F467750

General Info

Members Datasets Scaffolds Average Seq Length
598 302 588 183

Family's Representative Sequence

Representative Sequence 3300005367|Ga0070667_100000944|Ga0070667_10000094422
Length 206
Sequence MTAPAVSAPWLDPTTASPVPDSGIVNTIEPARIEPGGFRELGPLNWVIAKIGAKTIRAPRFTLFNVLGQHHLLFLTFLPYSGMLLGRSKLGLKDAELVILRVGHLRGSEYELQQHRRLARSRGVDAETQARIFEGPDADGLTDRQRVLITATDEFVITRSVSDQTWKSLASYLDRKQLIEFCLLAAQYDGLAATIATLRVPLDFPD

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
4 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
5 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
6 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
7 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
8 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
9 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
10 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
11 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
194 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
195 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
196 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
197 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
198 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
199 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
200 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
206 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
207 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
208 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
224 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
225 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
226 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
227 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
257 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
258 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
259 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
260 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
261 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
262 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
263 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
264 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
265 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
266 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
293 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
294 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
295 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
296 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
297 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
298 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.33
Metatranscriptomes 0
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.72
Nodule 0.17
Rhizoplane 12.88
Rhizosphere 66.72
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1021658 3300002074 Bacteria 776
2 JGI24749J21850_1044967 3300002076 Bacteria 651
3 JGI24744J21845_10006371 3300002077 Bacteria 2450
4 JGI24744J21845_10051303 3300002077 Bacteria 760
5 JGI24742J22300_10009284 3300002244 Bacteria 1623
6 JGI24751J29686_10005220 3300002459 Bacteria 2642
7 Ga0055540_1000069 3300003792 Bacteria 119560
8 Ga0055540_1001260 3300003792 Bacteria 15428
9 Ga0055540_1004053 3300003792 Bacteria 6806
10 Ga0055540_1004594 3300003792 Bacteria 6135
11 Ga0070658_10511199 3300005327 Bacteria 1038
12 Ga0070676_10003963 3300005328 Bacteria 7767
13 Ga0070683_100330333 3300005329 Bacteria 1452
14 Ga0070690_100009234 3300005330 Bacteria 5707
15 Ga0070690_100121706 3300005330 Bacteria 1752
16 Ga0068869_100023500 3300005334 Bacteria 4258
17 Ga0068869_100632634 3300005334 Bacteria 907
18 Ga0070666_10072822 3300005335 Bacteria 2340
19 Ga0070682_100003677 3300005337 Bacteria 8514
20 Ga0070682_100023610 3300005337 Bacteria 3653
21 Ga0070682_100034675 3300005337 Bacteria 3075
22 Ga0070682_100082726 3300005337 Bacteria 2082
23 Ga0068868_100002600 3300005338 Bacteria 12513
24 Ga0068868_100270514 3300005338 Bacteria 1435
25 Ga0070660_100421131 3300005339 Bacteria 1106
26 Ga0070660_100752844 3300005339 Bacteria 818
27 Ga0070689_100016154 3300005340 Bacteria 5460
28 Ga0070689_100690107 3300005340 Bacteria 891
29 Ga0070691_10008626 3300005341 Bacteria 4665
30 Ga0070692_10236015 3300005345 Bacteria 1088
31 Ga0070668_100004990 3300005347 Bacteria 9830
32 Ga0070668_100009899 3300005347 Bacteria 7059
33 Ga0070669_100013393 3300005353 Bacteria 5831
34 Ga0070671_100058365 3300005355 Bacteria 3213
35 Ga0070671_100080582 3300005355 Bacteria 2722
36 Ga0070674_100006416 3300005356 Bacteria 6860
37 Ga0070674_100017420 3300005356 Bacteria 4519
38 Ga0070674_101167170 3300005356 Bacteria 682
39 Ga0070673_100227477 3300005364 Bacteria 1617
40 Ga0070688_100160796 3300005365 Bacteria 1543
41 Ga0070688_100635393 3300005365 Bacteria 820
42 Ga0070659_100047018 3300005366 Bacteria 3383
43 Ga0070659_100198442 3300005366 Bacteria 1651
44 Ga0070659_100588875 3300005366 Bacteria 955
45 Ga0070667_100000944 3300005367 Bacteria 26746
46 Ga0070667_100005025 3300005367 Bacteria 11070
47 Ga0070667_100257126 3300005367 Bacteria 1563
48 Ga0070667_100561731 3300005367 Bacteria 1049
49 Ga0070703_10274915 3300005406 Bacteria 693
50 Ga0070709_10006545 3300005434 Bacteria 6353
51 Ga0070709_10056358 3300005434 Bacteria 2485
52 Ga0070714_100692430 3300005435 Bacteria 983
53 Ga0070714_101058750 3300005435 Bacteria 790
54 Ga0070710_10000645 3300005437 Bacteria 16624
55 Ga0070710_10005502 3300005437 Bacteria 6022
56 Ga0070701_10000931 3300005438 Bacteria 10590
57 Ga0070701_10251777 3300005438 Bacteria 1067
58 Ga0070711_100010668 3300005439 Bacteria 5691
59 Ga0070711_100011474 3300005439 Bacteria 5505
60 Ga0070705_100002344 3300005440 Bacteria 9550
61 Ga0070694_100212468 3300005444 Bacteria 1447
62 Ga0070663_100192690 3300005455 Bacteria 1587
63 Ga0070663_100344878 3300005455 Bacteria 1204
64 Ga0070663_100559335 3300005455 Bacteria 957
65 Ga0070678_100000622 3300005456 Bacteria 17380
66 Ga0070678_100017035 3300005456 Bacteria 4665
67 Ga0070662_100043042 3300005457 Bacteria 3228
68 Ga0070662_100199572 3300005457 Bacteria 1586
69 Ga0070662_101148231 3300005457 Bacteria 667
70 Ga0068867_100003304 3300005459 Bacteria 11360
71 Ga0070685_10034127 3300005466 Bacteria 2863
72 Ga0070685_10121412 3300005466 Bacteria 1623
73 Ga0070685_10282394 3300005466 Bacteria 1112
74 Ga0070679_100985039 3300005530 Bacteria 787
75 Ga0068853_100006099 3300005539 Bacteria 9543
76 Ga0068853_100020960 3300005539 Bacteria 5440
77 Ga0068853_100131019 3300005539 Bacteria 2245
78 Ga0068853_100147086 3300005539 Bacteria 2118
79 Ga0070672_100257148 3300005543 Bacteria 1472
80 Ga0070686_100181544 3300005544 Bacteria 1495
81 Ga0070686_100340511 3300005544 Bacteria 1124
82 Ga0070695_100003039 3300005545 Bacteria 9772
83 Ga0070696_100051969 3300005546 Bacteria 2851
84 Ga0070696_100365673 3300005546 Bacteria 1121
85 Ga0070693_100002346 3300005547 Bacteria 8699
86 Ga0070693_100015757 3300005547 Bacteria 3899
87 Ga0070665_100008523 3300005548 Bacteria 10371
88 Ga0070665_100015799 3300005548 Bacteria 7582
89 Ga0070665_100164165 3300005548 Bacteria 2223
90 Ga0070665_101567020 3300005548 Bacteria 667
91 Ga0070704_100002151 3300005549 Bacteria 10972
92 Ga0070704_100093664 3300005549 Bacteria 2245
93 Ga0068855_100596243 3300005563 Bacteria 1192
94 Ga0068854_100016216 3300005578 Bacteria 4960
95 Ga0068854_100247338 3300005578 Bacteria 1422
96 Ga0068856_100290231 3300005614 Bacteria 1653
97 Ga0068856_100886618 3300005614 Bacteria 911
98 Ga0070702_100006886 3300005615 Bacteria 5411
99 Ga0070702_100203453 3300005615 Bacteria 1312
100 Ga0068852_100088692 3300005616 Bacteria 2763
101 Ga0068859_100005667 3300005617 Bacteria 12713
102 Ga0068859_100968782 3300005617 Bacteria 933
103 Ga0068866_10000756 3300005718 Bacteria 14583
104 Ga0068866_10595507 3300005718 Bacteria 746
105 Ga0068866_10745523 3300005718 Bacteria 676
106 Ga0068861_100002048 3300005719 Bacteria 13061
107 Ga0068861_100118955 3300005719 Bacteria 2128
108 Ga0068861_100185551 3300005719 Bacteria 1734
109 Ga0068851_10094108 3300005834 Bacteria 1582
110 Ga0068870_10119918 3300005840 Bacteria 1514
111 Ga0068863_100052602 3300005841 Bacteria 3859
112 Ga0068858_100019623 3300005842 Bacteria 6320
113 Ga0068858_100054621 3300005842 Bacteria 3693
114 Ga0068860_100079147 3300005843 Bacteria 3125
115 Ga0068860_100898994 3300005843 Bacteria 901
116 Ga0068862_100006801 3300005844 Bacteria 9482
117 Ga0081455_10060979 3300005937 Bacteria 3176
118 Ga0081455_10158768 3300005937 Bacteria 1736
119 Ga0081538_10107119 3300005981 Bacteria 1385
120 Ga0081538_10125506 3300005981 Bacteria 1221
121 Ga0075365_10012814 3300006038 Bacteria 4993
122 Ga0075365_10053865 3300006038 Bacteria 2666
