F467718

General Info

Members Datasets Scaffolds Average Seq Length
597 237 1194 141

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_283678_c1|nmdc:mga05p37_283678_c1_441_935
Length 164
Sequence MTLCFLTHGERADINLPHEGVATMRKHILLGVACISLALAAAPLRAHHAFSAEFDAEKPLKLEGKISKTEWVNPHAWIHIDVKKADGTTEVWMIEGGTPNSLMRRGVSRDTLTIGTPVVVTGYQAKDGSNRANGRDITYPDGRKLFLGSTGTGAPYDKEPKEKK

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300002865 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_4 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003161 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_8 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003291 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
56 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
173 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
174 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
178 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
179 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
180 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
181 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
182 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
183 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
184 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
189 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
192 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
193 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
213 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
214 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
218 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.14
Metatranscriptomes 4.86
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.17
Rhizosphere 98.83
Stem 0
Stem Tuber 0
Unclassified 34.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_283678_c1 3300050507 Unclassified 1974
2 SwRhRL2b_contig_1259039 2162886007 Unclassified 802
3 JGI24746J21847_1008266 3300001977 Unclassified 1574
4 Ga0006761J43178_105119 3300002865 Bacteria 552
5 Ga0006762J43184_103745 3300002872 Bacteria 548
6 Ga0006765J45826_112004 3300003161 Unclassified 564
7 Ga0007421J48921_103838 3300003291 Bacteria 546
8 Ga0006758J48902_1014190 3300003300 Unclassified 562
9 Ga0007417J51691_1009704 3300003544 Unclassified 563
10 Ga0007417J51691_1049215 3300003544 Unclassified 501
11 Ga0006781J51513_1009835 3300003568 Bacteria 544
12 Ga0007410J51695_1004260 3300003574 Bacteria 563
13 Ga0007410J51695_1017249 3300003574 Unclassified 564
14 Ga0007409J51694_1003563 3300003575 Bacteria 558
15 Ga0032354_1007556 3300003693 Unclassified 560
16 Ga0058863_11722133 3300004799 Unclassified 586
17 Ga0058861_11806767 3300004800 Unclassified 542
18 Ga0058862_12663553 3300004803 Unclassified 593
19 Ga0065704_10136055 3300005289 Bacteria 1570
20 Ga0065704_10158328 3300005289 Unclassified 1373
21 Ga0065704_10312796 3300005289 Unclassified 865
22 Ga0065712_10016177 3300005290 Unclassified 2137
23 Ga0065712_10234246 3300005290 Bacteria 1002
24 Ga0065715_10000814 3300005293 Bacteria 8762
25 Ga0065715_10121116 3300005293 Bacteria 2224
26 Ga0065715_10614246 3300005293 Bacteria 699
27 Ga0065707_10087934 3300005295 Bacteria 4839
28 Ga0065707_10165965 3300005295 Bacteria 1522
29 Ga0065707_10229683 3300005295 Bacteria 1193
30 Ga0065707_10246770 3300005295 Bacteria 1138
31 Ga0070676_10005751 3300005328 Bacteria 6610
32 Ga0070676_10068870 3300005328 Unclassified 2119
33 Ga0070676_10858121 3300005328 Bacteria 674
34 Ga0070683_100798988 3300005329 Unclassified 904
35 Ga0070690_100003025 3300005330 Bacteria 9121
36 Ga0070690_100189342 3300005330 Bacteria 1426
37 Ga0070690_100995582 3300005330 Bacteria 660
38 Ga0070690_101274184 3300005330 Bacteria 588
39 Ga0070670_100003205 3300005331 Bacteria 13509
40 Ga0070670_100030357 3300005331 Bacteria 4655
41 Ga0070670_100065722 3300005331 Bacteria 3112
42 Ga0070677_10000760 3300005333 Bacteria 10728
43 Ga0070677_10000858 3300005333 Bacteria 10008
44 Ga0070677_10013520 3300005333 Bacteria 2857
45 Ga0068869_100003046 3300005334 Bacteria 10193
46 Ga0068869_100031295 3300005334 Bacteria 3742
47 Ga0068869_100051484 3300005334 Unclassified 2988
48 Ga0068869_100189868 3300005334 Unclassified 1615
49 Ga0068869_100352759 3300005334 Unclassified 1199
50 Ga0068869_100408379 3300005334 Bacteria 1118
51 Ga0068869_100747880 3300005334 Bacteria 837
52 Ga0070666_10015554 3300005335 Bacteria 4855
53 Ga0070666_10431014 3300005335 Unclassified 951
54 Ga0070680_100777755 3300005336 Bacteria 824
55 Ga0070680_101660205 3300005336 Unclassified 554
56 Ga0068868_100189480 3300005338 Bacteria 1710
57 Ga0068868_100238991 3300005338 Archaea 1525
58 Ga0070660_100209722 3300005339 Bacteria 1581
59 Ga0070689_100007876 3300005340 Bacteria 7471
60 Ga0070689_100109188 3300005340 Bacteria 2199
61 Ga0070687_100031877 3300005343 Bacteria 2589
62 Ga0070687_100424227 3300005343 Bacteria 878
63 Ga0070661_100006827 3300005344 Bacteria 7868
64 Ga0070668_100009031 3300005347 Bacteria 7404
65 Ga0070669_100004620 3300005353 Bacteria 9935
66 Ga0070669_100027779 3300005353 Bacteria 4073
67 Ga0070669_100038778 3300005353 Unclassified 3459
68 Ga0070669_100226672 3300005353 Unclassified 1479
69 Ga0070675_100003504 3300005354 Bacteria 11906
70 Ga0070675_100014936 3300005354 Bacteria 6132
71 Ga0070675_100399084 3300005354 Unclassified 1226
72 Ga0070675_100604547 3300005354 Unclassified 995
73 Ga0070671_100109758 3300005355 Unclassified 2317
74 Ga0070671_100930778 3300005355 Unclassified 760
75 Ga0070671_101762690 3300005355 Unclassified 550
76 Ga0070674_100001750 3300005356 Bacteria 11774
77 Ga0070674_100043438 3300005356 Bacteria 3058
78 Ga0070674_101715668 3300005356 Bacteria 568
79 Ga0070673_100007287 3300005364 Bacteria 7283
80 Ga0070673_100017761 3300005364 Bacteria 5068
81 Ga0070673_100044399 3300005364 Unclassified 3441
82 Ga0070673_100110120 3300005364 Bacteria 2283
