |
| 424 | 3300032126 | Ga0307415_100275877 | Ga0307415_1002758772 | 180 |
| 425 | 3300034957 | Ga0373938_0079066 | Ga0373938_0079066_14_589 | 180 |
| 426 | 3300035088 | Ga0373940_0126999 | Ga0373940_0126999_150_725 | 180 |
| 427 | 3300035091 | Ga0373951_0024188 | Ga0373951_0024188_62_637 | 180 |
| 428 | 3300035691 | Ga0373931_0101837 | Ga0373931_0101837_591_1133 | 180 |
| 429 | 3300035691 | Ga0373931_0176249 | Ga0373931_0176249_130_705 | 180 |
| 430 | 3300035695 | Ga0373927_0715856 | Ga0373927_0715856_82_627 | 180 |
| 431 | 3300038443 | Ga0395901_0734921 | Ga0395901_0734921_286_861 | 180 |
| 432 | 3300039450 | Ga0436363_1376696 | Ga0436363_1376696_1143_1688 | 180 |
| 433 | 3300041410 | Ga0439461_0007032 | Ga0439461_0007032_430_972 | 180 |
| 434 | 3300041410 | Ga0439461_0010928 | Ga0439461_0010928_1119_1661 | 180 |
| 435 | 3300041413 | Ga0439465_0002775 | Ga0439465_0002775_1070_1612 | 180 |
| 436 | 3300041413 | Ga0439465_0004364 | Ga0439465_0004364_217_759 | 180 |
| 437 | 3300041443 | Ga0451789_0587683 | Ga0451789_0587683_179_733 | 180 |
| 438 | 3300041452 | Ga0451793_1165290 | Ga0451793_1165290_307_861 | 180 |
| 439 | 3300041456 | Ga0451795_0480540 | Ga0451795_0480540_1024_1578 | 180 |
| 440 | 3300041486 | Ga0451807_2720499 | Ga0451807_2720499_22_576 | 180 |
| 441 | 3300041512 | Ga0451853_3778465 | Ga0451853_3778465_76_621 | 180 |
| 442 | 3300041997 | Ga0439431_0003038 | Ga0439431_0003038_392_934 | 180 |
| 443 | 3300042002 | Ga0439442_008866 | Ga0439442_008866_777_1319 | 180 |
| 444 | 3300042004 | Ga0439445_0096886 | Ga0439445_0096886_47_589 | 180 |
| 445 | 3300042435 | Ga0439434_0049932 | Ga0439434_0049932_735_1277 | 180 |
| 446 | 3300044658 | Ga0466972_0006124 | Ga0466972_0006124_5028_5588 | 180 |
| 447 | 3300044658 | Ga0466972_0034430 | Ga0466972_0034430_1267_1824 | 180 |
| 448 | 3300044683 | Ga0466965_0002380 | Ga0466965_0002380_634_1194 | 180 |
| 449 | 3300044683 | Ga0466965_0068328 | Ga0466965_0068328_1223_1765 | 180 |
| 450 | 3300044693 | Ga0466961_0090477 | Ga0466961_0090477_1063_1605 | 180 |
| 451 | 3300044694 | Ga0466963_0161652 | Ga0466963_0161652_302_844 | 180 |
| 452 | 3300044706 | Ga0466964_0282290 | Ga0466964_0282290_158_700 | 180 |
| 453 | 3300044735 | Ga0466968_0113853 | Ga0466968_0113853_380_937 | 180 |
| 454 | 3300044765 | Ga0466970_0130368 | Ga0466970_0130368_806_1357 | 180 |
| 455 | 3300044842 | Ga0466957_0269842 | Ga0466957_0269842_150_707 | 180 |
| 456 | 3300044901 | Ga0466960_0000572 | Ga0466960_0000572_573_1133 | 180 |
| 457 | 3300045049 | Ga0466959_0115525 | Ga0466959_0115525_658_1215 | 180 |
| 458 | 3300045976 | Ga0466967_0036973 | Ga0466967_0036973_1085_1633 | 180 |
| 459 | 3300045976 | Ga0466967_0495914 | Ga0466967_0495914_172_714 | 180 |
| 460 | 3300045976 | Ga0466967_1671988 | Ga0466967_1671988_11_559 | 180 |
| 461 | 3300045976 | Ga0466967_1837017 | Ga0466967_1837017_17_568 | 180 |
| 462 | 3300046455 | Ga0495603_0068308 | Ga0495603_0068308_1185_1730 | 180 |
| 463 | 3300046459 | Ga0495629_0053911 | Ga0495629_0053911_852_1397 | 180 |