123 Ga0075365_10088972 3300006038 Bacteria 2102
124 Ga0075363_100006732 3300006048 Bacteria 5245
125 Ga0075363_100007027 3300006048 Bacteria 5147
126 Ga0075363_100007612 3300006048 Bacteria 4990
127 Ga0075363_100011994 3300006048 Bacteria 4168
128 Ga0075363_100021612 3300006048 Bacteria 3244
129 Ga0075363_100022180 3300006048 Bacteria 3208
130 Ga0075363_100046445 3300006048 Bacteria 2304
131 Ga0075363_100060771 3300006048 Bacteria 2035
132 Ga0075363_100104478 3300006048 Bacteria 1570
133 Ga0075363_100277709 3300006048 Bacteria 969
134 Ga0075364_10037435 3300006051 Bacteria 3141
135 Ga0075364_10084983 3300006051 Bacteria 2095
136 Ga0075364_10171523 3300006051 Bacteria 1466
137 Ga0070715_10030790 3300006163 Bacteria 2173
138 Ga0070716_100018843 3300006173 Bacteria 3599
139 Ga0070716_100319920 3300006173 Bacteria 1087
140 Ga0070712_100001133 3300006175 Bacteria 16057
141 Ga0070712_100164174 3300006175 Bacteria 1717
142 Ga0075362_10082952 3300006177 Bacteria 1479
143 Ga0075362_10167011 3300006177 Bacteria 1062
144 Ga0075367_10009450 3300006178 Bacteria 5097
145 Ga0075367_10066209 3300006178 Bacteria 2164
146 Ga0075367_10103776 3300006178 Bacteria 1740
147 Ga0075367_10205108 3300006178 Bacteria 1232
148 Ga0075367_10250541 3300006178 Bacteria 1111
149 Ga0075369_10003220 3300006186 Bacteria 5925
150 Ga0075369_10003235 3300006186 Bacteria 5917
151 Ga0075369_10006370 3300006186 Bacteria 4461
152 Ga0075369_10013356 3300006186 Bacteria 3259
153 Ga0075369_10046748 3300006186 Bacteria 1865
154 Ga0075366_10041595 3300006195 Bacteria 2721
155 Ga0097621_100021994 3300006237 Bacteria 4943
156 Ga0097621_101130765 3300006237 Bacteria 736
157 Ga0075370_10001730 3300006353 Bacteria 9708
158 Ga0075370_10069773 3300006353 Bacteria 2009
159 Ga0075370_10204949 3300006353 Bacteria 1164
160 Ga0068871_100213781 3300006358 Bacteria 1669
161 Ga0068871_100551703 3300006358 Bacteria 1044
162 Ga0075428_100007609 3300006844 Bacteria 12007
163 Ga0075430_100015847 3300006846 Bacteria 6420
164 Ga0075431_100631371 3300006847 Bacteria 1053
165 Ga0075434_100786084 3300006871 Bacteria 968
166 Ga0075434_101048318 3300006871 Bacteria 829
167 Ga0068865_100013935 3300006881 Bacteria 5098
168 Ga0097620_100005667 3300006931 Bacteria 12713
169 Ga0097620_100968713 3300006931 Bacteria 933
170 Ga0099795_10021478 3300007788 Bacteria 2118
171 Ga0105245_10023517 3300009098 Bacteria 5410
172 Ga0105245_10172380 3300009098 Bacteria 2061
173 Ga0105245_10835300 3300009098 Bacteria 961
174 Ga0105247_10001481 3300009101 Bacteria 16883
175 Ga0105247_10062423 3300009101 Bacteria 2312
176 Ga0105247_10785381 3300009101 Bacteria 725
177 Ga0114129_10348679 3300009147 Bacteria 1962
178 Ga0105243_10001598 3300009148 Bacteria 19752
179 Ga0105243_10346852 3300009148 Bacteria 1362
180 Ga0105243_10536032 3300009148 Bacteria 1116
181 Ga0105241_10115150 3300009174 Bacteria 2158
182 Ga0105241_10622755 3300009174 Bacteria 977
183 Ga0105242_10026490 3300009176 Bacteria 4597
184 Ga0105242_11533632 3300009176 Bacteria 698
185 Ga0105248_10018191 3300009177 Bacteria 7761
186 Ga0105248_10032663 3300009177 Bacteria 5815
187 Ga0105248_10117672 3300009177 Bacteria 2997
188 Ga0105248_10290191 3300009177 Bacteria 1842
189 Ga0105248_11563268 3300009177 Bacteria 747
190 Ga0105237_10009243 3300009545 Bacteria 10569
191 Ga0105237_10049359 3300009545 Bacteria 4231
192 Ga0105238_10072625 3300009551 Bacteria 3436
193 Ga0105249_10003095 3300009553 Bacteria 14361
194 Ga0105249_10843607 3300009553 Bacteria 982
195 Ga0105239_10001018 3300010375 Bacteria 39155
196 Ga0105239_10107756 3300010375 Bacteria 3087
197 Ga0105239_10108882 3300010375 Bacteria 3069
198 Ga0105239_10226799 3300010375 Bacteria 2096
199 Ga0105239_10395357 3300010375 Bacteria 1564
200 Ga0105239_10707330 3300010375 Bacteria 1152
201 Ga0105246_10024745 3300011119 Bacteria 3905
202 Ga0105246_10548943 3300011119 Bacteria 990
203 Ga0157369_10224956 3300013105 Bacteria 1963
204 Ga0157374_10080946 3300013296 Bacteria 3081
205 Ga0157374_10281356 3300013296 Bacteria 1642
206 Ga0157378_10011978 3300013297 Bacteria 7593
207 Ga0163162_10050817 3300013306 Bacteria 4158
208 Ga0163162_10143195 3300013306 Bacteria 2505
209 Ga0163162_10250845 3300013306 Bacteria 1902
210 Ga0163162_10620518 3300013306 Bacteria 1206
211 Ga0157372_10008420 3300013307 Bacteria 10948
212 Ga0157375_10001902 3300013308 Bacteria 17961
213 Ga0157375_10068914 3300013308 Bacteria 3542
214 Ga0157375_10445174 3300013308 Bacteria 1461
215 Ga0157375_10716601 3300013308 Bacteria 1153
216 Ga0163163_10063814 3300014325 Bacteria 3654
217 Ga0163163_11175625 3300014325 Bacteria 830
218 Ga0157380_10014952 3300014326 Bacteria 5691
219 Ga0157380_10133694 3300014326 Bacteria 2120
220 Ga0157380_10145695 3300014326 Bacteria 2041
221 Ga0157377_10143130 3300014745 Bacteria 1471
222 Ga0157379_10241954 3300014968 Bacteria 1637
223 Ga0157379_10339071 3300014968 Bacteria 1375
224 Ga0157379_10342422 3300014968 Bacteria 1368
225 Ga0157379_10765006 3300014968 Bacteria 910
226 Ga0157376_10017806 3300014969 Bacteria 5430
227 Ga0157376_10087394 3300014969 Bacteria 2690
228 Ga0157376_10412153 3300014969 Bacteria 1309
229 Ga0163161_10001691 3300017792 Bacteria 16204
230 Ga0209673_1020913 3300025273 Bacteria 2302
231 Ga0209051_1000034 3300025303 Bacteria 371498
232 Ga0209051_1000478 3300025303 Bacteria 51782
233 Ga0209051_1002514 3300025303 Bacteria 13013
234 Ga0209051_1007549 3300025303 Bacteria 5924
235 Ga0207696_1073071 3300025711 Bacteria 952
236 Ga0207653_10101397 3300025885 Bacteria 1018
237 Ga0207692_10008286 3300025898 Bacteria 4300
238 Ga0207692_10289649 3300025898 Bacteria 993
239 Ga0207642_10000759 3300025899 Bacteria 9977
240 Ga0207710_10015573 3300025900 Bacteria 3216
241 Ga0207710_10178977 3300025900 Bacteria 1039
242 Ga0207688_10000800 3300025901 Bacteria 15737
243 Ga0207688_10001392 3300025901 Bacteria 12579
244 Ga0207688_10082013 3300025901 Bacteria 1843
245 Ga0207688_10257250 3300025901 Bacteria 1059
246 Ga0207680_10020950 3300025903 Bacteria 3530
247 Ga0207647_10209396 3300025904 Bacteria 1126
248 Ga0207699_10186830 3300025906 Bacteria 1396
249 Ga0207645_10008279 3300025907 Bacteria 7267
250 Ga0207643_10025005 3300025908 Bacteria 3298
251 Ga0207671_10007962 3300025914 Bacteria 9078
252 Ga0207671_10160399 3300025914 Bacteria 1741
253 Ga0207693_10004684 3300025915 Bacteria 11520
254 Ga0207693_10019343 3300025915 Bacteria 5418
255 Ga0207663_10003448 3300025916 Bacteria 7746
256 Ga0207662_10116357 3300025918 Bacteria 1672
257 Ga0207657_10219002 3300025919 Bacteria 1526
258 Ga0207681_10025164 3300025923 Bacteria 3826
259 Ga0207687_10029352 3300025927 Bacteria 3699
260 Ga0207687_10388950 3300025927 Bacteria 1144
261 Ga0207687_10451860 3300025927 Bacteria 1066
262 Ga0207644_10013355 3300025931 Bacteria 5474
263 Ga0207644_10176622 3300025931 Bacteria 1671
264 Ga0207690_10671898 3300025932 Bacteria 850
265 Ga0207706_10004948 3300025933 Bacteria 12449
266 Ga0207706_10006772 3300025933 Bacteria 10595
267 Ga0207686_10021012 3300025934 Bacteria 3739
268 Ga0207686_10025138 3300025934 Bacteria 3460
269 Ga0207709_10002953 3300025935 Bacteria 10370
270 Ga0207709_10222120 3300025935 Bacteria 1363
271 Ga0207669_10022587 3300025937 Bacteria 3344
272 Ga0207704_10020736 3300025938 Bacteria 3484
273 Ga0207665_10001283 3300025939 Bacteria 16977
274 Ga0207665_10006794 3300025939 Bacteria 7581
275 Ga0207691_10188716 3300025940 Bacteria 1798
276 Ga0207711_10055328 3300025941 Bacteria 3406
277 Ga0207711_10299405 3300025941 Bacteria 1483
278 Ga0207711_10468186 3300025941 Bacteria 1174
279 Ga0207689_10023810 3300025942 Bacteria 5136
280 Ga0207661_10533234 3300025944 Bacteria 1074
281 Ga0207667_10076280 3300025949 Bacteria 3479
282 Ga0207667_10727683 3300025949 Bacteria 993
283 Ga0207651_10130714 3300025960 Bacteria 1922
284 Ga0207651_10367449 3300025960 Bacteria 1216
285 Ga0207712_10056986 3300025961 Bacteria 2755
286 Ga0207712_10125671 3300025961 Bacteria 1947
287 Ga0207668_10002928 3300025972 Bacteria 10017
288 Ga0207668_10042692 3300025972 Bacteria 3072
289 Ga0207668_10516528 3300025972 Bacteria 1030
290 Ga0207640_10003175 3300025981 Bacteria 8848
291 Ga0207640_11076708 3300025981 Bacteria 710
292 Ga0207658_10002139 3300025986 Bacteria 14674
293 Ga0207658_10050918 3300025986 Bacteria 3049
294 Ga0207658_10076485 3300025986 Bacteria 2550
295 Ga0207658_10232524 3300025986 Bacteria 1557
296 Ga0207658_10327781 3300025986 Bacteria 1327
297 Ga0207677_10008137 3300026023 Bacteria 5839
298 Ga0207677_10359725 3300026023 Bacteria 1222
299 Ga0207703_10003076 3300026035 Bacteria 14111
300 Ga0207703_10093069 3300026035 Bacteria 2538
301 Ga0207703_10201322 3300026035 Bacteria 1770
302 Ga0207703_10414246 3300026035 Bacteria 1253