83 Ga0070673_100853807 3300005364 Bacteria 842
84 Ga0070688_100057260 3300005365 Unclassified 2449
85 Ga0070688_100148366 3300005365 Bacteria 1601
86 Ga0070688_100159834 3300005365 Bacteria 1547
87 Ga0070688_100466551 3300005365 Bacteria 947
88 Ga0070688_100783345 3300005365 Bacteria 744
89 Ga0070659_100022315 3300005366 Bacteria 4831
90 Ga0070667_100003935 3300005367 Bacteria 12618
91 Ga0070667_100100284 3300005367 Unclassified 2500
92 Ga0070667_100976018 3300005367 Bacteria 790
93 Ga0070703_10038880 3300005406 Unclassified 1472
94 Ga0070711_100733790 3300005439 Unclassified 834
95 Ga0070705_100696918 3300005440 Unclassified 797
96 Ga0070700_100001040 3300005441 Bacteria 13728
97 Ga0070700_100490995 3300005441 Unclassified 942
98 Ga0070700_100532218 3300005441 Bacteria 910
99 Ga0070700_100537242 3300005441 Bacteria 906
100 Ga0070700_100589819 3300005441 Bacteria 869
101 Ga0070700_101330082 3300005441 Bacteria 605
102 Ga0070694_100009935 3300005444 Bacteria 5848
103 Ga0070694_100155415 3300005444 Unclassified 1674
104 Ga0070708_100143881 3300005445 Unclassified 2213
105 Ga0070708_100228455 3300005445 Bacteria 1746
106 Ga0070663_100117909 3300005455 Archaea 2002
107 Ga0070678_100012188 3300005456 Bacteria 5333
108 Ga0070678_100042740 3300005456 Bacteria 3224
109 Ga0070678_100144249 3300005456 Bacteria 1909
110 Ga0070678_100562585 3300005456 Bacteria 1013
111 Ga0070678_100708331 3300005456 Bacteria 908
112 Ga0070662_100003906 3300005457 Bacteria 9347
113 Ga0070662_100022689 3300005457 Unclassified 4299
114 Ga0068867_100007175 3300005459 Bacteria 7876
115 Ga0068867_100284233 3300005459 Unclassified 1358
116 Ga0068867_100700697 3300005459 Unclassified 894
117 Ga0068867_101468317 3300005459 Bacteria 634
118 Ga0070685_10018478 3300005466 Unclassified 3749
119 Ga0070706_100237995 3300005467 Unclassified 1700
120 Ga0070706_100637944 3300005467 Bacteria 989
121 Ga0070706_100824692 3300005467 Bacteria 858
122 Ga0070707_100034740 3300005468 Unclassified 4810
123 Ga0070707_100071570 3300005468 Bacteria 3341
124 Ga0070707_100780893 3300005468 Unclassified 919
125 Ga0070698_100291233 3300005471 Unclassified 1564
126 Ga0070699_100050272 3300005518 Bacteria 3609
127 Ga0070699_100057919 3300005518 Bacteria 3355
128 Ga0070699_100282938 3300005518 Bacteria 1486
129 Ga0070697_100123727 3300005536 Unclassified 2165
130 Ga0070697_100131816 3300005536 Bacteria 2097
131 Ga0070672_100054553 3300005543 Unclassified 3129
132 Ga0070672_100342998 3300005543 Bacteria 1272
133 Ga0070672_100375247 3300005543 Unclassified 1216
134 Ga0070686_100001581 3300005544 Bacteria 12793
135 Ga0070686_101334069 3300005544 Bacteria 600
136 Ga0070695_100001596 3300005545 Bacteria 12687
137 Ga0070695_100516233 3300005545 Unclassified 926
138 Ga0070695_100664474 3300005545 Bacteria 824
139 Ga0070696_100008261 3300005546 Bacteria 6967
140 Ga0070696_100098821 3300005546 Bacteria 2088
141 Ga0070696_100484164 3300005546 Bacteria 982
142 Ga0070696_100862513 3300005546 Unclassified 749
143 Ga0070696_100971052 3300005546 Bacteria 708
144 Ga0070693_100304507 3300005547 Unclassified 1075
145 Ga0070665_100006532 3300005548 Bacteria 11846
146 Ga0070704_100092376 3300005549 Unclassified 2259
147 Ga0070704_100092910 3300005549 Unclassified 2253
148 Ga0070704_100453351 3300005549 Bacteria 1105
149 Ga0070704_101021495 3300005549 Unclassified 748
150 Ga0070664_100000258 3300005564 Bacteria 38234
151 Ga0070664_100014954 3300005564 Bacteria 6333
152 Ga0068857_100421806 3300005577 Unclassified 1244
153 Ga0068857_100528892 3300005577 Bacteria 1109
154 Ga0068857_101500041 3300005577 Unclassified 657
155 Ga0068854_100489723 3300005578 Unclassified 1034
156 Ga0070702_100115944 3300005615 Unclassified 1669
157 Ga0068852_100108375 3300005616 Archaea 2521
158 Ga0068859_100003560 3300005617 Bacteria 15862
159 Ga0068859_100011895 3300005617 Bacteria 8744
160 Ga0068859_100030750 3300005617 Bacteria 5389
161 Ga0068859_100169815 3300005617 Bacteria 2262
162 Ga0068859_100262731 3300005617 Bacteria 1818
163 Ga0068859_100342109 3300005617 Unclassified 1590
164 Ga0068859_100754953 3300005617 Bacteria 1062
165 Ga0068859_101560322 3300005617 Unclassified 729
166 Ga0068859_102073944 3300005617 Unclassified 628
167 Ga0068864_100027146 3300005618 Bacteria 4832
168 Ga0068864_101070825 3300005618 Bacteria 801
169 Ga0068864_101846313 3300005618 Unclassified 610
170 Ga0068866_11361023 3300005718 Unclassified 518
171 Ga0068861_100035901 3300005719 Unclassified 3675
172 Ga0068861_100220725 3300005719 Bacteria 1602
173 Ga0068861_100470927 3300005719 Unclassified 1130
174 Ga0068861_100517522 3300005719 Bacteria 1081
175 Ga0068861_100541629 3300005719 Bacteria 1059
176 Ga0068861_100746579 3300005719 Bacteria 914
177 Ga0068861_100867007 3300005719 Bacteria 852
178 Ga0068861_101666240 3300005719 Unclassified 630
179 Ga0068870_10000896 3300005840 Bacteria 11640
180 Ga0068870_10014378 3300005840 Unclassified 3737
181 Ga0068870_10014433 3300005840 Bacteria 3731
182 Ga0068870_10915618 3300005840 Unclassified 620
183 Ga0068858_100222257 3300005842 Bacteria 1789
184 Ga0068858_101912281 3300005842 Unclassified 586
185 Ga0068860_100028699 3300005843 Bacteria 5356
186 Ga0068860_100550630 3300005843 Bacteria 1156
187 Ga0068862_100008881 3300005844 Bacteria 8321
188 Ga0068862_100091705 3300005844 Bacteria 2647
189 Ga0068862_100304955 3300005844 Bacteria 1466
190 Ga0068862_100328821 3300005844 Bacteria 1413
191 Ga0068862_100440559 3300005844 Bacteria 1226
192 Ga0068862_101842295 3300005844 Unclassified 614
193 Ga0068862_102429494 3300005844 Unclassified 536
194 Ga0075432_10071375 3300006058 Unclassified 1248
195 Ga0070716_101000308 3300006173 Unclassified 661
196 Ga0075427_10007679 3300006194 Bacteria 1588
197 Ga0075427_10014838 3300006194 Unclassified 1198
198 Ga0097621_100058203 3300006237 Unclassified 3162
199 Ga0068871_100103801 3300006358 Unclassified 2384