| 464 | 3300046460 | Ga0495638_0002750 | Ga0495638_0002750_10678_11232 | 180 |
| 465 | 3300046461 | Ga0495641_0024960 | Ga0495641_0024960_1255_1800 | 180 |
| 466 | 3300046473 | Ga0495582_0146806 | Ga0495582_0146806_172_717 | 180 |
| 467 | 3300046506 | Ga0495583_0060721 | Ga0495583_0060721_859_1413 | 180 |
| 468 | 3300046517 | Ga0495630_0361216 | Ga0495630_0361216_318_863 | 180 |
| 469 | 3300046524 | Ga0495648_0002742 | Ga0495648_0002742_900_1454 | 180 |
| 470 | 3300046530 | Ga0495654_0137008 | Ga0495654_0137008_75_629 | 180 |
| 471 | 3300046531 | Ga0495665_0084544 | Ga0495665_0084544_599_1144 | 180 |
| 472 | 3300046533 | Ga0495640_0088987 | Ga0495640_0088987_885_1430 | 180 |
| 473 | 3300046533 | Ga0495640_0254276 | Ga0495640_0254276_95_646 | 180 |
| 474 | 3300046616 | Ga0495668_0032174 | Ga0495668_0032174_342_896 | 180 |
| 475 | 3300046642 | Ga0495634_0398731 | Ga0495634_0398731_257_802 | 180 |
| 476 | 3300046648 | Ga0495611_0245270 | Ga0495611_0245270_150_704 | 180 |
| 477 | 3300046663 | Ga0495635_0085490 | Ga0495635_0085490_1282_1836 | 180 |
| 478 | 3300046683 | Ga0495658_0011681 | Ga0495658_0011681_2129_2674 | 180 |
| 479 | 3300046689 | Ga0495613_0340263 | Ga0495613_0340263_387_932 | 180 |
| 480 | 3300046690 | Ga0495624_0204588 | Ga0495624_0204588_524_1069 | 180 |
| 481 | 3300047315 | Ga0495581_0052610 | Ga0495581_0052610_1549_2094 | 180 |
| 482 | 3300047320 | Ga0495672_0002921 | Ga0495672_0002921_793_1347 | 180 |
| 483 | 3300047320 | Ga0495672_0075972 | Ga0495672_0075972_453_995 | 180 |
| 484 | 3300047320 | Ga0495672_0140634 | Ga0495672_0140634_596_1150 | 180 |
| 485 | 3300047321 | Ga0495676_0291791 | Ga0495676_0291791_53_598 | 180 |
| 486 | 3300047469 | Ga0495673_0001467 | Ga0495673_0001467_6715_7269 | 180 |
| 487 | 3300047472 | Ga0495686_0008890 | Ga0495686_0008890_4300_4869 | 180 |
| 488 | 3300048091 | Ga0495626_0022103 | Ga0495626_0022103_2243_2797 | 180 |
| 489 | 3300048903 | Ga0496100_0004450 | Ga0496100_0004450_2690_3247 | 180 |
| 490 | 3300048903 | Ga0496100_0014240 | Ga0496100_0014240_1519_2073 | 180 |
| 491 | 3300048903 | Ga0496100_0051247 | Ga0496100_0051247_221_763 | 180 |
| 492 | 3300048903 | Ga0496100_0163002 | Ga0496100_0163002_527_1072 | 180 |
| 493 | 3300048903 | Ga0496100_0333880 | Ga0496100_0333880_173_754 | 180 |
| 494 | 3300048904 | Ga0496101_0000014 | Ga0496101_0000014_202017_202571 | 180 |
| 495 | 3300048904 | Ga0496101_0003353 | Ga0496101_0003353_6306_6848 | 180 |
| 496 | 3300048904 | Ga0496101_0004665 | Ga0496101_0004665_3953_4510 | 180 |
| 497 | 3300048904 | Ga0496101_0090391 | Ga0496101_0090391_658_1233 | 180 |
| 498 | 3300048904 | Ga0496101_0651277 | Ga0496101_0651277_230_775 | 180 |
| 499 | 3300048905 | Ga0496102_0000041 | Ga0496102_0000041_71248_71802 | 180 |
| 500 | 3300048905 | Ga0496102_0007297 | Ga0496102_0007297_6839_7381 | 180 |
| 501 | 3300048905 | Ga0496102_0009843 | Ga0496102_0009843_1141_1683 | 180 |
| 502 | 3300048905 | Ga0496102_0127430 | Ga0496102_0127430_437_1012 | 180 |
| 503 | 3300048905 | Ga0496102_0262656 | Ga0496102_0262656_719_1264 | 180 |