303 Ga0207639_10013377 3300026041 Bacteria 5743
304 Ga0207639_10034452 3300026041 Bacteria 3742
305 Ga0207639_10147672 3300026041 Bacteria 1966
306 Ga0207639_10392549 3300026041 Bacteria 1248
307 Ga0207678_10002992 3300026067 Bacteria 15285
308 Ga0207678_10049345 3300026067 Bacteria 3638
309 Ga0207678_10079587 3300026067 Bacteria 2806
310 Ga0207678_10318717 3300026067 Bacteria 1337
311 Ga0207708_10007438 3300026075 Bacteria 8096
312 Ga0207708_10034824 3300026075 Bacteria 3830
313 Ga0207702_10543826 3300026078 Bacteria 1135
314 Ga0207702_10844443 3300026078 Bacteria 906
315 Ga0207641_10019027 3300026088 Bacteria 5632
316 Ga0207648_10001849 3300026089 Bacteria 23156
317 Ga0207648_10019514 3300026089 Bacteria 6119
318 Ga0207676_10087144 3300026095 Bacteria 2553
319 Ga0207676_10367807 3300026095 Bacteria 1335
320 Ga0207675_100009494 3300026118 Bacteria 9106
321 Ga0207675_100201461 3300026118 Bacteria 1912
322 Ga0207683_10004741 3300026121 Bacteria 11717
323 Ga0207683_10401461 3300026121 Bacteria 1261
324 Ga0207698_10047260 3300026142 Bacteria 3259
325 Ga0207698_10450323 3300026142 Bacteria 1242
326 Ga0207698_10478924 3300026142 Bacteria 1207
327 Ga0268266_10002437 3300028379 Bacteria 19971
328 Ga0268266_10063227 3300028379 Bacteria 3195
329 Ga0268265_10160579 3300028380 Bacteria 1908
330 Ga0268264_10002313 3300028381 Bacteria 16854
331 Ga0268264_11482925 3300028381 Bacteria 689
332 Ga0265327_10000863 3300031251 Bacteria 45090
333 Ga0307413_10160587 3300031824 Bacteria 1578
334 Ga0307410_10050557 3300031852 Bacteria 2796
335 Ga0307410_10089870 3300031852 Bacteria 2177
336 Ga0307410_10797242 3300031852 Bacteria 803
337 Ga0307406_10154754 3300031901 Bacteria 1640
338 Ga0307409_100021152 3300031995 Bacteria 4454
339 Ga0307414_10309168 3300032004 Bacteria 1341
340 Ga0307415_100275877 3300032126 Bacteria 1380
341 Ga0373938_0079066 3300034957 Bacteria 798
342 Ga0373940_0126999 3300035088 Bacteria 796
343 Ga0373951_0024188 3300035091 Bacteria 1406
344 Ga0373931_0101837 3300035691 Bacteria 1616
345 Ga0373931_0176249 3300035691 Bacteria 1263
346 Ga0373927_0715856 3300035695 Bacteria 661
347 Ga0316582_0148085 3300036647 Bacteria 1586
348 Ga0316584_0072288 3300036712 Bacteria 2585
349 Ga0395901_0734921 3300038443 Bacteria 981
350 Ga0436363_1376696 3300039450 Bacteria 2252
351 Ga0439461_0000532 3300041410 Bacteria 5520
352 Ga0439461_0007032 3300041410 Bacteria 1980
353 Ga0439461_0010928 3300041410 Bacteria 1676
354 Ga0439466_0003885 3300041411 Bacteria 5767
355 Ga0439465_0002775 3300041413 Bacteria 5734
356 Ga0439465_0004364 3300041413 Bacteria 4580
357 Ga0451789_0587683 3300041443 Bacteria 804
358 Ga0451793_1165290 3300041452 Bacteria 1137
359 Ga0451795_0480540 3300041456 Bacteria 1674
360 Ga0451807_2720499 3300041486 Bacteria 942
361 Ga0451853_3778465 3300041512 Bacteria 635
362 Ga0439431_0000332 3300041997 Bacteria 9833
363 Ga0439431_0003038 3300041997 Bacteria 3681
364 Ga0439442_008866 3300042002 Bacteria 2032
365 Ga0439445_0020061 3300042004 Bacteria 1670
366 Ga0439445_0096886 3300042004 Bacteria 835
367 Ga0439448_0011971 3300042005 Bacteria 2591
368 Ga0439434_0014234 3300042435 Bacteria 2366
369 Ga0439434_0049932 3300042435 Bacteria 1295
370 Ga0466972_0002627 3300044658 Bacteria 8898
371 Ga0466972_0006124 3300044658 Bacteria 6043
372 Ga0466972_0034430 3300044658 Bacteria 2482
373 Ga0466965_0002380 3300044683 Bacteria 7969
374 Ga0466965_0005113 3300044683 Bacteria 5889
375 Ga0466965_0010952 3300044683 Bacteria 4241
376 Ga0466965_0068328 3300044683 Bacteria 1784
377 Ga0466961_0090477 3300044693 Bacteria 1932
378 Ga0466963_0161652 3300044694 Bacteria 1559
379 Ga0466964_0282290 3300044706 Bacteria 830
380 Ga0466964_0595192 3300044706 Bacteria 606
381 Ga0466971_0134383 3300044719 Bacteria 1150
382 Ga0466968_0000598 3300044735 Bacteria 12287
383 Ga0466968_0113853 3300044735 Unclassified 1218
384 Ga0466970_0056240 3300044765 Bacteria 2102
385 Ga0466970_0130368 3300044765 Bacteria 1381
386 Ga0466957_0269842 3300044842 Bacteria 1136
387 Ga0466960_0000572 3300044901 Bacteria 12763
388 Ga0466959_0115525 3300045049 Bacteria 1912
389 Ga0466958_0021717 3300045836 Bacteria 3754
390 Ga0466967_0023563 3300045976 Bacteria 5048
391 Ga0466967_0036973 3300045976 Bacteria 4174
392 Ga0466967_0216469 3300045976 Bacteria 1818
393 Ga0466967_0495914 3300045976 Bacteria 1198
394 Ga0466967_1223308 3300045976 Bacteria 748
395 Ga0466967_1671988 3300045976 Bacteria 634
396 Ga0466967_1837017 3300045976 Bacteria 603
397 Ga0495603_0068308 3300046455 Bacteria 2091
398 Ga0495590_0141688 3300046457 Bacteria 868
399 Ga0495629_0053911 3300046459 Bacteria 2812
400 Ga0495638_0002750 3300046460 Bacteria 14133
401 Ga0495641_0024960 3300046461 Bacteria 2940
402 Ga0495582_0146806 3300046473 Bacteria 1338
403 Ga0495583_0060721 3300046506 Bacteria 1689
404 Ga0495630_0361216 3300046517 Bacteria 1112
405 Ga0495632_0227157 3300046519 Bacteria 843
406 Ga0495648_0002742 3300046524 Bacteria 15910
407 Ga0495654_0137008 3300046530 Bacteria 1094
408 Ga0495665_0084544 3300046531 Bacteria 1668
409 Ga0495640_0088987 3300046533 Bacteria 2040
410 Ga0495640_0254276 3300046533 Bacteria 1099
411 Ga0495668_0032174 3300046616 Bacteria 2953
412 Ga0495634_0398731 3300046642 Bacteria 818
413 Ga0495611_0245270 3300046648 Bacteria 831
414 Ga0495635_0085490 3300046663 Bacteria 2158
415 Ga0495658_0011681 3300046683 Bacteria 4425
416 Ga0495613_0340263 3300046689 Bacteria 1032
417 Ga0495624_0204588 3300046690 Bacteria 1198
418 Ga0495581_0052610 3300047315 Bacteria 2352
419 Ga0495672_0002921 3300047320 Bacteria 15104
420 Ga0495672_0075972 3300047320 Bacteria 1888
421 Ga0495672_0140634 3300047320 Bacteria 1261
422 Ga0495676_0291791 3300047321 Bacteria 1102
423 Ga0495673_0001467 3300047469 Bacteria 18689
424 Ga0495686_0008890 3300047472 Bacteria 7306
425 Ga0495686_0089225 3300047472 Bacteria 1873
426 Ga0495626_0022103 3300048091 Bacteria 3144
427 Ga0496100_0000175 3300048903 Bacteria 35727
428 Ga0496100_0004450 3300048903 Bacteria 7434
429 Ga0496100_0014240 3300048903 Bacteria 4613
430 Ga0496100_0051247 3300048903 Bacteria 2678
431 Ga0496100_0163002 3300048903 Bacteria 1600
432 Ga0496100_0333880 3300048903 Bacteria 1141
433 Ga0496101_0000014 3300048904 Bacteria 253487
434 Ga0496101_0000140 3300048904 Bacteria 63955
435 Ga0496101_0003353 3300048904 Bacteria 9977
436 Ga0496101_0004665 3300048904 Bacteria 8673
437 Ga0496101_0026851 3300048904 Bacteria 4004
438 Ga0496101_0090391 3300048904 Bacteria 2277
439 Ga0496101_0651277 3300048904 Bacteria 832
440 Ga0496102_0000041 3300048905 Bacteria 196634
441 Ga0496102_0007297 3300048905 Bacteria 9435
442 Ga0496102_0007713 3300048905 Bacteria 9194
443 Ga0496102_0009843 3300048905 Bacteria 8220
444 Ga0496102_0127430 3300048905 Bacteria 2380
445 Ga0496102_0262656 3300048905 Bacteria 1628
446 Ga0496102_0410497 3300048905 Bacteria 1272
447 Ga0496103_0000058 3300048906 Bacteria 141099
448 Ga0496103_0000183 3300048906 Bacteria 63106
449 Ga0496103_0044212 3300048906 Bacteria 2744
450 Ga0496103_0118286 3300048906 Bacteria 1687
451 Ga0496103_0177331 3300048906 Bacteria 1369
452 Ga0496104_0008084 3300048907 Bacteria 9333
453 Ga0496104_0060614 3300048907 Bacteria 3585
454 Ga0496104_0108110 3300048907 Bacteria 2665
455 Ga0496104_0132311 3300048907 Bacteria 2396
456 Ga0496104_0183810 3300048907 Bacteria 2001
457 Ga0496105_0003856 3300048908 Bacteria 11203
458 Ga0496105_0264487 3300048908 Bacteria 1390
459 Ga0496105_0396548 3300048908 Bacteria 1096
460 Ga0496105_0821401 3300048908 Bacteria 705
461 Ga0496106_0001516 3300048909 Bacteria 17471
462 Ga0496106_0007881 3300048909 Bacteria 7874
463 Ga0496106_0014123 3300048909 Bacteria 5900
464 Ga0496106_0016728 3300048909 Bacteria 5426
465 Ga0496107_0000145 3300048910 Bacteria 35595
466 Ga0496107_0011115 3300048910 Bacteria 6263
467 Ga0496107_0044133 3300048910 Bacteria 3204
468 Ga0496107_0046533 3300048910 Bacteria 3122
469 Ga0496107_0059843 3300048910 Bacteria 2757
470 Ga0496107_0419333 3300048910 Bacteria 995
471 Ga0496108_0002334 3300048911 Bacteria 15200
472 Ga0496108_0013556 3300048911 Bacteria 6653
473 Ga0496108_0048734 3300048911 Bacteria 3542
474 Ga0496108_0147441 3300048911 Bacteria 2029
475 Ga0496109_0000161 3300048912 Bacteria 65633
476 Ga0496109_0056521 3300048912 Bacteria 3581
477 Ga0496109_0092452 3300048912 Bacteria 2798
478 Ga0496109_0093377 3300048912 Bacteria 2785
479 Ga0496109_0225818 3300048912 Bacteria 1761
480 Ga0496109_0488629 3300048912 Bacteria 1162
481 Ga0496109_1581695 3300048912 Bacteria 590
482 Ga0496110_0010152 3300048913 Bacteria 7650
483 Ga0496110_0030964 3300048913 Bacteria 4614
484 Ga0496111_0006072 3300048914 Bacteria 7807
485 Ga0496111_0057053 3300048914 Bacteria 2827