200 Ga0075428_100005177 3300006844 Bacteria 14480
201 Ga0075428_100018622 3300006844 Bacteria 7674
202 Ga0075428_100151371 3300006844 Bacteria 2520
203 Ga0075428_100214384 3300006844 Unclassified 2080
204 Ga0075428_100239124 3300006844 Unclassified 1959
205 Ga0075428_100461527 3300006844 Bacteria 1360
206 Ga0075428_100664261 3300006844 Bacteria 1111
207 Ga0075428_100751887 3300006844 Unclassified 1037
208 Ga0075428_100867687 3300006844 Bacteria 958
209 Ga0075430_100004167 3300006846 Bacteria 12201
210 Ga0075430_100005421 3300006846 Bacteria 10775
211 Ga0075430_100014105 3300006846 Bacteria 6814
212 Ga0075430_100039041 3300006846 Bacteria 4021
213 Ga0075430_100141680 3300006846 Bacteria 2002
214 Ga0075430_100232016 3300006846 Archaea 1530
215 Ga0075431_100007595 3300006847 Bacteria 10796
216 Ga0075431_100081788 3300006847 Bacteria 3335
217 Ga0075431_100090883 3300006847 Unclassified 3151
218 Ga0075431_100146877 3300006847 Bacteria 2430
219 Ga0075431_100773343 3300006847 Bacteria 935
220 Ga0075431_101183478 3300006847 Bacteria 727
221 Ga0075431_101274682 3300006847 Bacteria 696
222 Ga0075433_10011789 3300006852 Bacteria 7041
223 Ga0075433_10015826 3300006852 Bacteria 6201
224 Ga0075433_10021857 3300006852 Bacteria 5367
225 Ga0075433_10074735 3300006852 Bacteria 2982
226 Ga0075433_10229984 3300006852 Bacteria 1647
227 Ga0075434_100000639 3300006871 Bacteria 27069
228 Ga0075434_100013548 3300006871 Bacteria 7766
229 Ga0075434_100412172 3300006871 Unclassified 1372
230 Ga0075429_100014632 3300006880 Bacteria 6801
231 Ga0075429_100044832 3300006880 Bacteria 3847
232 Ga0075429_100119932 3300006880 Bacteria 2299
233 Ga0075429_100126056 3300006880 Bacteria 2239
234 Ga0075429_100202086 3300006880 Bacteria 1741
235 Ga0075429_100394676 3300006880 Unclassified 1211
236 Ga0075429_100839834 3300006880 Unclassified 804
237 Ga0068865_100044194 3300006881 Bacteria 3048
238 Ga0068865_100265174 3300006881 Bacteria 1361
239 Ga0068865_100458401 3300006881 Unclassified 1055
240 Ga0075436_100005607 3300006914 Bacteria 8613
241 Ga0097620_100003560 3300006931 Bacteria 15862
242 Ga0097620_100011895 3300006931 Bacteria 8744
243 Ga0097620_100030750 3300006931 Bacteria 5389
244 Ga0097620_100169817 3300006931 Bacteria 2262
245 Ga0097620_100262726 3300006931 Bacteria 1818
246 Ga0097620_100342143 3300006931 Unclassified 1590
247 Ga0097620_100754998 3300006931 Bacteria 1062
248 Ga0097620_101560479 3300006931 Unclassified 729
249 Ga0097620_102074397 3300006931 Unclassified 628
250 Ga0075435_100000402 3300007076 Bacteria 26492
251 Ga0075435_100107939 3300007076 Bacteria 2312
252 Ga0075435_100165574 3300007076 Unclassified 1864
253 Ga0099794_10141807 3300007265 Bacteria 1217
254 Ga0111539_10000262 3300009094 Bacteria 62799
255 Ga0111539_10004609 3300009094 Bacteria 18005
256 Ga0111539_10014413 3300009094 Bacteria 9867
257 Ga0111539_10021767 3300009094 Bacteria 7882
258 Ga0111539_10025156 3300009094 Bacteria 7298
259 Ga0111539_10038287 3300009094 Bacteria 5784
260 Ga0111539_10072766 3300009094 Bacteria 4053
261 Ga0111539_10423599 3300009094 Unclassified 1550
262 Ga0111539_11691299 3300009094 Bacteria 734
263 Ga0105245_10238873 3300009098 Bacteria 1760
264 Ga0105245_10688653 3300009098 Bacteria 1055
265 Ga0105247_10550647 3300009101 Unclassified 848
266 Ga0114129_10003761 3300009147 Bacteria 21393
267 Ga0114129_10021698 3300009147 Bacteria 9113
268 Ga0114129_10040913 3300009147 Bacteria 6532
269 Ga0114129_10081633 3300009147 Bacteria 4494
270 Ga0114129_10087849 3300009147 Bacteria 4311
271 Ga0114129_10097300 3300009147 Bacteria 4074
272 Ga0114129_10334764 3300009147 Bacteria 2009
273 Ga0114129_10471332 3300009147 Bacteria 1644
274 Ga0114129_10817451 3300009147 Bacteria 1187
275 Ga0105243_10024608 3300009148 Bacteria 4593
276 Ga0105243_10671399 3300009148 Bacteria 1007
277 Ga0105243_10817729 3300009148 Unclassified 920
278 Ga0105243_12316254 3300009148 Unclassified 575
279 Ga0105243_12322121 3300009148 Unclassified 574
280 Ga0105242_10603430 3300009176 Unclassified 1061
281 Ga0105242_13183889 3300009176 Bacteria 509
282 Ga0105248_10047626 3300009177 Bacteria 4808
283 Ga0105248_10101702 3300009177 Bacteria 3239
284 Ga0105248_10107449 3300009177 Unclassified 3146
285 Ga0105248_12032403 3300009177 Bacteria 653
286 Ga0105249_10013613 3300009553 Bacteria 7183
287 Ga0105249_11838024 3300009553 Unclassified 678
288 Ga0105249_12307955 3300009553 Unclassified 611
289 Ga0105249_13008169 3300009553 Unclassified 541
290 Ga0105246_10050142 3300011119 Unclassified 2862
291 Ga0105246_10195987 3300011119 Bacteria 1567
292 Ga0105246_10978582 3300011119 Bacteria 764
293 Ga0157315_1004891 3300012508 Unclassified 980
294 Ga0157374_10105517 3300013296 Bacteria 2706
295 Ga0157378_11057762 3300013297 Unclassified 847
296 Ga0163162_10022861 3300013306 Bacteria 6165
297 Ga0163162_10528438 3300013306 Unclassified 1309
298 Ga0163162_12522089 3300013306 Unclassified 591
299 Ga0163162_12732185 3300013306 Bacteria 568
300 Ga0157372_11801075 3300013307 Bacteria 704
301 Ga0157375_10042168 3300013308 Bacteria 4415
302 Ga0157375_10156534 3300013308 Bacteria 2418
303 Ga0157375_10545540 3300013308 Bacteria 1321
304 Ga0157375_11908828 3300013308 Unclassified 705
305 Ga0163163_10085760 3300014325 Bacteria 3157
306 Ga0163163_10110868 3300014325 Bacteria 2772
307 Ga0157380_10027375 3300014326 Bacteria 4336
308 Ga0157380_10049016 3300014326 Bacteria 3330
309 Ga0157380_10121788 3300014326 Bacteria 2211
310 Ga0157380_10507700 3300014326 Bacteria 1173
311 Ga0157380_10948563 3300014326 Bacteria 890
312 Ga0157380_10996163 3300014326 Bacteria 871
313 Ga0157380_11037553 3300014326 Bacteria 856
314 Ga0157380_12090157 3300014326 Bacteria 629
315 Ga0157377_10004549 3300014745 Bacteria 6407
316 Ga0157377_10008955 3300014745 Bacteria 4898
317 Ga0157377_10047208 3300014745 Unclassified 2412
318 Ga0157377_10480874 3300014745 Bacteria 864
319 Ga0157377_10707334 3300014745 Bacteria 732