| 504 | 3300048905 | Ga0496102_0410497 | Ga0496102_0410497_342_917 | 180 |
| 505 | 3300048906 | Ga0496103_0000058 | Ga0496103_0000058_52129_52683 | 180 |
| 506 | 3300048906 | Ga0496103_0044212 | Ga0496103_0044212_357_899 | 180 |
| 507 | 3300048906 | Ga0496103_0118286 | Ga0496103_0118286_1050_1625 | 180 |
| 508 | 3300048906 | Ga0496103_0177331 | Ga0496103_0177331_402_977 | 180 |
| 509 | 3300048907 | Ga0496104_0008084 | Ga0496104_0008084_3937_4494 | 180 |
| 510 | 3300048907 | Ga0496104_0060614 | Ga0496104_0060614_2931_3473 | 180 |
| 511 | 3300048907 | Ga0496104_0108110 | Ga0496104_0108110_1715_2257 | 180 |
| 512 | 3300048907 | Ga0496104_0132311 | Ga0496104_0132311_855_1430 | 180 |
| 513 | 3300048907 | Ga0496104_0183810 | Ga0496104_0183810_116_661 | 180 |
| 514 | 3300048908 | Ga0496105_0003856 | Ga0496105_0003856_5086_5643 | 180 |
| 515 | 3300048908 | Ga0496105_0264487 | Ga0496105_0264487_243_785 | 180 |
| 516 | 3300048908 | Ga0496105_0396548 | Ga0496105_0396548_251_826 | 180 |
| 517 | 3300048908 | Ga0496105_0821401 | Ga0496105_0821401_56_631 | 180 |
| 518 | 3300048909 | Ga0496106_0007881 | Ga0496106_0007881_4187_4744 | 180 |
| 519 | 3300048909 | Ga0496106_0014123 | Ga0496106_0014123_761_1303 | 180 |
| 520 | 3300048909 | Ga0496106_0016728 | Ga0496106_0016728_872_1426 | 180 |
| 521 | 3300048910 | Ga0496107_0011115 | Ga0496107_0011115_3232_3807 | 180 |
| 522 | 3300048910 | Ga0496107_0044133 | Ga0496107_0044133_940_1482 | 180 |
| 523 | 3300048910 | Ga0496107_0046533 | Ga0496107_0046533_1022_1579 | 180 |
| 524 | 3300048910 | Ga0496107_0059843 | Ga0496107_0059843_1342_1896 | 180 |
| 525 | 3300048910 | Ga0496107_0419333 | Ga0496107_0419333_406_948 | 180 |
| 526 | 3300048911 | Ga0496108_0013556 | Ga0496108_0013556_4913_5488 | 180 |
| 527 | 3300048911 | Ga0496108_0048734 | Ga0496108_0048734_2495_3070 | 180 |
| 528 | 3300048911 | Ga0496108_0147441 | Ga0496108_0147441_23_580 | 180 |
| 529 | 3300048912 | Ga0496109_0056521 | Ga0496109_0056521_2171_2713 | 180 |
| 530 | 3300048912 | Ga0496109_0092452 | Ga0496109_0092452_1627_2202 | 180 |
| 531 | 3300048912 | Ga0496109_0093377 | Ga0496109_0093377_2025_2600 | 180 |
| 532 | 3300048912 | Ga0496109_0225818 | Ga0496109_0225818_250_795 | 180 |
| 533 | 3300048912 | Ga0496109_0488629 | Ga0496109_0488629_585_1127 | 180 |
| 534 | 3300048913 | Ga0496110_0010152 | Ga0496110_0010152_1383_1925 | 180 |
| 535 | 3300048914 | Ga0496111_0057053 | Ga0496111_0057053_1620_2195 | 180 |
| 536 | 3300048914 | Ga0496111_0188621 | Ga0496111_0188621_811_1356 | 180 |
| 537 | 3300048914 | Ga0496111_0266590 | Ga0496111_0266590_384_926 | 180 |
| 538 | 3300048915 | Ga0496112_0006436 | Ga0496112_0006436_7346_7921 | 180 |
| 539 | 3300048915 | Ga0496112_0012706 | Ga0496112_0012706_4908_5453 | 180 |
| 540 | 3300048916 | Ga0496113_0006742 | Ga0496113_0006742_4353_4934 | 180 |
| 541 | 3300048916 | Ga0496113_0096160 | Ga0496113_0096160_988_1563 | 180 |
| 542 | 3300048917 | Ga0496114_0001744 | Ga0496114_0001744_2180_2722 | 180 |