486 Ga0496111_0188621 3300048914 Bacteria 1533
487 Ga0496111_0266590 3300048914 Bacteria 1270
488 Ga0496112_0006436 3300048915 Bacteria 10312
489 Ga0496112_0012706 3300048915 Bacteria 7744
490 Ga0496113_0006742 3300048916 Bacteria 7318
491 Ga0496113_0096160 3300048916 Bacteria 2290
492 Ga0496113_0132344 3300048916 Bacteria 1958
493 Ga0496114_0001744 3300048917 Bacteria 16517
494 Ga0496114_0008198 3300048917 Bacteria 8282
495 Ga0496114_0022796 3300048917 Bacteria 5103
496 Ga0496114_0088739 3300048917 Bacteria 2623
497 Ga0496115_0006154 3300048918 Bacteria 8778
498 Ga0496115_0006640 3300048918 Bacteria 8489
499 Ga0496115_0106818 3300048918 Bacteria 2298
500 Ga0496116_0000098 3300048919 Bacteria 196497
501 Ga0496116_0001872 3300048919 Bacteria 22739
502 Ga0496117_0000096 3300048920 Bacteria 196788
503 Ga0496118_0000073 3300048921 Bacteria 196712
504 Ga0496118_0009422 3300048921 Bacteria 9861
505 Ga0496119_0006822 3300048922 Bacteria 10468
506 Ga0496119_0114735 3300048922 Bacteria 1489
507 Ga0496120_0101653 3300048923 Bacteria 1517
508 Ga0496120_0146039 3300048923 Bacteria 1194
509 Ga0496121_0000002 3300048924 Bacteria 1494588
510 Ga0496121_0000354 3300048924 Bacteria 94725
511 Ga0496121_0392835 3300048924 Bacteria 911
512 Ga0496122_0001055 3300048925 Bacteria 48077
513 Ga0496122_0096805 3300048925 Bacteria 1988
514 Ga0496122_0185277 3300048925 Bacteria 1236
515 Ga0496123_0004209 3300048926 Bacteria 15361
516 Ga0496123_0055470 3300048926 Bacteria 2599
517 Ga0496124_0000002 3300048927 Bacteria 1494588
518 Ga0496125_0000002 3300048928 Bacteria 1480920
519 Ga0496126_0000009 3300048929 Bacteria 750350
520 Ga0496126_0001057 3300048929 Bacteria 46555
521 Ga0496126_0002185 3300048929 Bacteria 27192
522 Ga0496126_0129440 3300048929 Bacteria 2182
523 Ga0501032_0016653 3300049569 Bacteria 5168
524 Ga0501033_0344770 3300049570 Bacteria 1044
525 Ga0501034_0055117 3300049571 Bacteria 4001
526 Ga0501036_0004272 3300049572 Bacteria 11531
527 Ga0501037_0001645 3300049573 Bacteria 16251
528 Ga0501038_0026442 3300049574 Bacteria 5168
529 Ga0501039_0000415 3300049575 Bacteria 30627
530 Ga0501040_0663000 3300049576 Bacteria 754
531 Ga0501043_0001031 3300049579 Bacteria 24463
532 Ga0501047_0013760 3300049581 Bacteria 7684
533 Ga0501047_0096689 3300049581 Bacteria 2832
534 Ga0501068_0093339 3300049584 Bacteria 1859
535 Ga0501070_0000517 3300049586 Bacteria 35418
536 Ga0501070_0097477 3300049586 Bacteria 2432
537 Ga0501073_0101235 3300049589 Bacteria 2000
538 Ga0501044_0211389 3300049823 Bacteria 1894
539 nmdc:mga03683_299986_c1 3300050489 Bacteria 753
540 nmdc:mga03683_50048_c1 3300050489 Bacteria 1741
541 nmdc:mga03n38_105_c2 3300050490 Bacteria 16032
542 nmdc:mga03n38_18613_c1 3300050490 Bacteria 2745
543 nmdc:mga03n38_37714_c1 3300050490 Bacteria 2086
544 nmdc:mga03n38_75125_c1 3300050490 Bacteria 1573
545 nmdc:mga03n38_988_c1 3300050490 Bacteria 7761
546 nmdc:mga00v17_14597_c1 3300050491 Bacteria 4389
547 nmdc:mga00v17_160552_c1 3300050491 Bacteria 1447
548 nmdc:mga00v17_210840_c1 3300050491 Bacteria 1257
549 nmdc:mga00v17_242369_c1 3300050491 Bacteria 1169
550 nmdc:mga00v17_2895_c1 3300050491 Bacteria 8802
551 nmdc:mga00v17_2898_c1 3300050491 Bacteria 8795
552 nmdc:mga0yw44_211392_c1 3300050492 Bacteria 1283
553 nmdc:mga0yw44_33090_c1 3300050492 Bacteria 3018
554 nmdc:mga0yw44_367000_c1 3300050492 Bacteria 971
555 nmdc:mga0yw44_73034_c1 3300050492 Bacteria 2133
556 nmdc:mga0k408_52408_c1 3300050493 Bacteria 2365
557 nmdc:mga06z11_102046_c1 3300050494 Bacteria 986
558 nmdc:mga06z11_105582_c1 3300050494 Bacteria 1552
559 nmdc:mga06z11_11854_c1 3300050494 Bacteria 3772
560 nmdc:mga06z11_373876_c1 3300050494 Bacteria 855
561 nmdc:mga06z11_58903_c1 3300050494 Bacteria 1994
562 nmdc:mga07m45_24226_c1 3300050496 Bacteria 3323
563 nmdc:mga07m45_251625_c1 3300050496 Bacteria 1028
564 nmdc:mga07m45_447232_c1 3300050496 Bacteria 749
565 nmdc:mga07m45_479723_c1 3300050496 Bacteria 720
566 nmdc:mga07m45_562253_c1 3300050496 Bacteria 659
567 nmdc:mga07m45_781_c1 3300050496 Bacteria 13679
568 nmdc:mga05p37_118759_c1 3300050507 Bacteria 3249
569 nmdc:mga0qj67_27151_c1 3300050509 Bacteria 4434
570 nmdc:mga06r32_151410_c1 3300050510 Bacteria 2298
571 nmdc:mga0sz30_16563_c1 3300050516 Bacteria 2929
572 nmdc:mga0sz30_177101_c1 3300050516 Bacteria 945
573 nmdc:mga0sz30_30161_c1 3300050516 Bacteria 2239
574 nmdc:mga0sz30_39146_c1 3300050516 Bacteria 1988
575 nmdc:mga0sz30_40019_c1 3300050516 Bacteria 1969
576 nmdc:mga0sz30_43208_c1 3300050516 Bacteria 1897
577 nmdc:mga0sz30_68145_c1 3300050516 Bacteria 1528
578 Ga0500610_0013266 3300053079 Bacteria 3829
579 Ga0500641_0013855 3300053096 Bacteria 2967
580 Ga0500650_0129247 3300053098 Bacteria 1175
581 Ga0500562_004189 3300053108 Bacteria 3642
582 Ga0500595_107564 3300053119 Bacteria 795
583 Ga0500608_034736 3300053122 Bacteria 2403
584 Ga0500642_0101457 3300053130 Bacteria 1339
585 Ga0500658_0420096 3300053134 Bacteria 611
586 Ga0500577_0028326 3300053142 Bacteria 1929
587 Ga0500616_0011053 3300053153 Bacteria 5368
588 Ga0500627_0015617 3300053158 Bacteria 2940

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100004990 Ga0070668_10000499010 166
2 iso_pu_bacteria 2842134933 2842135120 173
3 3300050496 nmdc:mga07m45_562253_c1 nmdc:mga07m45_562253_c1_16_546 176
4 3300003792 Ga0055540_1000069 Ga0055540_100006917 177
5 3300005356 Ga0070674_101167170 Ga0070674_1011671701 177
6 3300005718 Ga0068866_10745523 Ga0068866_107455232 177
7 3300006038 Ga0075365_10053865 Ga0075365_100538655 177
8 3300006048 Ga0075363_100006732 Ga0075363_1000067324 177
9 3300006048 Ga0075363_100007027 Ga0075363_1000070272 177
10 3300006048 Ga0075363_100021612 Ga0075363_1000216124 177
11 3300006048 Ga0075363_100046445 Ga0075363_1000464454 177
12 3300006048 Ga0075363_100060771 Ga0075363_1000607712 177
13 3300006051 Ga0075364_10084983 Ga0075364_100849834 177
14 3300006051 Ga0075364_10171523 Ga0075364_101715232 177
15 3300006177 Ga0075362_10082952 Ga0075362_100829522 177
16 3300006178 Ga0075367_10009450 Ga0075367_100094504 177
17 3300006178 Ga0075367_10205108 Ga0075367_102051082 177
18 3300006195 Ga0075366_10041595 Ga0075366_100415954 177
19 3300006353 Ga0075370_10001730 Ga0075370_100017309 177
20 3300006353 Ga0075370_10204949 Ga0075370_102049492 177
21 3300009148 Ga0105243_10346852 Ga0105243_103468523 177
22 3300009148 Ga0105243_10536032 Ga0105243_105360322 177
23 3300009545 Ga0105237_10009243 Ga0105237_1000924310 177
24 3300010375 Ga0105239_10226799 Ga0105239_102267993 177
25 3300025303 Ga0209051_1000034 Ga0209051_1000034260 177
26 3300025914 Ga0207671_10007962 Ga0207671_100079622 177
27 3300025927 Ga0207687_10388950 Ga0207687_103889501 177
28 3300025935 Ga0207709_10222120 Ga0207709_102221203 177
29 3300025972 Ga0207668_10516528 Ga0207668_105165282 177
30 3300031251 Ga0265327_10000863 Ga0265327_1000086329 177
31 3300036647 Ga0316582_0148085 Ga0316582_0148085_796_1332 177
32 3300036712 Ga0316584_0072288 Ga0316584_0072288_424_960 177
33 3300042005 Ga0439448_0011971 Ga0439448_0011971_148_696 177
34 3300044658 Ga0466972_0002627 Ga0466972_0002627_3915_4451 177
35 3300044683 Ga0466965_0005113 Ga0466965_0005113_3946_4482 177
36 3300044683 Ga0466965_0010952 Ga0466965_0010952_196_744 177
37 3300044706 Ga0466964_0595192 Ga0466964_0595192_56_592 177
38 3300044719 Ga0466971_0134383 Ga0466971_0134383_226_762 177
39 3300044735 Ga0466968_0000598 Ga0466968_0000598_9527_10063 177
40 3300044765 Ga0466970_0056240 Ga0466970_0056240_1217_1753 177
41 3300045836 Ga0466958_0021717 Ga0466958_0021717_1272_1808 177
42 3300045976 Ga0466967_0023563 Ga0466967_0023563_651_1187 177
43 3300045976 Ga0466967_1223308 Ga0466967_1223308_127_675 177
44 3300046457 Ga0495590_0141688 Ga0495590_0141688_110_655 177
45 3300046519 Ga0495632_0227157 Ga0495632_0227157_130_675 177
46 3300047472 Ga0495686_0089225 Ga0495686_0089225_138_677 177
47 3300048903 Ga0496100_0000175 Ga0496100_0000175_23348_23896 177
48 3300048904 Ga0496101_0000140 Ga0496101_0000140_45737_46285 177
49 3300048904 Ga0496101_0026851 Ga0496101_0026851_3428_3964 177
50 3300048905 Ga0496102_0007713 Ga0496102_0007713_8322_8870 177
51 3300048906 Ga0496103_0000183 Ga0496103_0000183_45540_46088 177
52 3300048909 Ga0496106_0001516 Ga0496106_0001516_10492_11040 177
53 3300048910 Ga0496107_0000145 Ga0496107_0000145_17591_18139 177
54 3300048911 Ga0496108_0002334 Ga0496108_0002334_7578_8126 177
55 3300048912 Ga0496109_0000161 Ga0496109_0000161_47453_48001 177
56 3300048912 Ga0496109_1581695 Ga0496109_1581695_26_562 177
57 3300048913 Ga0496110_0030964 Ga0496110_0030964_780_1328 177
58 3300048914 Ga0496111_0006072 Ga0496111_0006072_968_1516 177
59 3300048916 Ga0496113_0132344 Ga0496113_0132344_1124_1672 177
60 3300048917 Ga0496114_0022796 Ga0496114_0022796_2978_3526 177
61 3300048918 Ga0496115_0106818 Ga0496115_0106818_1158_1706 177
62 3300048919 Ga0496116_0001872 Ga0496116_0001872_10288_10836 177
63 3300048921 Ga0496118_0009422 Ga0496118_0009422_993_1541 177
64 3300048922 Ga0496119_0006822 Ga0496119_0006822_9418_9966 177
65 3300048924 Ga0496121_0000002 Ga0496121_0000002_586138_586686 177
66 3300048924 Ga0496121_0392835 Ga0496121_0392835_70_609 177
67 3300048925 Ga0496122_0001055 Ga0496122_0001055_17648_18196 177
68 3300048926 Ga0496123_0004209 Ga0496123_0004209_14089_14637 177
69 3300048927 Ga0496124_0000002 Ga0496124_0000002_907903_908451 177
70 3300048928 Ga0496125_0000002 Ga0496125_0000002_586138_586686 177
71 3300048929 Ga0496126_0000009 Ga0496126_0000009_163665_164213 177
72 3300048929 Ga0496126_0129440 Ga0496126_0129440_735_1274 177
73 3300049581 Ga0501047_0013760 Ga0501047_0013760_4742_5281 177
74 3300049823 Ga0501044_0211389 Ga0501044_0211389_1254_1790 177
75 3300050489 nmdc:mga03683_299986_c1 nmdc:mga03683_299986_c1_185_727 177
76 3300050489 nmdc:mga03683_50048_c1 nmdc:mga03683_50048_c1_965_1513 177
77 3300050490 nmdc:mga03n38_105_c2 nmdc:mga03n38_105_c2_8593_9135 177
78 3300050490 nmdc:mga03n38_37714_c1 nmdc:mga03n38_37714_c1_1120_1668 177
79 3300050491 nmdc:mga00v17_160552_c1 nmdc:mga00v17_160552_c1_534_1082 177
80 3300050491 nmdc:mga00v17_242369_c1 nmdc:mga00v17_242369_c1_34_570 177
81 3300050491 nmdc:mga00v17_2898_c1 nmdc:mga00v17_2898_c1_3405_3947 177
82 3300050492 nmdc:mga0yw44_211392_c1 nmdc:mga0yw44_211392_c1_369_911 177
83 3300050492 nmdc:mga0yw44_33090_c1 nmdc:mga0yw44_33090_c1_2075_2623 177
84 3300050492 nmdc:mga0yw44_73034_c1 nmdc:mga0yw44_73034_c1_571_1119 177
85 3300050493 nmdc:mga0k408_52408_c1 nmdc:mga0k408_52408_c1_910_1458 177
86 3300050494 nmdc:mga06z11_11854_c1 nmdc:mga06z11_11854_c1_2415_2963 177
87 3300050494 nmdc:mga06z11_373876_c1 nmdc:mga06z11_373876_c1_288_830 177
88 3300050496 nmdc:mga07m45_24226_c1 nmdc:mga07m45_24226_c1_1401_1949 177
89 3300050496 nmdc:mga07m45_447232_c1 nmdc:mga07m45_447232_c1_190_738 177
90 3300050496 nmdc:mga07m45_781_c1 nmdc:mga07m45_781_c1_4359_4901 177
91 3300050516 nmdc:mga0sz30_68145_c1 nmdc:mga0sz30_68145_c1_336_884 177
92 3300053096 Ga0500641_0013855 Ga0500641_0013855_469_1008 177
93 3300053119 Ga0500595_107564 Ga0500595_107564_172_711 177
94 3300053122 Ga0500608_034736 Ga0500608_034736_570_1109 177
95 3300053130 Ga0500642_0101457 Ga0500642_0101457_359_898 177
96 3300053158 Ga0500627_0015617 Ga0500627_0015617_1555_2094 177
97 iso_pu_bacteria 2643221687 2644487305 177
98 iso_pu_bacteria 2643221715 2644638919 177
99 iso_pu_bacteria 2738541264 2738665826 177
100 iso_pu_bacteria 2738541356 2739144960 177
101 iso_pu_bacteria 2902792274 2902794467 177
102 iso_pu_bacteria 2902810491 2902814044 177
103 iso_pu_bacteria 2902837492 2902839411 177
104 iso_pu_bacteria 2939582691 2939587067 177
105 iso_pu_bacteria 2929212328 2929213215 178
106 3300005435 Ga0070714_100692430 Ga0070714_1006924302 179
107 3300014968 Ga0157379_10342422 Ga0157379_103424222 179
108 3300031901 Ga0307406_10154754 Ga0307406_101547543 179
109 3300041410 Ga0439461_0000532 Ga0439461_0000532_4875_5423 179
110 3300041411 Ga0439466_0003885 Ga0439466_0003885_2877_3425 179
111 3300041997 Ga0439431_0000332 Ga0439431_0000332_560_1108 179
112 3300042004 Ga0439445_0020061 Ga0439445_0020061_970_1518 179
113 3300042435 Ga0439434_0014234 Ga0439434_0014234_1459_2007 179
114 3300045976 Ga0466967_0216469 Ga0466967_0216469_864_1436 179
115 3300049586 Ga0501070_0097477 Ga0501070_0097477_1001_1546 179
116 3300002074 JGI24748J21848_1021658 JGI24748J21848_10216581 180
117 3300002076 JGI24749J21850_1044967 JGI24749J21850_10449671 180
118 3300002077 JGI24744J21845_10006371 JGI24744J21845_100063714 180
119 3300002077 JGI24744J21845_10051303 JGI24744J21845_100513031 180
120 3300002244 JGI24742J22300_10009284 JGI24742J22300_100092842 180
121 3300002459 JGI24751J29686_10005220 JGI24751J29686_100052202 180
122 3300003792 Ga0055540_1001260 Ga0055540_10012604 180
123 3300003792 Ga0055540_1004053 Ga0055540_10040535 180
124 3300003792 Ga0055540_1004594 Ga0055540_10045943 180
125 3300005327 Ga0070658_10511199 Ga0070658_105111992 180
126 3300005328 Ga0070676_10003963 Ga0070676_100039633 180
127 3300005329 Ga0070683_100330333 Ga0070683_1003303332 180
128 3300005330 Ga0070690_100009234 Ga0070690_1000092343 180
129 3300005330 Ga0070690_100121706 Ga0070690_1001217062 180
130 3300005334 Ga0068869_100023500 Ga0068869_1000235003 180
131 3300005334 Ga0068869_100632634 Ga0068869_1006326341 180
132 3300005335 Ga0070666_10072822 Ga0070666_100728223 180
133 3300005337 Ga0070682_100003677 Ga0070682_1000036776 180
134 3300005337 Ga0070682_100023610 Ga0070682_1000236102 180
135 3300005337 Ga0070682_100034675 Ga0070682_1000346752 180
136 3300005337 Ga0070682_100082726 Ga0070682_1000827262 180
137 3300005338 Ga0068868_100002600 Ga0068868_10000260011 180
138 3300005338 Ga0068868_100270514 Ga0068868_1002705142 180
139 3300005339 Ga0070660_100421131 Ga0070660_1004211312 180
140 3300005339 Ga0070660_100752844 Ga0070660_1007528441 180
141 3300005340 Ga0070689_100016154 Ga0070689_1000161544 180
142 3300005340 Ga0070689_100690107 Ga0070689_1006901071 180
143 3300005341 Ga0070691_10008626 Ga0070691_100086264 180
144 3300005345 Ga0070692_10236015 Ga0070692_102360151 180
145 3300005347 Ga0070668_100009899 Ga0070668_1000098993 180
146 3300005353 Ga0070669_100013393 Ga0070669_1000133934 180
147 3300005355 Ga0070671_100058365 Ga0070671_1000583652 180
148 3300005355 Ga0070671_100080582 Ga0070671_1000805822 180
149 3300005356 Ga0070674_100006416 Ga0070674_1000064163 180
150 3300005356 Ga0070674_100017420 Ga0070674_1000174203 180
151 3300005364 Ga0070673_100227477 Ga0070673_1002274772 180
152 3300005365 Ga0070688_100160796 Ga0070688_1001607963 180
153 3300005365 Ga0070688_100635393 Ga0070688_1006353931 180
154 3300005366 Ga0070659_100047018 Ga0070659_1000470184 180
155 3300005366 Ga0070659_100198442 Ga0070659_1001984421 180
156 3300005366 Ga0070659_100588875 Ga0070659_1005888751 180
157 3300005367 Ga0070667_100000944 Ga0070667_10000094422 180
158 3300005367 Ga0070667_100005025 Ga0070667_1000050253 180
159 3300005367 Ga0070667_100257126 Ga0070667_1002571262 180
160 3300005367 Ga0070667_100561731 Ga0070667_1005617312 180
161 3300005406 Ga0070703_10274915 Ga0070703_102749151 180
162 3300005434 Ga0070709_10006545 Ga0070709_100065457 180
163 3300005434 Ga0070709_10056358 Ga0070709_100563584 180
164 3300005435 Ga0070714_101058750 Ga0070714_1010587502 180
165 3300005437 Ga0070710_10000645 Ga0070710_1000064514 180
166 3300005437 Ga0070710_10005502 Ga0070710_100055021 180
167 3300005438 Ga0070701_10000931 Ga0070701_100009317 180
168 3300005438 Ga0070701_10251777 Ga0070701_102517771 180
169 3300005439 Ga0070711_100010668 Ga0070711_1000106685 180
170 3300005439 Ga0070711_100011474 Ga0070711_1000114744 180
171 3300005440 Ga0070705_100002344 Ga0070705_1000023443 180
172 3300005444 Ga0070694_100212468 Ga0070694_1002124682 180
173 3300005455 Ga0070663_100192690 Ga0070663_1001926902 180
174 3300005455 Ga0070663_100344878 Ga0070663_1003448781 180
175 3300005455 Ga0070663_100559335 Ga0070663_1005593352 180
176 3300005456 Ga0070678_100000622 Ga0070678_1000006227 180
177 3300005456 Ga0070678_100017035 Ga0070678_1000170353 180
178 3300005457 Ga0070662_100043042 Ga0070662_1000430422 180
179 3300005457 Ga0070662_100199572 Ga0070662_1001995723 180
180 3300005457 Ga0070662_101148231 Ga0070662_1011482311 180
181 3300005459 Ga0068867_100003304 Ga0068867_10000330413 180
182 3300005466 Ga0070685_10034127 Ga0070685_100341272 180
183 3300005466 Ga0070685_10121412 Ga0070685_101214122 180
184 3300005466 Ga0070685_10282394 Ga0070685_102823942 180
185 3300005530 Ga0070679_100985039 Ga0070679_1009850391 180
186 3300005539 Ga0068853_100006099 Ga0068853_1000060996 180
187 3300005539 Ga0068853_100020960 Ga0068853_1000209604 180
188 3300005539 Ga0068853_100131019 Ga0068853_1001310192 180
189 3300005539 Ga0068853_100147086 Ga0068853_1001470862 180
190 3300005543 Ga0070672_100257148 Ga0070672_1002571484 180
191 3300005544 Ga0070686_100181544 Ga0070686_1001815442 180
192 3300005544 Ga0070686_100340511 Ga0070686_1003405111 180
193 3300005545 Ga0070695_100003039 Ga0070695_1000030397 180
194 3300005546 Ga0070696_100051969 Ga0070696_1000519694 180
195 3300005546 Ga0070696_100365673 Ga0070696_1003656732 180
196 3300005547 Ga0070693_100002346 Ga0070693_1000023464 180
197 3300005547 Ga0070693_100015757 Ga0070693_1000157573 180
198 3300005548 Ga0070665_100008523 Ga0070665_1000085234 180
199 3300005548 Ga0070665_100015799 Ga0070665_1000157994 180
200 3300005548 Ga0070665_100164165 Ga0070665_1001641652 180