320 Ga0157379_10004481 3300014968 Bacteria 11972
321 Ga0157376_10028142 3300014969 Bacteria 4464
322 Ga0163161_10149604 3300017792 Unclassified 1774
323 Ga0163161_10638210 3300017792 Unclassified 881
324 Ga0206356_11837473 3300020070 Bacteria 567
325 Ga0206352_10434921 3300020078 Unclassified 567
326 Ga0207697_10000284 3300025315 Bacteria 28168
327 Ga0207697_10026613 3300025315 Bacteria 2365
328 Ga0207697_10070616 3300025315 Bacteria 1463
329 Ga0207653_10218530 3300025885 Unclassified 723
330 Ga0207682_10002478 3300025893 Bacteria 8263
331 Ga0207682_10016292 3300025893 Unclassified 2899
332 Ga0207682_10016369 3300025893 Bacteria 2891
333 Ga0207710_10275989 3300025900 Unclassified 845
334 Ga0207688_10000122 3300025901 Bacteria 32004
335 Ga0207688_10115785 3300025901 Bacteria 1560
336 Ga0207680_10068719 3300025903 Bacteria 2187
337 Ga0207680_10095687 3300025903 Unclassified 1898
338 Ga0207680_10490504 3300025903 Bacteria 874
339 Ga0207680_10554853 3300025903 Unclassified 820
340 Ga0207645_10000459 3300025907 Bacteria 33709
341 Ga0207645_10013042 3300025907 Bacteria 5615
342 Ga0207645_10024146 3300025907 Bacteria 3944
343 Ga0207645_10871841 3300025907 Bacteria 612
344 Ga0207645_10875644 3300025907 Unclassified 610
345 Ga0207643_10048093 3300025908 Unclassified 2415
346 Ga0207643_10057687 3300025908 Bacteria 2211
347 Ga0207643_10093086 3300025908 Bacteria 1759
348 Ga0207643_10106781 3300025908 Bacteria 1646
349 Ga0207643_10348831 3300025908 Unclassified 929
350 Ga0207643_10871473 3300025908 Unclassified 584
351 Ga0207684_10539800 3300025910 Bacteria 998
352 Ga0207684_10642764 3300025910 Unclassified 904
353 Ga0207660_10080397 3300025917 Bacteria 2393
354 Ga0207660_10689066 3300025917 Bacteria 833
355 Ga0207662_10003024 3300025918 Bacteria 8578
356 Ga0207662_10020138 3300025918 Bacteria 3805
357 Ga0207662_10117745 3300025918 Bacteria 1663
358 Ga0207649_10037255 3300025920 Unclassified 2936
359 Ga0207646_10479122 3300025922 Bacteria 1122
360 Ga0207646_11375597 3300025922 Bacteria 614
361 Ga0207681_10003444 3300025923 Bacteria 9866
362 Ga0207681_10015938 3300025923 Bacteria 4693
363 Ga0207681_10035527 3300025923 Bacteria 3284
364 Ga0207681_10129849 3300025923 Bacteria 1861
365 Ga0207681_11731749 3300025923 Unclassified 522
366 Ga0207650_10018383 3300025925 Bacteria 4905
367 Ga0207650_10157966 3300025925 Bacteria 1794
368 Ga0207650_10593686 3300025925 Bacteria 931
369 Ga0207659_10018257 3300025926 Bacteria 4596
370 Ga0207659_10018469 3300025926 Bacteria 4572
371 Ga0207659_10060182 3300025926 Bacteria 2732
372 Ga0207659_10077588 3300025926 Bacteria 2445
373 Ga0207659_10522984 3300025926 Unclassified 1006
374 Ga0207659_11862007 3300025926 Unclassified 510
375 Ga0207687_10442848 3300025927 Bacteria 1076
376 Ga0207690_10068581 3300025932 Unclassified 2437
377 Ga0207690_11426128 3300025932 Bacteria 579
378 Ga0207706_10007043 3300025933 Bacteria 10393
379 Ga0207706_10007390 3300025933 Bacteria 10157
380 Ga0207706_10114687 3300025933 Bacteria 2370
381 Ga0207706_10976847 3300025933 Bacteria 712
382 Ga0207709_11039412 3300025935 Bacteria 671
383 Ga0207670_10291818 3300025936 Bacteria 1274
384 Ga0207670_10464986 3300025936 Bacteria 1022
385 Ga0207670_11464434 3300025936 Unclassified 580
386 Ga0207669_10011168 3300025937 Unclassified 4359
387 Ga0207669_10144150 3300025937 Unclassified 1658
388 Ga0207669_10387571 3300025937 Bacteria 1091
389 Ga0207669_10473139 3300025937 Bacteria 997
390 Ga0207669_11062257 3300025937 Unclassified 682
391 Ga0207704_10195122 3300025938 Unclassified 1476
392 Ga0207665_10915455 3300025939 Unclassified 696
393 Ga0207691_10005093 3300025940 Bacteria 12685
394 Ga0207691_10285712 3300025940 Unclassified 1419
395 Ga0207691_11179596 3300025940 Unclassified 635
396 Ga0207711_10256273 3300025941 Archaea 1607
397 Ga0207711_10282492 3300025941 Unclassified 1529
398 Ga0207711_11142867 3300025941 Bacteria 720
399 Ga0207689_10004409 3300025942 Bacteria 12786
400 Ga0207689_10061172 3300025942 Unclassified 3096
401 Ga0207689_10171013 3300025942 Unclassified 1791
402 Ga0207689_10389630 3300025942 Bacteria 1161
403 Ga0207689_10806430 3300025942 Unclassified 792
404 Ga0207679_10008973 3300025945 Bacteria 6389
405 Ga0207679_10064399 3300025945 Unclassified 2740
406 Ga0207679_10429261 3300025945 Unclassified 1168
407 Ga0207679_10710460 3300025945 Bacteria 913
408 Ga0207651_10005798 3300025960 Bacteria 6379
409 Ga0207651_10045537 3300025960 Unclassified 2943
410 Ga0207651_10141092 3300025960 Bacteria 1861
411 Ga0207651_10798622 3300025960 Unclassified 836
412 Ga0207712_10020714 3300025961 Bacteria 4309
413 Ga0207668_10357002 3300025972 Bacteria 1224
414 Ga0207640_10601005 3300025981 Unclassified 931
415 Ga0207640_10749141 3300025981 Bacteria 842
416 Ga0207658_10110405 3300025986 Bacteria 2173
417 Ga0207658_10454319 3300025986 Bacteria 1135
418 Ga0207677_10384289 3300026023 Bacteria 1186
419 Ga0207677_11027599 3300026023 Unclassified 748
420 Ga0207703_10149009 3300026035 Unclassified 2038
421 Ga0207703_10371114 3300026035 Bacteria 1322
422 Ga0207678_10125684 3300026067 Unclassified 2188
423 Ga0207708_10001605 3300026075 Bacteria 16838
424 Ga0207708_10050064 3300026075 Bacteria 3181
425 Ga0207708_10422248 3300026075 Bacteria 1106
426 Ga0207708_10583808 3300026075 Bacteria 945
427 Ga0207708_11000293 3300026075 Bacteria 726
428 Ga0207708_11055842 3300026075 Bacteria 707
429 Ga0207702_10254017 3300026078 Bacteria 1652
430 Ga0207641_10003598 3300026088 Bacteria 13681
431 Ga0207648_10016489 3300026089 Bacteria 6747
432 Ga0207648_10025157 3300026089 Bacteria 5307
433 Ga0207648_10084392 3300026089 Unclassified 2770
434 Ga0207648_10086071 3300026089 Unclassified 2742
435 Ga0207648_10405071 3300026089 Bacteria 1237
436 Ga0207648_10416083 3300026089 Bacteria 1220
437 Ga0207648_10594242 3300026089 Bacteria 1020
438 Ga0207648_11226207 3300026089 Bacteria 705
439 Ga0207676_10053228 3300026095 Bacteria 3168
440 Ga0207676_10316895 3300026095 Bacteria 1430
441 Ga0207676_10582043 3300026095 Bacteria 1073
442 Ga0207676_11481298 3300026095 Unclassified 675
443 Ga0207674_10433498 3300026116 Unclassified 1270
444 Ga0207675_100009601 3300026118 Bacteria 9052
445 Ga0207675_100172953 3300026118 Bacteria 2065
446 Ga0207675_100360484 3300026118 Bacteria 1426
447 Ga0207675_100577525 3300026118 Bacteria 1125
448 Ga0207675_101352496 3300026118 Bacteria 733
449 Ga0207683_10018625 3300026121 Bacteria 5925
450 Ga0207683_10029978 3300026121 Bacteria 4712
451 Ga0207683_10037974 3300026121 Bacteria 4195
452 Ga0207683_10379416 3300026121 Bacteria 1299
453 Ga0207683_10486082 3300026121 Bacteria 1140
454 Ga0207698_10159327 3300026142 Unclassified 1971
455 Ga0209984_1028640 3300027424 Unclassified 783
456 Ga0210002_1024572 3300027617 Unclassified 983
457 Ga0209974_10054317 3300027876 Bacteria 1350
458 Ga0209974_10171842 3300027876 Unclassified 790
459 Ga0207428_10000641 3300027907 Bacteria 41168
460 Ga0207428_10000881 3300027907 Bacteria 33707
461 Ga0207428_10002516 3300027907 Bacteria 18299
462 Ga0207428_10006631 3300027907 Bacteria 10643
463 Ga0207428_10071061 3300027907 Bacteria 2734
464 Ga0207428_10080263 3300027907 Bacteria 2549
465 Ga0207428_10134582 3300027907 Bacteria 1890
466 Ga0268265_10008384 3300028380 Bacteria 6978
467 Ga0268265_10376102 3300028380 Unclassified 1305
468 Ga0268265_10418605 3300028380 Bacteria 1243
469 Ga0268265_10436592 3300028380 Bacteria 1219
470 Ga0268265_10438528 3300028380 Bacteria 1217
471 Ga0268264_10028077 3300028381 Bacteria 4603
472 Ga0268264_11791252 3300028381 Unclassified 624
473 Ga0307408_100707640 3300031548 Unclassified 906
474 Ga0307412_11823872 3300031911 Bacteria 560
475 Ga0307411_12191461 3300032005 Unclassified 518
476 Ga0373938_0028003 3300034957 Unclassified 1189
477 Ga0373940_0030729 3300035088 Unclassified 1430
478 Ga0373932_0057304 3300035112 Unclassified 1174
479 Ga0373941_0127671 3300035115 Unclassified 913
480 Ga0373941_0518787 3300035115 Unclassified 509
481 Ga0373942_0074982 3300035207 Unclassified 995
482 Ga0373931_0121780 3300035691 Bacteria 1492
483 Ga0373931_0734937 3300035691 Unclassified 654
484 Ga0395900_0311322 3300037418 Unclassified 1558
485 Ga0242420_047048 3300038996 Bacteria 836
486 Ga0439441_101584 3300042001 Unclassified 645
487 Ga0439443_118393 3300042003 Unclassified 518
488 Ga0450917_010870 3300042120 Bacteria 727
489 Ga0450923_045060 3300042125 Bacteria 935
490 Ga0450890_035698 3300042127 Unclassified 722
491 Ga0439435_0017635 3300042436 Bacteria 1808
492 Ga0439444_0023427 3300042437 Bacteria 1108
493 Ga0439464_0079331 3300042439 Unclassified 979
494 Ga0439440_0022568 3300042993 Bacteria 1427
495 Ga0466960_0721528 3300044901 Bacteria 599
496 Ga0451576_0085723 3300045051 Unclassified 3276
497 Ga0495663_0151633 3300046525 Bacteria 791
498 Ga0495586_0064038 3300046535 Unclassified 2003
499 Ga0495598_0007858 3300046537 Bacteria 2464
500 Ga0495598_0270456 3300046537 Bacteria 635
501 Ga0495621_0221963 3300046539 Bacteria 765
502 Ga0495656_0014429 3300046615 Bacteria 2962
503 Ga0495656_0065067 3300046615 Bacteria 1602
504 Ga0495656_0139732 3300046615 Unclassified 1160
505 Ga0495656_0443396 3300046615 Unclassified 683
506 Ga0495659_0190396 3300046664 Bacteria 838
507 Ga0495659_0192435 3300046664 Bacteria 834
508 Ga0495670_0107783 3300046691 Bacteria 1440
509 Ga0495670_0468601 3300046691 Bacteria 683
510 Ga0496102_0749163 3300048905 Unclassified 900
511 Ga0496106_0188731 3300048909 Unclassified 1638
512 Ga0496109_0981233 3300048912 Unclassified 783
513 Ga0496110_0129207 3300048913 Unclassified 2281
514 Ga0496112_1519286 3300048915 Unclassified 583
515 Ga0496113_0040876 3300048916 Bacteria 3419
516 Ga0496113_0452264 3300048916 Unclassified 1032
517 Ga0501307_065607 3300049162 Bacteria 571
518 Ga0501036_0244573 3300049572 Bacteria 1504
519 Ga0501041_0991140 3300049577 Bacteria 541
520 Ga0501042_0335768 3300049578 Bacteria 1092
521 Ga0501042_1086761 3300049578 Bacteria 583
522 Ga0501046_0373056 3300049580 Bacteria 1034
523 Ga0501046_0769189 3300049580 Bacteria 676
524 Ga0501048_0071846 3300049582 Bacteria 2443
525 Ga0501071_0130212 3300049587 Bacteria 1868
526 Ga0501071_0246133 3300049587 Bacteria 1349
527 Ga0501072_0073982 3300049588 Unclassified 2694
528 Ga0501075_0174805 3300049591 Unclassified 1639
529 Ga0501076_0110336 3300049592 Bacteria 2224
530 Ga0501076_0374821 3300049592 Bacteria 1170
531 Ga0501079_0250640 3300049741 Bacteria 1384
532 Ga0501080_0786383 3300049742 Bacteria 835
533 Ga0501080_1252808 3300049742 Bacteria 636
534 Ga0501081_0055924 3300049743 Unclassified 2726
535 Ga0501081_1197100 3300049743 Bacteria 575
536 Ga0501265_055557 3300049762 Bacteria 634
537 Ga0501283_001217 3300049779 Unclassified 3398
538 nmdc:mga05p37_118807_c1 3300050507 Unclassified 3248
539 nmdc:mga05p37_12246_c1 3300050507 Bacteria 10241
540 nmdc:mga05p37_138585_c1 3300050507 Unclassified 2982
541 nmdc:mga05p37_175911_c1 3300050507 Bacteria 2607
542 nmdc:mga05p37_30248_c1 3300050507 Bacteria 6607
543 nmdc:mga05p37_59821_c1 3300050507 Bacteria 4691
544 nmdc:mga05p37_79412_c1 3300050507 Bacteria 4040
545 nmdc:mga05p37_912092_c1 3300050507 Bacteria 946
546 nmdc:mga09592_111107_c1 3300050508 Bacteria 2351
547 nmdc:mga09592_125600_c1 3300050508 Bacteria 2205
548 nmdc:mga09592_257485_c1 3300050508 Unclassified 1513
549 nmdc:mga09592_269219_c1 3300050508 Unclassified 1478
550 nmdc:mga09592_289067_c1 3300050508 Bacteria 1421
551 nmdc:mga09592_545_c1 3300050508 Bacteria 28597
552 nmdc:mga09592_789570_c1 3300050508 Unclassified 804
553 nmdc:mga0qj67_1079715_c1 3300050509 Unclassified 628
554 nmdc:mga0qj67_389141_c1 3300050509 Unclassified 1126
555 nmdc:mga0qj67_4265_c1 3300050509 Bacteria 10360
556 nmdc:mga0qj67_4892_c1 3300050509 Bacteria 9741
557 nmdc:mga0qj67_663235_c1 3300050509 Unclassified 832
558 nmdc:mga0qj67_75507_c1 3300050509 Bacteria 2694
559 nmdc:mga06r32_133838_c1 3300050510 Bacteria 2453
560 nmdc:mga06r32_19348_c1 3300050510 Bacteria 6247
561 nmdc:mga06r32_303442_c1 3300050510 Unclassified 1583
562 nmdc:mga06r32_43414_c1 3300050510 Bacteria 4278
563 nmdc:mga06r32_894629_c1 3300050510 Bacteria 844
564 nmdc:mga08y16_114139_c1 3300050511 Bacteria 2812
565 nmdc:mga08y16_12159_c1 3300050511 Bacteria 9048
566 nmdc:mga08y16_1375840_c1 3300050511 Bacteria 670
567 nmdc:mga08y16_1391_c1 3300050511 Bacteria 24210
568 nmdc:mga08y16_31170_c1 3300050511 Bacteria 5610
569 nmdc:mga08y16_451703_c1 3300050511 Bacteria 1310
570 nmdc:mga08y16_57575_c1 3300050511 Bacteria 4061
571 nmdc:mga08y16_8475_c1 3300050511 Bacteria 10768
572 nmdc:mga08y16_9938_c1 3300050511 Bacteria 9987
573 nmdc:mga0n895_388596_c1 3300050512 Bacteria 1412
574 nmdc:mga0n895_422865_c1 3300050512 Unclassified 1347
575 nmdc:mga0n895_471_c1 3300050512 Bacteria 27076
576 nmdc:mga0rr50_210601_c1 3300050513 Unclassified 1601
577 nmdc:mga0rr50_256_c1 3300050513 Bacteria 28829
578 nmdc:mga08x19_4582_c1 3300050514 Bacteria 8204
579 nmdc:mga08x19_5340_c1 3300050514 Bacteria 7594
580 nmdc:mga08x19_7242_c1 3300050514 Bacteria 6590
581 nmdc:mga0a205_26244_c1 3300050515 Bacteria 5552
582 nmdc:mga0a205_378919_c1 3300050515 Bacteria 1280
583 nmdc:mga0a205_477_c1 3300050515 Bacteria 31297
584 nmdc:mga0a205_9021_c1 3300050515 Bacteria 9090
585 Ga0501084_0155342 3300054114 Unclassified 1929
586 Ga0501084_1101761 3300054114 Bacteria 667
587 Ga0587066_166796 3300059490 Unclassified 557
588 Ga0587066_189523 3300059490 Unclassified 534
589 Ga0587083_0223258 3300059505 Unclassified 549
590 Ga0587091_179074 3300059511 Unclassified 557
591 Ga0587092_082363 3300059512 Unclassified 637
592 Ga0587094_110131 3300059513 Unclassified 541
593 Ga0587068_107085 3300059641 Unclassified 593
594 Ga0587076_182581 3300059645 Unclassified 529
595 Ga0587107_093081 3300059652 Unclassified 585
596 Ga0587071_177382 3300060344 Unclassified 545
597 Ga0587111_0174788 3300060346 Unclassified 593
598 nmdc:mga05p37_283678_c1
599 SwRhRL2b_contig_1259039
600 JGI24746J21847_1008266
601 Ga0006761J43178_105119
602 Ga0006762J43184_103745
603 Ga0006765J45826_112004
604 Ga0007421J48921_103838
605 Ga0006758J48902_1014190
606 Ga0007417J51691_1009704
607 Ga0007417J51691_1049215
608 Ga0006781J51513_1009835
609 Ga0007410J51695_1004260
610 Ga0007410J51695_1017249
611 Ga0007409J51694_1003563
612 Ga0032354_1007556
613 Ga0058863_11722133
614 Ga0058861_11806767
615 Ga0058862_12663553
616 Ga0065704_10136055
617 Ga0065704_10158328
618 Ga0065704_10312796
619 Ga0065712_10016177
620 Ga0065712_10234246
621 Ga0065715_10000814
622 Ga0065715_10121116
623 Ga0065715_10614246
624 Ga0065707_10087934
625 Ga0065707_10165965
626 Ga0065707_10229683
627 Ga0065707_10246770
628 Ga0070676_10005751
629 Ga0070676_10068870
630 Ga0070676_10858121
631 Ga0070683_100798988
632 Ga0070690_100003025
633 Ga0070690_100189342
634 Ga0070690_100995582
635 Ga0070690_101274184
636 Ga0070670_100003205
637 Ga0070670_100030357
638 Ga0070670_100065722
639 Ga0070677_10000760
640 Ga0070677_10000858
641 Ga0070677_10013520
642 Ga0068869_100003046
643 Ga0068869_100031295
644 Ga0068869_100051484
645 Ga0068869_100189868
646 Ga0068869_100352759
647 Ga0068869_100408379
648 Ga0068869_100747880
649 Ga0070666_10015554
650 Ga0070666_10431014
651 Ga0070680_100777755
652 Ga0070680_101660205
653 Ga0068868_100189480
654 Ga0068868_100238991
655 Ga0070660_100209722
656 Ga0070689_100007876
657 Ga0070689_100109188
658 Ga0070687_100031877
659 Ga0070687_100424227
660 Ga0070661_100006827
661 Ga0070668_100009031
662 Ga0070669_100004620
663 Ga0070669_100027779
664 Ga0070669_100038778
665 Ga0070669_100226672
666 Ga0070675_100003504
667 Ga0070675_100014936
668 Ga0070675_100399084
669 Ga0070675_100604547
670 Ga0070671_100109758
671 Ga0070671_100930778
672 Ga0070671_101762690
673 Ga0070674_100001750
674 Ga0070674_100043438
675 Ga0070674_101715668
676 Ga0070673_100007287
677 Ga0070673_100017761
678 Ga0070673_100044399
679 Ga0070673_100110120
680 Ga0070673_100853807
681 Ga0070688_100057260
682 Ga0070688_100148366
683 Ga0070688_100159834
684 Ga0070688_100466551
685 Ga0070688_100783345
686 Ga0070659_100022315
687 Ga0070667_100003935
688 Ga0070667_100100284
689 Ga0070667_100976018
690 Ga0070703_10038880
691 Ga0070711_100733790
692 Ga0070705_100696918
693 Ga0070700_100001040
694 Ga0070700_100490995
695 Ga0070700_100532218
696 Ga0070700_100537242
697 Ga0070700_100589819
698 Ga0070700_101330082
699 Ga0070694_100009935
700 Ga0070694_100155415
701 Ga0070708_100143881
702 Ga0070708_100228455
703 Ga0070663_100117909
704 Ga0070678_100012188
705 Ga0070678_100042740
706 Ga0070678_100144249
707 Ga0070678_100562585
708 Ga0070678_100708331
709 Ga0070662_100003906
710 Ga0070662_100022689
711 Ga0068867_100007175
712 Ga0068867_100284233
713 Ga0068867_100700697
714 Ga0068867_101468317
715 Ga0070685_10018478
716 Ga0070706_100237995
717 Ga0070706_100637944
718 Ga0070706_100824692
719 Ga0070707_100034740
720 Ga0070707_100071570
721 Ga0070707_100780893
722 Ga0070698_100291233
723 Ga0070699_100050272
724 Ga0070699_100057919
725 Ga0070699_100282938
726 Ga0070697_100123727
727 Ga0070697_100131816
728 Ga0070672_100054553
729 Ga0070672_100342998
730 Ga0070672_100375247
731 Ga0070686_100001581
732 Ga0070686_101334069
733 Ga0070695_100001596
734 Ga0070695_100516233
735 Ga0070695_100664474
736 Ga0070696_100008261
737 Ga0070696_100098821
738 Ga0070696_100484164
739 Ga0070696_100862513
740 Ga0070696_100971052
741 Ga0070693_100304507
742 Ga0070665_100006532
743 Ga0070704_100092376
744 Ga0070704_100092910
745 Ga0070704_100453351
746 Ga0070704_101021495
747 Ga0070664_100000258
748 Ga0070664_100014954
749 Ga0068857_100421806
750 Ga0068857_100528892
751 Ga0068857_101500041
752 Ga0068854_100489723
753 Ga0070702_100115944
754 Ga0068852_100108375
755 Ga0068859_100003560
756 Ga0068859_100011895