| 543 | 3300048917 | Ga0496114_0008198 | Ga0496114_0008198_3923_4480 | 180 |
| 544 | 3300048917 | Ga0496114_0088739 | Ga0496114_0088739_1568_2143 | 180 |
| 545 | 3300048918 | Ga0496115_0006154 | Ga0496115_0006154_8184_8726 | 180 |
| 546 | 3300048918 | Ga0496115_0006640 | Ga0496115_0006640_4222_4779 | 180 |
| 547 | 3300048919 | Ga0496116_0000098 | Ga0496116_0000098_71111_71665 | 180 |
| 548 | 3300048920 | Ga0496117_0000096 | Ga0496117_0000096_71402_71956 | 180 |
| 549 | 3300048921 | Ga0496118_0000073 | Ga0496118_0000073_124833_125387 | 180 |
| 550 | 3300048922 | Ga0496119_0114735 | Ga0496119_0114735_202_756 | 180 |
| 551 | 3300048923 | Ga0496120_0101653 | Ga0496120_0101653_485_1039 | 180 |
| 552 | 3300048923 | Ga0496120_0146039 | Ga0496120_0146039_420_1001 | 180 |
| 553 | 3300048924 | Ga0496121_0000354 | Ga0496121_0000354_58033_58587 | 180 |
| 554 | 3300048925 | Ga0496122_0096805 | Ga0496122_0096805_1170_1751 | 180 |
| 555 | 3300048925 | Ga0496122_0185277 | Ga0496122_0185277_454_1008 | 180 |
| 556 | 3300048926 | Ga0496123_0055470 | Ga0496123_0055470_16_597 | 180 |
| 557 | 3300048929 | Ga0496126_0001057 | Ga0496126_0001057_26229_26783 | 180 |
| 558 | 3300048929 | Ga0496126_0002185 | Ga0496126_0002185_3580_4161 | 180 |
| 559 | 3300049569 | Ga0501032_0016653 | Ga0501032_0016653_4222_4773 | 180 |
| 560 | 3300049570 | Ga0501033_0344770 | Ga0501033_0344770_77_628 | 180 |
| 561 | 3300049571 | Ga0501034_0055117 | Ga0501034_0055117_3056_3607 | 180 |
| 562 | 3300049572 | Ga0501036_0004272 | Ga0501036_0004272_4822_5373 | 180 |
| 563 | 3300049573 | Ga0501037_0001645 | Ga0501037_0001645_15305_15856 | 180 |
| 564 | 3300049574 | Ga0501038_0026442 | Ga0501038_0026442_396_947 | 180 |
| 565 | 3300049575 | Ga0501039_0000415 | Ga0501039_0000415_29681_30232 | 180 |
| 566 | 3300049576 | Ga0501040_0663000 | Ga0501040_0663000_28_579 | 180 |
| 567 | 3300049579 | Ga0501043_0001031 | Ga0501043_0001031_15305_15856 | 180 |
| 568 | 3300049581 | Ga0501047_0096689 | Ga0501047_0096689_2037_2594 | 180 |
| 569 | 3300049584 | Ga0501068_0093339 | Ga0501068_0093339_690_1241 | 180 |
| 570 | 3300049586 | Ga0501070_0000517 | Ga0501070_0000517_283_834 | 180 |
| 571 | 3300049589 | Ga0501073_0101235 | Ga0501073_0101235_62_613 | 180 |
| 572 | 3300050490 | nmdc:mga03n38_18613_c1 | nmdc:mga03n38_18613_c1_1438_1980 | 180 |
| 573 | 3300050490 | nmdc:mga03n38_75125_c1 | nmdc:mga03n38_75125_c1_83_634 | 180 |
| 574 | 3300050490 | nmdc:mga03n38_988_c1 | nmdc:mga03n38_988_c1_386_931 | 180 |
| 575 | 3300050491 | nmdc:mga00v17_14597_c1 | nmdc:mga00v17_14597_c1_3697_4239 | 180 |
| 576 | 3300050491 | nmdc:mga00v17_210840_c1 | nmdc:mga00v17_210840_c1_279_833 | 180 |
| 577 | 3300050491 | nmdc:mga00v17_2895_c1 | nmdc:mga00v17_2895_c1_337_879 | 180 |
| 578 | 3300050492 | nmdc:mga0yw44_367000_c1 | nmdc:mga0yw44_367000_c1_11_553 | 180 |
| 579 | 3300050494 | nmdc:mga06z11_102046_c1 | nmdc:mga06z11_102046_c1_132_680 | 180 |
| 580 | 3300050494 | nmdc:mga06z11_105582_c1 | nmdc:mga06z11_105582_c1_599_1141 | 180 |
| 581 | 3300050494 | nmdc:mga06z11_58903_c1 | nmdc:mga06z11_58903_c1_609_1151 | 180 |