201 3300005548 Ga0070665_101567020 Ga0070665_1015670201 180
202 3300005549 Ga0070704_100002151 Ga0070704_10000215110 180
203 3300005549 Ga0070704_100093664 Ga0070704_1000936642 180
204 3300005563 Ga0068855_100596243 Ga0068855_1005962433 180
205 3300005578 Ga0068854_100016216 Ga0068854_1000162164 180
206 3300005578 Ga0068854_100247338 Ga0068854_1002473382 180
207 3300005614 Ga0068856_100290231 Ga0068856_1002902313 180
208 3300005614 Ga0068856_100886618 Ga0068856_1008866182 180
209 3300005615 Ga0070702_100006886 Ga0070702_1000068863 180
210 3300005615 Ga0070702_100203453 Ga0070702_1002034532 180
211 3300005616 Ga0068852_100088692 Ga0068852_1000886925 180
212 3300005617 Ga0068859_100005667 Ga0068859_1000056679 180
213 3300005617 Ga0068859_100968782 Ga0068859_1009687822 180
214 3300005718 Ga0068866_10000756 Ga0068866_100007567 180
215 3300005718 Ga0068866_10595507 Ga0068866_105955072 180
216 3300005719 Ga0068861_100002048 Ga0068861_1000020487 180
217 3300005719 Ga0068861_100118955 Ga0068861_1001189552 180
218 3300005719 Ga0068861_100185551 Ga0068861_1001855512 180
219 3300005834 Ga0068851_10094108 Ga0068851_100941082 180
220 3300005840 Ga0068870_10119918 Ga0068870_101199182 180
221 3300005841 Ga0068863_100052602 Ga0068863_1000526023 180
222 3300005842 Ga0068858_100019623 Ga0068858_1000196237 180
223 3300005842 Ga0068858_100054621 Ga0068858_1000546217 180
224 3300005843 Ga0068860_100079147 Ga0068860_1000791473 180
225 3300005843 Ga0068860_100898994 Ga0068860_1008989942 180
226 3300005844 Ga0068862_100006801 Ga0068862_1000068019 180
227 3300005937 Ga0081455_10060979 Ga0081455_100609793 180
228 3300005937 Ga0081455_10158768 Ga0081455_101587683 180
229 3300005981 Ga0081538_10107119 Ga0081538_101071192 180
230 3300005981 Ga0081538_10125506 Ga0081538_101255062 180
231 3300006038 Ga0075365_10012814 Ga0075365_100128143 180
232 3300006038 Ga0075365_10088972 Ga0075365_100889724 180
233 3300006048 Ga0075363_100007612 Ga0075363_1000076124 180
234 3300006048 Ga0075363_100011994 Ga0075363_1000119943 180
235 3300006048 Ga0075363_100022180 Ga0075363_1000221804 180
236 3300006048 Ga0075363_100104478 Ga0075363_1001044782 180
237 3300006048 Ga0075363_100277709 Ga0075363_1002777092 180
238 3300006051 Ga0075364_10037435 Ga0075364_100374352 180
239 3300006163 Ga0070715_10030790 Ga0070715_100307902 180
240 3300006173 Ga0070716_100018843 Ga0070716_1000188433 180
241 3300006173 Ga0070716_100319920 Ga0070716_1003199202 180
242 3300006175 Ga0070712_100001133 Ga0070712_1000011335 180
243 3300006175 Ga0070712_100164174 Ga0070712_1001641742 180
244 3300006177 Ga0075362_10167011 Ga0075362_101670112 180
245 3300006178 Ga0075367_10066209 Ga0075367_100662091 180
246 3300006178 Ga0075367_10103776 Ga0075367_101037762 180
247 3300006178 Ga0075367_10250541 Ga0075367_102505412 180
248 3300006186 Ga0075369_10003220 Ga0075369_100032205 180
249 3300006186 Ga0075369_10003235 Ga0075369_100032352 180
250 3300006186 Ga0075369_10006370 Ga0075369_100063707 180
251 3300006186 Ga0075369_10013356 Ga0075369_100133562 180
252 3300006186 Ga0075369_10046748 Ga0075369_100467484 180
253 3300006237 Ga0097621_100021994 Ga0097621_1000219943 180
254 3300006237 Ga0097621_101130765 Ga0097621_1011307651 180
255 3300006353 Ga0075370_10069773 Ga0075370_100697733 180
256 3300006358 Ga0068871_100213781 Ga0068871_1002137812 180
257 3300006358 Ga0068871_100551703 Ga0068871_1005517031 180
258 3300006844 Ga0075428_100007609 Ga0075428_1000076094 180
259 3300006846 Ga0075430_100015847 Ga0075430_1000158472 180
260 3300006847 Ga0075431_100631371 Ga0075431_1006313712 180
261 3300006871 Ga0075434_100786084 Ga0075434_1007860841 180
262 3300006871 Ga0075434_101048318 Ga0075434_1010483182 180
263 3300006881 Ga0068865_100013935 Ga0068865_1000139353 180
264 3300006931 Ga0097620_100005667 Ga0097620_1000056679 180
265 3300006931 Ga0097620_100968713 Ga0097620_1009687132 180
266 3300007788 Ga0099795_10021478 Ga0099795_100214783 180
267 3300009098 Ga0105245_10023517 Ga0105245_100235174 180
268 3300009098 Ga0105245_10172380 Ga0105245_101723804 180
269 3300009098 Ga0105245_10835300 Ga0105245_108353002 180
270 3300009101 Ga0105247_10001481 Ga0105247_1000148113 180
271 3300009101 Ga0105247_10062423 Ga0105247_100624236 180
272 3300009101 Ga0105247_10785381 Ga0105247_107853812 180
273 3300009147 Ga0114129_10348679 Ga0114129_103486794 180
274 3300009148 Ga0105243_10001598 Ga0105243_1000159811 180
275 3300009174 Ga0105241_10115150 Ga0105241_101151502 180
276 3300009174 Ga0105241_10622755 Ga0105241_106227552 180
277 3300009176 Ga0105242_10026490 Ga0105242_100264903 180
278 3300009176 Ga0105242_11533632 Ga0105242_115336321 180
279 3300009177 Ga0105248_10018191 Ga0105248_100181916 180
280 3300009177 Ga0105248_10032663 Ga0105248_100326638 180
281 3300009177 Ga0105248_10117672 Ga0105248_101176722 180
282 3300009177 Ga0105248_10290191 Ga0105248_102901912 180
283 3300009177 Ga0105248_11563268 Ga0105248_115632681 180
284 3300009545 Ga0105237_10049359 Ga0105237_100493597 180
285 3300009551 Ga0105238_10072625 Ga0105238_100726253 180
286 3300009553 Ga0105249_10003095 Ga0105249_100030957 180
287 3300009553 Ga0105249_10843607 Ga0105249_108436072 180
288 3300010375 Ga0105239_10001018 Ga0105239_100010189 180
289 3300010375 Ga0105239_10107756 Ga0105239_101077562 180
290 3300010375 Ga0105239_10108882 Ga0105239_101088822 180
291 3300010375 Ga0105239_10395357 Ga0105239_103953574 180
292 3300010375 Ga0105239_10707330 Ga0105239_107073301 180
293 3300011119 Ga0105246_10024745 Ga0105246_100247453 180
294 3300011119 Ga0105246_10548943 Ga0105246_105489431 180
295 3300013105 Ga0157369_10224956 Ga0157369_102249562 180
296 3300013296 Ga0157374_10080946 Ga0157374_100809466 180
297 3300013296 Ga0157374_10281356 Ga0157374_102813562 180
298 3300013297 Ga0157378_10011978 Ga0157378_100119786 180
299 3300013306 Ga0163162_10050817 Ga0163162_100508173 180
300 3300013306 Ga0163162_10143195 Ga0163162_101431952 180
301 3300013306 Ga0163162_10250845 Ga0163162_102508452 180
302 3300013306 Ga0163162_10620518 Ga0163162_106205182 180
303 3300013307 Ga0157372_10008420 Ga0157372_100084204 180
304 3300013308 Ga0157375_10001902 Ga0157375_100019027 180
305 3300013308 Ga0157375_10068914 Ga0157375_100689142 180
306 3300013308 Ga0157375_10445174 Ga0157375_104451741 180
307 3300013308 Ga0157375_10716601 Ga0157375_107166012 180
308 3300014325 Ga0163163_10063814 Ga0163163_100638144 180
309 3300014325 Ga0163163_11175625 Ga0163163_111756252 180
310 3300014326 Ga0157380_10014952 Ga0157380_100149526 180
311 3300014326 Ga0157380_10133694 Ga0157380_101336943 180
312 3300014326 Ga0157380_10145695 Ga0157380_101456952 180
313 3300014745 Ga0157377_10143130 Ga0157377_101431302 180
314 3300014968 Ga0157379_10241954 Ga0157379_102419542 180
315 3300014968 Ga0157379_10339071 Ga0157379_103390713 180
316 3300014968 Ga0157379_10765006 Ga0157379_107650062 180
317 3300014969 Ga0157376_10017806 Ga0157376_100178063 180
318 3300014969 Ga0157376_10087394 Ga0157376_100873943 180
319 3300014969 Ga0157376_10412153 Ga0157376_104121532 180
320 3300017792 Ga0163161_10001691 Ga0163161_1000169110 180
321 3300025273 Ga0209673_1020913 Ga0209673_10209133 180
322 3300025303 Ga0209051_1000478 Ga0209051_100047842 180
323 3300025303 Ga0209051_1002514 Ga0209051_10025143 180
324 3300025303 Ga0209051_1007549 Ga0209051_10075496 180
325 3300025711 Ga0207696_1073071 Ga0207696_10730711 180
326 3300025885 Ga0207653_10101397 Ga0207653_101013972 180
327 3300025898 Ga0207692_10008286 Ga0207692_100082862 180
328 3300025898 Ga0207692_10289649 Ga0207692_102896492 180
329 3300025899 Ga0207642_10000759 Ga0207642_100007593 180
330 3300025900 Ga0207710_10015573 Ga0207710_100155732 180
331 3300025900 Ga0207710_10178977 Ga0207710_101789772 180
332 3300025901 Ga0207688_10000800 Ga0207688_100008003 180
333 3300025901 Ga0207688_10001392 Ga0207688_1000139210 180
334 3300025901 Ga0207688_10082013 Ga0207688_100820132 180
335 3300025901 Ga0207688_10257250 Ga0207688_102572502 180
336 3300025903 Ga0207680_10020950 Ga0207680_100209503 180
337 3300025904 Ga0207647_10209396 Ga0207647_102093962 180
338 3300025906 Ga0207699_10186830 Ga0207699_101868302 180
339 3300025907 Ga0207645_10008279 Ga0207645_100082796 180
340 3300025908 Ga0207643_10025005 Ga0207643_100250052 180
341 3300025914 Ga0207671_10160399 Ga0207671_101603992 180
342 3300025915 Ga0207693_10004684 Ga0207693_100046846 180
343 3300025915 Ga0207693_10019343 Ga0207693_100193435 180
344 3300025916 Ga0207663_10003448 Ga0207663_100034484 180
345 3300025918 Ga0207662_10116357 Ga0207662_101163573 180
346 3300025919 Ga0207657_10219002 Ga0207657_102190023 180
347 3300025923 Ga0207681_10025164 Ga0207681_100251643 180
348 3300025927 Ga0207687_10029352 Ga0207687_100293523 180
349 3300025927 Ga0207687_10451860 Ga0207687_104518602 180
350 3300025931 Ga0207644_10013355 Ga0207644_100133555 180
351 3300025931 Ga0207644_10176622 Ga0207644_101766222 180
352 3300025932 Ga0207690_10671898 Ga0207690_106718982 180
353 3300025933 Ga0207706_10004948 Ga0207706_100049485 180
354 3300025933 Ga0207706_10006772 Ga0207706_1000677213 180
355 3300025934 Ga0207686_10021012 Ga0207686_100210125 180
356 3300025934 Ga0207686_10025138 Ga0207686_100251383 180
357 3300025935 Ga0207709_10002953 Ga0207709_1000295312 180
358 3300025937 Ga0207669_10022587 Ga0207669_100225873 180
359 3300025938 Ga0207704_10020736 Ga0207704_100207363 180
360 3300025939 Ga0207665_10001283 Ga0207665_100012834 180
361 3300025939 Ga0207665_10006794 Ga0207665_1000679410 180
362 3300025940 Ga0207691_10188716 Ga0207691_101887164 180
363 3300025941 Ga0207711_10055328 Ga0207711_100553283 180
364 3300025941 Ga0207711_10299405 Ga0207711_102994052 180
365 3300025941 Ga0207711_10468186 Ga0207711_104681864 180
366 3300025942 Ga0207689_10023810 Ga0207689_100238104 180
367 3300025944 Ga0207661_10533234 Ga0207661_105332342 180
368 3300025949 Ga0207667_10076280 Ga0207667_100762803 180
369 3300025949 Ga0207667_10727683 Ga0207667_107276832 180
370 3300025960 Ga0207651_10130714 Ga0207651_101307143 180
371 3300025960 Ga0207651_10367449 Ga0207651_103674492 180
372 3300025961 Ga0207712_10056986 Ga0207712_100569862 180
373 3300025961 Ga0207712_10125671 Ga0207712_101256712 180
374 3300025972 Ga0207668_10002928 Ga0207668_1000292810 180
375 3300025972 Ga0207668_10042692 Ga0207668_100426921 180
376 3300025981 Ga0207640_10003175 Ga0207640_100031759 180
377 3300025981 Ga0207640_11076708 Ga0207640_110767081 180
378 3300025986 Ga0207658_10002139 Ga0207658_100021397 180
379 3300025986 Ga0207658_10050918 Ga0207658_100509183 180
380 3300025986 Ga0207658_10076485 Ga0207658_100764852 180
381 3300025986 Ga0207658_10232524 Ga0207658_102325242 180
382 3300025986 Ga0207658_10327781 Ga0207658_103277812 180
383 3300026023 Ga0207677_10008137 Ga0207677_100081375 180
384 3300026023 Ga0207677_10359725 Ga0207677_103597252 180
385 3300026035 Ga0207703_10003076 Ga0207703_1000307612 180
386 3300026035 Ga0207703_10093069 Ga0207703_100930694 180
387 3300026035 Ga0207703_10201322 Ga0207703_102013222 180
388 3300026035 Ga0207703_10414246 Ga0207703_104142462 180
389 3300026041 Ga0207639_10013377 Ga0207639_100133773 180
390 3300026041 Ga0207639_10034452 Ga0207639_100344523 180
391 3300026041 Ga0207639_10147672 Ga0207639_101476722 180
392 3300026041 Ga0207639_10392549 Ga0207639_103925492 180
393 3300026067 Ga0207678_10002992 Ga0207678_100029924 180
394 3300026067 Ga0207678_10049345 Ga0207678_100493454 180
395 3300026067 Ga0207678_10079587 Ga0207678_100795874 180
396 3300026067 Ga0207678_10318717 Ga0207678_103187172 180
397 3300026075 Ga0207708_10007438 Ga0207708_100074389 180
398 3300026075 Ga0207708_10034824 Ga0207708_100348243 180
399 3300026078 Ga0207702_10543826 Ga0207702_105438262 180
400 3300026078 Ga0207702_10844443 Ga0207702_108444432 180
401 3300026088 Ga0207641_10019027 Ga0207641_100190272 180
402 3300026089 Ga0207648_10001849 Ga0207648_1000184913 180
403 3300026089 Ga0207648_10019514 Ga0207648_100195145 180
404 3300026095 Ga0207676_10087144 Ga0207676_100871442 180
405 3300026095 Ga0207676_10367807 Ga0207676_103678073 180
406 3300026118 Ga0207675_100009494 Ga0207675_1000094946 180
407 3300026118 Ga0207675_100201461 Ga0207675_1002014614 180
408 3300026121 Ga0207683_10004741 Ga0207683_100047414 180
409 3300026121 Ga0207683_10401461 Ga0207683_104014612 180
410 3300026142 Ga0207698_10047260 Ga0207698_100472603 180
411 3300026142 Ga0207698_10450323 Ga0207698_104503232 180
412 3300026142 Ga0207698_10478924 Ga0207698_104789242 180
413 3300028379 Ga0268266_10002437 Ga0268266_1000243716 180
414 3300028379 Ga0268266_10063227 Ga0268266_100632273 180
415 3300028380 Ga0268265_10160579 Ga0268265_101605793 180
416 3300028381 Ga0268264_10002313 Ga0268264_100023132 180
417 3300028381 Ga0268264_11482925 Ga0268264_114829251 180
418 3300031824 Ga0307413_10160587 Ga0307413_101605872 180
419 3300031852 Ga0307410_10050557 Ga0307410_100505572 180
420 3300031852 Ga0307410_10089870 Ga0307410_100898701 180
421 3300031852 Ga0307410_10797242 Ga0307410_107972421 180
422 3300031995 Ga0307409_100021152 Ga0307409_1000211522 180
423 3300032004 Ga0307414_10309168 Ga0307414_103091681 180
424 3300032126 Ga0307415_100275877 Ga0307415_1002758772 180
425 3300034957 Ga0373938_0079066 Ga0373938_0079066_14_589 180
426 3300035088 Ga0373940_0126999 Ga0373940_0126999_150_725 180
427 3300035091 Ga0373951_0024188 Ga0373951_0024188_62_637 180
428 3300035691 Ga0373931_0101837 Ga0373931_0101837_591_1133 180
429 3300035691 Ga0373931_0176249 Ga0373931_0176249_130_705 180
430 3300035695 Ga0373927_0715856 Ga0373927_0715856_82_627 180
431 3300038443 Ga0395901_0734921 Ga0395901_0734921_286_861 180
432 3300039450 Ga0436363_1376696 Ga0436363_1376696_1143_1688 180
433 3300041410 Ga0439461_0007032 Ga0439461_0007032_430_972 180
434 3300041410 Ga0439461_0010928 Ga0439461_0010928_1119_1661 180
435 3300041413 Ga0439465_0002775 Ga0439465_0002775_1070_1612 180
436 3300041413 Ga0439465_0004364 Ga0439465_0004364_217_759 180
437 3300041443 Ga0451789_0587683 Ga0451789_0587683_179_733 180
438 3300041452 Ga0451793_1165290 Ga0451793_1165290_307_861 180
439 3300041456 Ga0451795_0480540 Ga0451795_0480540_1024_1578 180
440 3300041486 Ga0451807_2720499 Ga0451807_2720499_22_576 180
441 3300041512 Ga0451853_3778465 Ga0451853_3778465_76_621 180
442 3300041997 Ga0439431_0003038 Ga0439431_0003038_392_934 180
443 3300042002 Ga0439442_008866 Ga0439442_008866_777_1319 180
444 3300042004 Ga0439445_0096886 Ga0439445_0096886_47_589 180
445 3300042435 Ga0439434_0049932 Ga0439434_0049932_735_1277 180
446 3300044658 Ga0466972_0006124 Ga0466972_0006124_5028_5588 180
447 3300044658 Ga0466972_0034430 Ga0466972_0034430_1267_1824 180
448 3300044683 Ga0466965_0002380 Ga0466965_0002380_634_1194 180
449 3300044683 Ga0466965_0068328 Ga0466965_0068328_1223_1765 180
450 3300044693 Ga0466961_0090477 Ga0466961_0090477_1063_1605 180
451 3300044694 Ga0466963_0161652 Ga0466963_0161652_302_844 180
452 3300044706 Ga0466964_0282290 Ga0466964_0282290_158_700 180
453 3300044735 Ga0466968_0113853 Ga0466968_0113853_380_937 180
454 3300044765 Ga0466970_0130368 Ga0466970_0130368_806_1357 180
455 3300044842 Ga0466957_0269842 Ga0466957_0269842_150_707 180
456 3300044901 Ga0466960_0000572 Ga0466960_0000572_573_1133 180
457 3300045049 Ga0466959_0115525 Ga0466959_0115525_658_1215 180
458 3300045976 Ga0466967_0036973 Ga0466967_0036973_1085_1633 180
459 3300045976 Ga0466967_0495914 Ga0466967_0495914_172_714 180
460 3300045976 Ga0466967_1671988 Ga0466967_1671988_11_559 180
461 3300045976 Ga0466967_1837017 Ga0466967_1837017_17_568 180
462 3300046455 Ga0495603_0068308 Ga0495603_0068308_1185_1730 180
463 3300046459 Ga0495629_0053911 Ga0495629_0053911_852_1397 180
464 3300046460 Ga0495638_0002750 Ga0495638_0002750_10678_11232 180
465 3300046461 Ga0495641_0024960 Ga0495641_0024960_1255_1800 180
466 3300046473 Ga0495582_0146806 Ga0495582_0146806_172_717 180
467 3300046506 Ga0495583_0060721 Ga0495583_0060721_859_1413 180
468 3300046517 Ga0495630_0361216 Ga0495630_0361216_318_863 180
469 3300046524 Ga0495648_0002742 Ga0495648_0002742_900_1454 180
470 3300046530 Ga0495654_0137008 Ga0495654_0137008_75_629 180
471 3300046531 Ga0495665_0084544 Ga0495665_0084544_599_1144 180
472 3300046533 Ga0495640_0088987 Ga0495640_0088987_885_1430 180
473 3300046533 Ga0495640_0254276 Ga0495640_0254276_95_646 180
474 3300046616 Ga0495668_0032174 Ga0495668_0032174_342_896 180
475 3300046642 Ga0495634_0398731 Ga0495634_0398731_257_802 180
476 3300046648 Ga0495611_0245270 Ga0495611_0245270_150_704 180
477 3300046663 Ga0495635_0085490 Ga0495635_0085490_1282_1836 180
478 3300046683 Ga0495658_0011681 Ga0495658_0011681_2129_2674 180
479 3300046689 Ga0495613_0340263 Ga0495613_0340263_387_932 180
480 3300046690 Ga0495624_0204588 Ga0495624_0204588_524_1069 180
481 3300047315 Ga0495581_0052610 Ga0495581_0052610_1549_2094 180
482 3300047320 Ga0495672_0002921 Ga0495672_0002921_793_1347 180
483 3300047320 Ga0495672_0075972 Ga0495672_0075972_453_995 180
484 3300047320 Ga0495672_0140634 Ga0495672_0140634_596_1150 180
485 3300047321 Ga0495676_0291791 Ga0495676_0291791_53_598 180
486 3300047469 Ga0495673_0001467 Ga0495673_0001467_6715_7269 180
487 3300047472 Ga0495686_0008890 Ga0495686_0008890_4300_4869 180
488 3300048091 Ga0495626_0022103 Ga0495626_0022103_2243_2797 180
489 3300048903 Ga0496100_0004450 Ga0496100_0004450_2690_3247 180
490 3300048903 Ga0496100_0014240 Ga0496100_0014240_1519_2073 180
491 3300048903 Ga0496100_0051247 Ga0496100_0051247_221_763 180
492 3300048903 Ga0496100_0163002 Ga0496100_0163002_527_1072 180
493 3300048903 Ga0496100_0333880 Ga0496100_0333880_173_754 180
494 3300048904 Ga0496101_0000014 Ga0496101_0000014_202017_202571 180
495 3300048904 Ga0496101_0003353 Ga0496101_0003353_6306_6848 180
496 3300048904 Ga0496101_0004665 Ga0496101_0004665_3953_4510 180
497 3300048904 Ga0496101_0090391 Ga0496101_0090391_658_1233 180
498 3300048904 Ga0496101_0651277 Ga0496101_0651277_230_775 180
499 3300048905 Ga0496102_0000041 Ga0496102_0000041_71248_71802 180
500 3300048905 Ga0496102_0007297 Ga0496102_0007297_6839_7381 180
501 3300048905 Ga0496102_0009843 Ga0496102_0009843_1141_1683 180
502 3300048905 Ga0496102_0127430 Ga0496102_0127430_437_1012 180
503 3300048905 Ga0496102_0262656 Ga0496102_0262656_719_1264 180
504 3300048905 Ga0496102_0410497 Ga0496102_0410497_342_917 180
505 3300048906 Ga0496103_0000058 Ga0496103_0000058_52129_52683 180
506 3300048906 Ga0496103_0044212 Ga0496103_0044212_357_899 180
507 3300048906 Ga0496103_0118286 Ga0496103_0118286_1050_1625 180
508 3300048906 Ga0496103_0177331 Ga0496103_0177331_402_977 180
509 3300048907 Ga0496104_0008084 Ga0496104_0008084_3937_4494 180
510 3300048907 Ga0496104_0060614 Ga0496104_0060614_2931_3473 180
511 3300048907 Ga0496104_0108110 Ga0496104_0108110_1715_2257 180
512 3300048907 Ga0496104_0132311 Ga0496104_0132311_855_1430 180
513 3300048907 Ga0496104_0183810 Ga0496104_0183810_116_661 180
514 3300048908 Ga0496105_0003856 Ga0496105_0003856_5086_5643 180
515 3300048908 Ga0496105_0264487 Ga0496105_0264487_243_785 180
516 3300048908 Ga0496105_0396548 Ga0496105_0396548_251_826 180
517 3300048908 Ga0496105_0821401 Ga0496105_0821401_56_631 180
518 3300048909 Ga0496106_0007881 Ga0496106_0007881_4187_4744 180
519 3300048909 Ga0496106_0014123 Ga0496106_0014123_761_1303 180
520 3300048909 Ga0496106_0016728 Ga0496106_0016728_872_1426 180
521 3300048910 Ga0496107_0011115 Ga0496107_0011115_3232_3807 180
522 3300048910 Ga0496107_0044133 Ga0496107_0044133_940_1482 180
523 3300048910 Ga0496107_0046533 Ga0496107_0046533_1022_1579 180
524 3300048910 Ga0496107_0059843 Ga0496107_0059843_1342_1896 180
525 3300048910 Ga0496107_0419333 Ga0496107_0419333_406_948 180
526 3300048911 Ga0496108_0013556 Ga0496108_0013556_4913_5488 180
527 3300048911 Ga0496108_0048734 Ga0496108_0048734_2495_3070 180
528 3300048911 Ga0496108_0147441 Ga0496108_0147441_23_580 180
529 3300048912 Ga0496109_0056521 Ga0496109_0056521_2171_2713 180
530 3300048912 Ga0496109_0092452 Ga0496109_0092452_1627_2202 180
531 3300048912 Ga0496109_0093377 Ga0496109_0093377_2025_2600 180
532 3300048912 Ga0496109_0225818 Ga0496109_0225818_250_795 180
533 3300048912 Ga0496109_0488629 Ga0496109_0488629_585_1127 180
534 3300048913 Ga0496110_0010152 Ga0496110_0010152_1383_1925 180
535 3300048914 Ga0496111_0057053 Ga0496111_0057053_1620_2195 180
536 3300048914 Ga0496111_0188621 Ga0496111_0188621_811_1356 180
537 3300048914 Ga0496111_0266590 Ga0496111_0266590_384_926 180
538 3300048915 Ga0496112_0006436 Ga0496112_0006436_7346_7921 180
539 3300048915 Ga0496112_0012706 Ga0496112_0012706_4908_5453 180
540 3300048916 Ga0496113_0006742 Ga0496113_0006742_4353_4934 180
541 3300048916 Ga0496113_0096160 Ga0496113_0096160_988_1563 180
542 3300048917 Ga0496114_0001744 Ga0496114_0001744_2180_2722 180
543 3300048917 Ga0496114_0008198 Ga0496114_0008198_3923_4480 180
544 3300048917 Ga0496114_0088739 Ga0496114_0088739_1568_2143 180
545 3300048918 Ga0496115_0006154 Ga0496115_0006154_8184_8726 180
546 3300048918 Ga0496115_0006640 Ga0496115_0006640_4222_4779 180
547 3300048919 Ga0496116_0000098 Ga0496116_0000098_71111_71665 180
548 3300048920 Ga0496117_0000096 Ga0496117_0000096_71402_71956 180
549 3300048921 Ga0496118_0000073 Ga0496118_0000073_124833_125387 180
550 3300048922 Ga0496119_0114735 Ga0496119_0114735_202_756 180
551 3300048923 Ga0496120_0101653 Ga0496120_0101653_485_1039 180
552 3300048923 Ga0496120_0146039 Ga0496120_0146039_420_1001 180
553 3300048924 Ga0496121_0000354 Ga0496121_0000354_58033_58587 180
554 3300048925 Ga0496122_0096805 Ga0496122_0096805_1170_1751 180
555 3300048925 Ga0496122_0185277 Ga0496122_0185277_454_1008 180
556 3300048926 Ga0496123_0055470 Ga0496123_0055470_16_597 180
557 3300048929 Ga0496126_0001057 Ga0496126_0001057_26229_26783 180
558 3300048929 Ga0496126_0002185 Ga0496126_0002185_3580_4161 180
559 3300049569 Ga0501032_0016653 Ga0501032_0016653_4222_4773 180
560 3300049570 Ga0501033_0344770 Ga0501033_0344770_77_628 180
561 3300049571 Ga0501034_0055117 Ga0501034_0055117_3056_3607 180
562 3300049572 Ga0501036_0004272 Ga0501036_0004272_4822_5373 180
563 3300049573 Ga0501037_0001645 Ga0501037_0001645_15305_15856 180
564 3300049574 Ga0501038_0026442 Ga0501038_0026442_396_947 180
565 3300049575 Ga0501039_0000415 Ga0501039_0000415_29681_30232 180
566 3300049576 Ga0501040_0663000 Ga0501040_0663000_28_579 180
567 3300049579 Ga0501043_0001031 Ga0501043_0001031_15305_15856 180
568 3300049581 Ga0501047_0096689 Ga0501047_0096689_2037_2594 180
569 3300049584 Ga0501068_0093339 Ga0501068_0093339_690_1241 180
570 3300049586 Ga0501070_0000517 Ga0501070_0000517_283_834 180
571 3300049589 Ga0501073_0101235 Ga0501073_0101235_62_613 180
572 3300050490 nmdc:mga03n38_18613_c1 nmdc:mga03n38_18613_c1_1438_1980 180
573 3300050490 nmdc:mga03n38_75125_c1 nmdc:mga03n38_75125_c1_83_634 180
574 3300050490 nmdc:mga03n38_988_c1 nmdc:mga03n38_988_c1_386_931 180
575 3300050491 nmdc:mga00v17_14597_c1 nmdc:mga00v17_14597_c1_3697_4239 180
576 3300050491 nmdc:mga00v17_210840_c1 nmdc:mga00v17_210840_c1_279_833 180
577 3300050491 nmdc:mga00v17_2895_c1 nmdc:mga00v17_2895_c1_337_879 180
578 3300050492 nmdc:mga0yw44_367000_c1 nmdc:mga0yw44_367000_c1_11_553 180
579 3300050494 nmdc:mga06z11_102046_c1 nmdc:mga06z11_102046_c1_132_680 180
580 3300050494 nmdc:mga06z11_105582_c1 nmdc:mga06z11_105582_c1_599_1141 180
581 3300050494 nmdc:mga06z11_58903_c1 nmdc:mga06z11_58903_c1_609_1151 180
582 3300050496 nmdc:mga07m45_251625_c1 nmdc:mga07m45_251625_c1_80_622 180
583 3300050496 nmdc:mga07m45_479723_c1 nmdc:mga07m45_479723_c1_110_652 180
584 3300050507 nmdc:mga05p37_118759_c1 nmdc:mga05p37_118759_c1_233_775 180
585 3300050509 nmdc:mga0qj67_27151_c1 nmdc:mga0qj67_27151_c1_2002_2544 180
586 3300050510 nmdc:mga06r32_151410_c1 nmdc:mga06r32_151410_c1_1325_1867 180
587 3300050516 nmdc:mga0sz30_16563_c1 nmdc:mga0sz30_16563_c1_949_1491 180
588 3300050516 nmdc:mga0sz30_177101_c1 nmdc:mga0sz30_177101_c1_313_891 180
589 3300050516 nmdc:mga0sz30_30161_c1 nmdc:mga0sz30_30161_c1_1078_1632 180
590 3300050516 nmdc:mga0sz30_39146_c1 nmdc:mga0sz30_39146_c1_597_1151 180
591 3300050516 nmdc:mga0sz30_40019_c1 nmdc:mga0sz30_40019_c1_40_588 180
592 3300050516 nmdc:mga0sz30_43208_c1 nmdc:mga0sz30_43208_c1_1067_1609 180
593 3300053079 Ga0500610_0013266 Ga0500610_0013266_709_1263 180
594 3300053098 Ga0500650_0129247 Ga0500650_0129247_608_1162 180
595 3300053108 Ga0500562_004189 Ga0500562_004189_3071_3625 180
596 3300053134 Ga0500658_0420096 Ga0500658_0420096_19_573 180
597 3300053142 Ga0500577_0028326 Ga0500577_0028326_765_1319 180
598 3300053153 Ga0500616_0011053 Ga0500616_0011053_2655_3197 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

72

154

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.8851 47 173
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.8847 46 178
2oyo-assembly1.cif.gz_A crystal structure of uncharacterized peroxidase-related protein (yp_604910.1) from deinococcus geothermalis dsm 11300 at 1.51 a resolution 0.8603 5 175
6k40-assembly5.cif.gz_K crystal structure of alkyl hydroperoxide reductase from d. radiodurans r1 0.854 18 179
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.8533 47 177
ID Description Score Start End Superfamily
af_O53905_23_180_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9591 36 179 1.20.1290.10
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9519 45 177 1.20.1290.10
af_O53749_49_187_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9047 45 177 1.20.1290.10
af_P76222_42_172_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8994 53 176 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8907 47 180 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A2S7NHY5-F1-model_v4 deleted 0.9989 6 180
AF-A0A6N4WJL0-F1-model_v4 4-carboxymuconolactone decarboxylase 0.9955 35 180 GO:0051920
AF-A0A1G6VYN6-F1-model_v4 Alkylhydroperoxidase AhpD family core domain-containing protein 0.9889 6 178 GO:0051920
AF-A0A6N4WJL0-F1-model_v4 4-carboxymuconolactone decarboxylase 0.9888 35 180 GO:0051920
AF-Q0SEU6-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9883 5 178 GO:0051920

Feature Viewer

pLDDT pTM Quality
95.88 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map