757 Ga0068859_100030750
758 Ga0068859_100169815
759 Ga0068859_100262731
760 Ga0068859_100342109
761 Ga0068859_100754953
762 Ga0068859_101560322
763 Ga0068859_102073944
764 Ga0068864_100027146
765 Ga0068864_101070825
766 Ga0068864_101846313
767 Ga0068866_11361023
768 Ga0068861_100035901
769 Ga0068861_100220725
770 Ga0068861_100470927
771 Ga0068861_100517522
772 Ga0068861_100541629
773 Ga0068861_100746579
774 Ga0068861_100867007
775 Ga0068861_101666240
776 Ga0068870_10000896
777 Ga0068870_10014378
778 Ga0068870_10014433
779 Ga0068870_10915618
780 Ga0068858_100222257
781 Ga0068858_101912281
782 Ga0068860_100028699
783 Ga0068860_100550630
784 Ga0068862_100008881
785 Ga0068862_100091705
786 Ga0068862_100304955
787 Ga0068862_100328821
788 Ga0068862_100440559
789 Ga0068862_101842295
790 Ga0068862_102429494
791 Ga0075432_10071375
792 Ga0070716_101000308
793 Ga0075427_10007679
794 Ga0075427_10014838
795 Ga0097621_100058203
796 Ga0068871_100103801
797 Ga0075428_100005177
798 Ga0075428_100018622
799 Ga0075428_100151371
800 Ga0075428_100214384
801 Ga0075428_100239124
802 Ga0075428_100461527
803 Ga0075428_100664261
804 Ga0075428_100751887
805 Ga0075428_100867687
806 Ga0075430_100004167
807 Ga0075430_100005421
808 Ga0075430_100014105
809 Ga0075430_100039041
810 Ga0075430_100141680
811 Ga0075430_100232016
812 Ga0075431_100007595
813 Ga0075431_100081788
814 Ga0075431_100090883
815 Ga0075431_100146877
816 Ga0075431_100773343
817 Ga0075431_101183478
818 Ga0075431_101274682
819 Ga0075433_10011789
820 Ga0075433_10015826
821 Ga0075433_10021857
822 Ga0075433_10074735
823 Ga0075433_10229984
824 Ga0075434_100000639
825 Ga0075434_100013548
826 Ga0075434_100412172
827 Ga0075429_100014632
828 Ga0075429_100044832
829 Ga0075429_100119932
830 Ga0075429_100126056
831 Ga0075429_100202086
832 Ga0075429_100394676
833 Ga0075429_100839834
834 Ga0068865_100044194
835 Ga0068865_100265174
836 Ga0068865_100458401
837 Ga0075436_100005607
838 Ga0097620_100003560
839 Ga0097620_100011895
840 Ga0097620_100030750
841 Ga0097620_100169817
842 Ga0097620_100262726
843 Ga0097620_100342143
844 Ga0097620_100754998
845 Ga0097620_101560479
846 Ga0097620_102074397
847 Ga0075435_100000402
848 Ga0075435_100107939
849 Ga0075435_100165574
850 Ga0099794_10141807
851 Ga0111539_10000262
852 Ga0111539_10004609
853 Ga0111539_10014413
854 Ga0111539_10021767
855 Ga0111539_10025156
856 Ga0111539_10038287
857 Ga0111539_10072766
858 Ga0111539_10423599
859 Ga0111539_11691299
860 Ga0105245_10238873
861 Ga0105245_10688653
862 Ga0105247_10550647
863 Ga0114129_10003761
864 Ga0114129_10021698
865 Ga0114129_10040913
866 Ga0114129_10081633
867 Ga0114129_10087849
868 Ga0114129_10097300
869 Ga0114129_10334764
870 Ga0114129_10471332
871 Ga0114129_10817451
872 Ga0105243_10024608
873 Ga0105243_10671399
874 Ga0105243_10817729
875 Ga0105243_12316254
876 Ga0105243_12322121
877 Ga0105242_10603430
878 Ga0105242_13183889
879 Ga0105248_10047626
880 Ga0105248_10101702
881 Ga0105248_10107449
882 Ga0105248_12032403
883 Ga0105249_10013613
884 Ga0105249_11838024
885 Ga0105249_12307955
886 Ga0105249_13008169
887 Ga0105246_10050142
888 Ga0105246_10195987
889 Ga0105246_10978582
890 Ga0157315_1004891
891 Ga0157374_10105517
892 Ga0157378_11057762
893 Ga0163162_10022861
894 Ga0163162_10528438
895 Ga0163162_12522089
896 Ga0163162_12732185
897 Ga0157372_11801075
898 Ga0157375_10042168
899 Ga0157375_10156534
900 Ga0157375_10545540
901 Ga0157375_11908828
902 Ga0163163_10085760
903 Ga0163163_10110868
904 Ga0157380_10027375
905 Ga0157380_10049016
906 Ga0157380_10121788
907 Ga0157380_10507700
908 Ga0157380_10948563
909 Ga0157380_10996163
910 Ga0157380_11037553
911 Ga0157380_12090157
912 Ga0157377_10004549
913 Ga0157377_10008955
914 Ga0157377_10047208
915 Ga0157377_10480874
916 Ga0157377_10707334
917 Ga0157379_10004481
918 Ga0157376_10028142
919 Ga0163161_10149604
920 Ga0163161_10638210
921 Ga0206356_11837473
922 Ga0206352_10434921
923 Ga0207697_10000284
924 Ga0207697_10026613
925 Ga0207697_10070616
926 Ga0207653_10218530
927 Ga0207682_10002478
928 Ga0207682_10016292
929 Ga0207682_10016369
930 Ga0207710_10275989
931 Ga0207688_10000122
932 Ga0207688_10115785
933 Ga0207680_10068719
934 Ga0207680_10095687
935 Ga0207680_10490504
936 Ga0207680_10554853
937 Ga0207645_10000459
938 Ga0207645_10013042
939 Ga0207645_10024146
940 Ga0207645_10871841
941 Ga0207645_10875644
942 Ga0207643_10048093
943 Ga0207643_10057687
944 Ga0207643_10093086
945 Ga0207643_10106781
946 Ga0207643_10348831
947 Ga0207643_10871473
948 Ga0207684_10539800
949 Ga0207684_10642764
950 Ga0207660_10080397
951 Ga0207660_10689066
952 Ga0207662_10003024
953 Ga0207662_10020138
954 Ga0207662_10117745
955 Ga0207649_10037255
956 Ga0207646_10479122
957 Ga0207646_11375597
958 Ga0207681_10003444
959 Ga0207681_10015938
960 Ga0207681_10035527
961 Ga0207681_10129849
962 Ga0207681_11731749
963 Ga0207650_10018383
964 Ga0207650_10157966
965 Ga0207650_10593686
966 Ga0207659_10018257
967 Ga0207659_10018469
968 Ga0207659_10060182
969 Ga0207659_10077588
970 Ga0207659_10522984
971 Ga0207659_11862007
972 Ga0207687_10442848
973 Ga0207690_10068581
974 Ga0207690_11426128
975 Ga0207706_10007043
976 Ga0207706_10007390
977 Ga0207706_10114687
978 Ga0207706_10976847
979 Ga0207709_11039412
980 Ga0207670_10291818
981 Ga0207670_10464986
982 Ga0207670_11464434
983 Ga0207669_10011168
984 Ga0207669_10144150
985 Ga0207669_10387571
986 Ga0207669_10473139
987 Ga0207669_11062257
988 Ga0207704_10195122
989 Ga0207665_10915455
990 Ga0207691_10005093
991 Ga0207691_10285712
992 Ga0207691_11179596
993 Ga0207711_10256273
994 Ga0207711_10282492
995 Ga0207711_11142867
996 Ga0207689_10004409
997 Ga0207689_10061172
998 Ga0207689_10171013
999 Ga0207689_10389630
1000 Ga0207689_10806430
1001 Ga0207679_10008973
1002 Ga0207679_10064399
1003 Ga0207679_10429261
1004 Ga0207679_10710460
1005 Ga0207651_10005798
1006 Ga0207651_10045537
1007 Ga0207651_10141092
1008 Ga0207651_10798622
1009 Ga0207712_10020714
1010 Ga0207668_10357002
1011 Ga0207640_10601005
1012 Ga0207640_10749141
1013 Ga0207658_10110405
1014 Ga0207658_10454319
1015 Ga0207677_10384289
1016 Ga0207677_11027599
1017 Ga0207703_10149009
1018 Ga0207703_10371114
1019 Ga0207678_10125684
1020 Ga0207708_10001605
1021 Ga0207708_10050064
1022 Ga0207708_10422248
1023 Ga0207708_10583808
1024 Ga0207708_11000293
1025 Ga0207708_11055842
1026 Ga0207702_10254017
1027 Ga0207641_10003598
1028 Ga0207648_10016489
1029 Ga0207648_10025157
1030 Ga0207648_10084392
1031 Ga0207648_10086071
1032 Ga0207648_10405071
1033 Ga0207648_10416083
1034 Ga0207648_10594242
1035 Ga0207648_11226207
1036 Ga0207676_10053228
1037 Ga0207676_10316895
1038 Ga0207676_10582043
1039 Ga0207676_11481298
1040 Ga0207674_10433498
1041 Ga0207675_100009601
1042 Ga0207675_100172953
1043 Ga0207675_100360484
1044 Ga0207675_100577525
1045 Ga0207675_101352496
1046 Ga0207683_10018625
1047 Ga0207683_10029978
1048 Ga0207683_10037974
1049 Ga0207683_10379416
1050 Ga0207683_10486082
1051 Ga0207698_10159327
1052 Ga0209984_1028640
1053 Ga0210002_1024572
1054 Ga0209974_10054317
1055 Ga0209974_10171842
1056 Ga0207428_10000641
1057 Ga0207428_10000881
1058 Ga0207428_10002516
1059 Ga0207428_10006631
1060 Ga0207428_10071061
1061 Ga0207428_10080263
1062 Ga0207428_10134582
1063 Ga0268265_10008384
1064 Ga0268265_10376102
1065 Ga0268265_10418605
1066 Ga0268265_10436592
1067 Ga0268265_10438528
1068 Ga0268264_10028077
1069 Ga0268264_11791252
1070 Ga0307408_100707640
1071 Ga0307412_11823872
1072 Ga0307411_12191461
1073 Ga0373938_0028003
1074 Ga0373940_0030729
1075 Ga0373932_0057304
1076 Ga0373941_0127671
1077 Ga0373941_0518787
1078 Ga0373942_0074982
1079 Ga0373931_0121780
1080 Ga0373931_0734937
1081 Ga0395900_0311322
1082 Ga0242420_047048
1083 Ga0439441_101584
1084 Ga0439443_118393
1085 Ga0450917_010870
1086 Ga0450923_045060
1087 Ga0450890_035698
1088 Ga0439435_0017635
1089 Ga0439444_0023427
1090 Ga0439464_0079331
1091 Ga0439440_0022568
1092 Ga0466960_0721528
1093 Ga0451576_0085723
1094 Ga0495663_0151633
1095 Ga0495586_0064038
1096 Ga0495598_0007858
1097 Ga0495598_0270456
1098 Ga0495621_0221963
1099 Ga0495656_0014429
1100 Ga0495656_0065067
1101 Ga0495656_0139732
1102 Ga0495656_0443396
1103 Ga0495659_0190396
1104 Ga0495659_0192435
1105 Ga0495670_0107783
1106 Ga0495670_0468601
1107 Ga0496102_0749163
1108 Ga0496106_0188731
1109 Ga0496109_0981233
1110 Ga0496110_0129207
1111 Ga0496112_1519286
1112 Ga0496113_0040876
1113 Ga0496113_0452264
1114 Ga0501307_065607
1115 Ga0501036_0244573
1116 Ga0501041_0991140
1117 Ga0501042_0335768
1118 Ga0501042_1086761
1119 Ga0501046_0373056
1120 Ga0501046_0769189
1121 Ga0501048_0071846
1122 Ga0501071_0130212
1123 Ga0501071_0246133
1124 Ga0501072_0073982
1125 Ga0501075_0174805
1126 Ga0501076_0110336
1127 Ga0501076_0374821
1128 Ga0501079_0250640
1129 Ga0501080_0786383
1130 Ga0501080_1252808
1131 Ga0501081_0055924
1132 Ga0501081_1197100
1133 Ga0501265_055557
1134 Ga0501283_001217
1135 nmdc:mga05p37_118807_c1
1136 nmdc:mga05p37_12246_c1
1137 nmdc:mga05p37_138585_c1
1138 nmdc:mga05p37_175911_c1
1139 nmdc:mga05p37_30248_c1
1140 nmdc:mga05p37_59821_c1
1141 nmdc:mga05p37_79412_c1
1142 nmdc:mga05p37_912092_c1
1143 nmdc:mga09592_111107_c1
1144 nmdc:mga09592_125600_c1
1145 nmdc:mga09592_257485_c1
1146 nmdc:mga09592_269219_c1
1147 nmdc:mga09592_289067_c1
1148 nmdc:mga09592_545_c1
1149 nmdc:mga09592_789570_c1
1150 nmdc:mga0qj67_1079715_c1
1151 nmdc:mga0qj67_389141_c1
1152 nmdc:mga0qj67_4265_c1
1153 nmdc:mga0qj67_4892_c1
1154 nmdc:mga0qj67_663235_c1
1155 nmdc:mga0qj67_75507_c1
1156 nmdc:mga06r32_133838_c1
1157 nmdc:mga06r32_19348_c1
1158 nmdc:mga06r32_303442_c1
1159 nmdc:mga06r32_43414_c1
1160 nmdc:mga06r32_894629_c1
1161 nmdc:mga08y16_114139_c1
1162 nmdc:mga08y16_12159_c1
1163 nmdc:mga08y16_1375840_c1
1164 nmdc:mga08y16_1391_c1
1165 nmdc:mga08y16_31170_c1
1166 nmdc:mga08y16_451703_c1
1167 nmdc:mga08y16_57575_c1
1168 nmdc:mga08y16_8475_c1
1169 nmdc:mga08y16_9938_c1
1170 nmdc:mga0n895_388596_c1
1171 nmdc:mga0n895_422865_c1
1172 nmdc:mga0n895_471_c1
1173 nmdc:mga0rr50_210601_c1
1174 nmdc:mga0rr50_256_c1
1175 nmdc:mga08x19_4582_c1
1176 nmdc:mga08x19_5340_c1
1177 nmdc:mga08x19_7242_c1
1178 nmdc:mga0a205_26244_c1
1179 nmdc:mga0a205_378919_c1
1180 nmdc:mga0a205_477_c1
1181 nmdc:mga0a205_9021_c1
1182 Ga0501084_0155342
1183 Ga0501084_1101761
1184 Ga0587066_166796
1185 Ga0587066_189523
1186 Ga0587083_0223258
1187 Ga0587091_179074
1188 Ga0587092_082363
1189 Ga0587094_110131
1190 Ga0587068_107085
1191 Ga0587076_182581
1192 Ga0587107_093081
1193 Ga0587071_177382
1194 Ga0587111_0174788

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

33

134

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7og2-assembly1.cif.gz_B crystal structure of pseudoalteromonas luteoviolacea l-amino acid oxidase 0.8014 38 70
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7977 37 70
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7949 37 70
8foc-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i 0.7799 36 70
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.775 36 70
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.9385 40 70 2.30.29.30
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.877 40 68 2.30.29.30
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8233 35 94 2.40.50.140
2jjdF02 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8068 41 70 3.90.190.10
af_I1LI90_433_534_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.7814 47 70 3.30.300.30
ID Description Score Start End GO Terms
AF-A0A2V9CMA3-F1-model_v4 Uncharacterized protein 0.9674 39 122
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9601 29 121
AF-A0A521RFX0-F1-model_v4 Uncharacterized protein 0.9577 29 121
AF-A0A2V9CP64-F1-model_v4 LTD domain-containing protein 0.9547 31 121
AF-A0A2V8I9N4-F1-model_v4 DUF5666 domain-containing protein 0.9528 37 122

Map