| 582 | 3300050496 | nmdc:mga07m45_251625_c1 | nmdc:mga07m45_251625_c1_80_622 | 180 |
| 583 | 3300050496 | nmdc:mga07m45_479723_c1 | nmdc:mga07m45_479723_c1_110_652 | 180 |
| 584 | 3300050507 | nmdc:mga05p37_118759_c1 | nmdc:mga05p37_118759_c1_233_775 | 180 |
| 585 | 3300050509 | nmdc:mga0qj67_27151_c1 | nmdc:mga0qj67_27151_c1_2002_2544 | 180 |
| 586 | 3300050510 | nmdc:mga06r32_151410_c1 | nmdc:mga06r32_151410_c1_1325_1867 | 180 |
| 587 | 3300050516 | nmdc:mga0sz30_16563_c1 | nmdc:mga0sz30_16563_c1_949_1491 | 180 |
| 588 | 3300050516 | nmdc:mga0sz30_177101_c1 | nmdc:mga0sz30_177101_c1_313_891 | 180 |
| 589 | 3300050516 | nmdc:mga0sz30_30161_c1 | nmdc:mga0sz30_30161_c1_1078_1632 | 180 |
| 590 | 3300050516 | nmdc:mga0sz30_39146_c1 | nmdc:mga0sz30_39146_c1_597_1151 | 180 |
| 591 | 3300050516 | nmdc:mga0sz30_40019_c1 | nmdc:mga0sz30_40019_c1_40_588 | 180 |
| 592 | 3300050516 | nmdc:mga0sz30_43208_c1 | nmdc:mga0sz30_43208_c1_1067_1609 | 180 |
| 593 | 3300053079 | Ga0500610_0013266 | Ga0500610_0013266_709_1263 | 180 |
| 594 | 3300053098 | Ga0500650_0129247 | Ga0500650_0129247_608_1162 | 180 |
| 595 | 3300053108 | Ga0500562_004189 | Ga0500562_004189_3071_3625 | 180 |
| 596 | 3300053134 | Ga0500658_0420096 | Ga0500658_0420096_19_573 | 180 |
| 597 | 3300053142 | Ga0500577_0028326 | Ga0500577_0028326_765_1319 | 180 |
| 598 | 3300053153 | Ga0500616_0011053 | Ga0500616_0011053_2655_3197 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.8851 | 47 | 173 |
| 2gmy-assembly1.cif.gz_C | crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd | 0.8847 | 46 | 178 |
| 2oyo-assembly1.cif.gz_A | crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution | 0.8603 | 5 | 175 |
| 6k40-assembly5.cif.gz_K | crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 | 0.854 | 18 | 179 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.8533 | 47 | 177 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53905_23_180_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9591 | 36 | 179 | 1.20.1290.10 |
| af_O53749_49_187_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9519 | 45 | 177 | 1.20.1290.10 |
| af_O53749_49_187_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9047 | 45 | 177 | 1.20.1290.10 |
| af_P76222_42_172_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8994 | 53 | 176 | 1.20.1290.10 |
| 2gmyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.8907 | 47 | 180 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S7NHY5-F1-model_v4 | deleted | 0.9989 | 6 | 180 |
|
| AF-A0A6N4WJL0-F1-model_v4 | 4-carboxymuconolactone decarboxylase | 0.9955 | 35 | 180 |
GO:0051920
|
| AF-A0A1G6VYN6-F1-model_v4 | Alkylhydroperoxidase AhpD family core domain-containing protein | 0.9889 | 6 | 178 |
GO:0051920
|
| AF-A0A6N4WJL0-F1-model_v4 | 4-carboxymuconolactone decarboxylase | 0.9888 | 35 | 180 |
GO:0051920
|
| AF-Q0SEU6-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9883 | 5 | 178 |
GO:0051920
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar