F467702

General Info

Members Datasets Scaffolds Average Seq Length
597 357 1194 248

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0090636|Ga0495686_0090636_127_1023
Length 298
Sequence MQVMSDVTRFTSVRLWPNDDCAARANGARGRLAVSELSSPAWSTDKEDDMKQATLATIALRRREFLAGTAMLLFSATTVKAATIAGRLPWVPNAGSPPPPIKVGPWEFFNGDEGRAIEALVDCIIPPDPETPGGKDAGCAVFIDRQLAGPYGRQEGLYVRPPFQAGAKNQGHQSASGPAQDYREGLAALDRACKQRSGGKPFAELSDDDRIAVLKAVEKGELKLDGVDGKSFFTQLVKDVQMGFFADPIYGGNRDMVAWKMIGYPGARYNYLDWVNRHNERFPLPPVGMTGNAQWTRS

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
147 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
151 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
159 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
165 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
176 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
222 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
223 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
238 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
260 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
270 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
271 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
290 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
294 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
295 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
296 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
297 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
298 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
304 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
305 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
306 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
310 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
311 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
312 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
313 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
314 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
315 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
316 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
321 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
322 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
325 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
326 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
327 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
329 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
330 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
331 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
332 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
333 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
334 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
335 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
336 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
337 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
338 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
339 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
340 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
341 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
342 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
343 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
344 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
345 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
346 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
347 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
348 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
349 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
350 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
351 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
352 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
353 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
354 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
355 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
356 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
357 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.47
Metatranscriptomes 0.17
Isolates 5.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.03
Nodule 5.19
Rhizoplane 6.37
Rhizosphere 78.73
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0090636 3300047472 Bacteria 1856
2 JGI24750J21931_1001116 3300002070 Bacteria 3463
3 JGI24745J21846_1002382 3300002073 Bacteria 1919
4 JGI24742J22300_10002490 3300002244 Bacteria 2947
5 JGI25404J52841_10000037 3300003659 Bacteria 11010
6 JGI25404J52841_10013541 3300003659 Bacteria 1769
7 Ga0065165_1000871 3300005262 Bacteria 39257
8 Ga0070658_10492765 3300005327 Bacteria 1058
9 Ga0070676_10061996 3300005328 Bacteria 2223
10 Ga0070690_100019635 3300005330 Bacteria 4106
11 Ga0070670_100116127 3300005331 Bacteria 2308
12 Ga0070677_10026501 3300005333 Bacteria 2174
13 Ga0070666_10053355 3300005335 Bacteria 2727
14 Ga0070680_100007057 3300005336 Bacteria 8564
15 Ga0070680_100190575 3300005336 Bacteria 1727
16 Ga0070680_100268980 3300005336 Bacteria 1443
17 Ga0070680_100280949 3300005336 Bacteria 1410
18 Ga0070682_100059440 3300005337 Bacteria 2415
19 Ga0070682_100404761 3300005337 Bacteria 1033
20 Ga0068868_100038969 3300005338 Bacteria 3690
21 Ga0068868_100041854 3300005338 Bacteria 3571
22 Ga0070689_100320318 3300005340 Bacteria 1295
23 Ga0070687_100014116 3300005343 Bacteria 3580
24 Ga0070668_100021220 3300005347 Bacteria 4909
25 Ga0070671_100016972 3300005355 Bacteria 5887
26 Ga0070671_100412529 3300005355 Bacteria 1156
27 Ga0070671_100469844 3300005355 Bacteria 1080
28 Ga0070674_100068429 3300005356 Bacteria 2501
29 Ga0070673_100039769 3300005364 Bacteria 3602
30 Ga0070688_100091152 3300005365 Bacteria 1992
31 Ga0070659_100280948 3300005366 Bacteria 1385
32 Ga0070709_10002397 3300005434 Bacteria 10156
33 Ga0070714_100634076 3300005435 Bacteria 1028
34 Ga0070713_100353275 3300005436 Bacteria 1364
35 Ga0070701_10040725 3300005438 Bacteria 2363
36 Ga0070711_100005259 3300005439 Bacteria 7725
37 Ga0070700_100033252 3300005441 Bacteria 3104
38 Ga0070663_100025531 3300005455 Bacteria 3990
39 Ga0070678_100091331 3300005456 Bacteria 2336
40 Ga0070678_100255470 3300005456 Bacteria 1471
41 Ga0070678_100530500 3300005456 Bacteria 1043
42 Ga0070662_100195141 3300005457 Bacteria 1603
43 Ga0070681_10026710 3300005458 Bacteria 5804
44 Ga0070681_10363907 3300005458 Bacteria 1357
45 Ga0070681_10554346 3300005458 Bacteria 1063
46 Ga0070685_10026465 3300005466 Bacteria 3197
47 Ga0070706_100114352 3300005467 Bacteria 2513
48 Ga0070679_100013883 3300005530 Bacteria 7717
49 Ga0070679_100014231 3300005530 Bacteria 7637
50 Ga0070679_100061797 3300005530 Bacteria 3734
51 Ga0070679_100150212 3300005530 Bacteria 2306
52 Ga0070679_100167155 3300005530 Bacteria 2172
53 Ga0070679_100296424 3300005530 Bacteria 1568
54 Ga0070684_100032554 3300005535 Bacteria 4444
55 Ga0068853_100093701 3300005539 Bacteria 2644
56 Ga0070672_100020347 3300005543 Bacteria 4838
57 Ga0070686_100015124 3300005544 Bacteria 4462
58 Ga0070665_100030140 3300005548 Bacteria 5459
59 Ga0070665_100498653 3300005548 Bacteria 1229
60 Ga0068855_100084259 3300005563 Bacteria 3681
61 Ga0068855_100246269 3300005563 Bacteria 1995
62 Ga0068855_100373464 3300005563 Bacteria 1567
63 Ga0068855_100809781 3300005563 Bacteria 995
64 Ga0070664_100142314 3300005564 Bacteria 2112
65 Ga0070664_100497040 3300005564 Bacteria 1124
66 Ga0068854_100151427 3300005578 Bacteria 1789
67 Ga0068856_100028189 3300005614 Bacteria 5482
68 Ga0068856_100202283 3300005614 Bacteria 2001
69 Ga0068852_100018955 3300005616 Bacteria 5435
70 Ga0068852_100491276 3300005616 Bacteria 1221
71 Ga0068859_100117174 3300005617 Bacteria 2728
72 Ga0068864_100012057 3300005618 Bacteria 7139
73 Ga0068864_100104631 3300005618 Bacteria 2515
74 Ga0068851_10169433 3300005834 Bacteria 1204
75 Ga0068870_10011153 3300005840 Bacteria 4156
76 Ga0068863_100080102 3300005841 Bacteria 3093
77 Ga0068858_100123115 3300005842 Bacteria 2427
78 Ga0068860_100085631 3300005843 Bacteria 2999
79 Ga0068860_100153786 3300005843 Bacteria 2216
80 Ga0081455_10090226 3300005937 Bacteria 2485
81 Ga0081540_1000728 3300005983 Bacteria 30330
82 Ga0081540_1007266 3300005983 Bacteria 7932
83 Ga0081540_1009654 3300005983 Bacteria 6632
84 Ga0081540_1015505 3300005983 Bacteria 4822
85 Ga0081540_1044772 3300005983 Bacteria 2256
86 Ga0070717_10335550 3300006028 Bacteria 1349
87 Ga0075365_10125639 3300006038 Bacteria 1772
88 Ga0075368_10045724 3300006042 Bacteria 1730
89 Ga0075368_10066450 3300006042 Bacteria 1450
90 Ga0070716_100121115 3300006173 Bacteria 1638
91 Ga0070716_100383630 3300006173 Bacteria 1005
92 Ga0070712_100021895 3300006175 Bacteria 4203
93 Ga0075367_10019338 3300006178 Bacteria 3776
94 Ga0097621_100245454 3300006237 Bacteria 1566
95 Ga0068871_100038203 3300006358 Bacteria 3832
96 Ga0068865_100456987 3300006881 Bacteria 1057
97 Ga0097620_100117180 3300006931 Bacteria 2728
98 Ga0099794_10002150 3300007265 Bacteria 7172
99 Ga0105247_10032975 3300009101 Bacteria 3148
100 Ga0105247_10050778 3300009101 Bacteria 2552
101 Ga0105242_10539429 3300009176 Bacteria 1116
102 Ga0105248_10116978 3300009177 Bacteria 3006
103 Ga0105238_10036835 3300009551 Bacteria 4974
104 Ga0105238_10040099 3300009551 Bacteria 4747
105 Ga0105238_10068535 3300009551 Bacteria 3549
106 Ga0105238_10155694 3300009551 Bacteria 2260
107 Ga0105249_10047546 3300009553 Bacteria 3910
108 Ga0105246_10062714 3300011119 Bacteria 2590
109 Ga0157373_10177131 3300013100 Bacteria 1501
110 Ga0157371_10000551 3300013102 Bacteria 44580
111 Ga0157371_10342787 3300013102 Bacteria 1087
112 Ga0157370_10030043 3300013104 Bacteria 5326
113 Ga0157370_10114455 3300013104 Bacteria 2520
114 Ga0157369_10029196 3300013105 Bacteria 6096
115 Ga0157369_10501761 3300013105 Bacteria 1255
116 Ga0157378_10258257 3300013297 Bacteria 1670
117 Ga0163162_10025336 3300013306 Bacteria 5861
118 Ga0163162_10175803 3300013306 Bacteria 2266
119 Ga0157372_10020195 3300013307 Bacteria 7183
120 Ga0157372_10334350 3300013307 Bacteria 1764
121 Ga0157375_10027376 3300013308 Bacteria 5328
122 Ga0163163_10020990 3300014325 Bacteria 6159
123 Ga0163163_10094061 3300014325 Bacteria 3014
124 Ga0182008_10036068 3300014497 Bacteria 2475
125 Ga0157377_10008442 3300014745 Bacteria 5025
126 Ga0157379_10275094 3300014968 Bacteria 1532
127 Ga0157376_10147536 3300014969 Bacteria 2117
128 Ga0157376_10611085 3300014969 Bacteria 1086
129 Ga0182005_1039502 3300015265 Bacteria 1283
130 Ga0163161_10060239 3300017792 Bacteria 2763
131 Ga0213873_10004290 3300021358 Bacteria 2647
132 Ga0213872_10024646 3300021361 Bacteria 2768
133 Ga0213876_10099821 3300021384 Bacteria 1539
134 Ga0213871_10002000 3300021441 Bacteria 3634
135 Ga0209233_1002797 3300025261 Bacteria 6261
136 Ga0207426_1001403 3300025302 Bacteria 20249
137 Ga0207656_10016200 3300025321 Bacteria 2899
138 Ga0207710_10006598 3300025900 Bacteria 4948
139 Ga0207688_10014779 3300025901 Bacteria 4237
140 Ga0207643_10008861 3300025908 Bacteria 5400
141 Ga0207705_10038394 3300025909 Bacteria 3428
142 Ga0207705_10181959 3300025909 Bacteria 1587
143 Ga0207654_10125391 3300025911 Bacteria 1618
144 Ga0207707_10076907 3300025912 Bacteria 2913
145 Ga0207707_10077417 3300025912 Bacteria 2903
146 Ga0207707_10240537 3300025912 Bacteria 1574
147 Ga0207671_10052927 3300025914 Bacteria 3009
148 Ga0207671_10113265 3300025914 Bacteria 2066
149 Ga0207671_10338058 3300025914 Bacteria 1193
150 Ga0207693_10096385 3300025915 Bacteria 2319
151 Ga0207693_10108029 3300025915 Bacteria 2183
152 Ga0207660_10008964 3300025917 Bacteria 6473
153 Ga0207660_10150235 3300025917 Bacteria 1789
154 Ga0207660_10253802 3300025917 Bacteria 1388
155 Ga0207662_10006695 3300025918 Bacteria 6229
156 Ga0207657_10041981 3300025919 Bacteria 4039
157 Ga0207657_10060137 3300025919 Bacteria 3261
158 Ga0207657_10154229 3300025919 Bacteria 1869
159 Ga0207652_10015661 3300025921 Bacteria 6172
160 Ga0207652_10019037 3300025921 Bacteria 5638
161 Ga0207652_10021845 3300025921 Bacteria 5286
162 Ga0207652_10460290 3300025921 Bacteria 1146
163 Ga0207694_10086873 3300025924 Bacteria 2463
164 Ga0207694_10254054 3300025924 Bacteria 1439
165 Ga0207659_10078262 3300025926 Bacteria 2436
166 Ga0207687_10099966 3300025927 Bacteria 2133
167 Ga0207700_10263837 3300025928 Bacteria 1476
168 Ga0207700_10303239 3300025928 Bacteria 1380
169 Ga0207664_10080309 3300025929 Bacteria 2650
170 Ga0207644_10029116 3300025931 Bacteria 3828
171 Ga0207644_10173500 3300025931 Bacteria 1685
172 Ga0207690_10146439 3300025932 Bacteria 1746
173 Ga0207706_10256738 3300025933 Bacteria 1526
174 Ga0207709_10024830 3300025935 Bacteria 3427
175 Ga0207670_10246236 3300025936 Bacteria 1379
176 Ga0207669_10045445 3300025937 Bacteria 2587
177 Ga0207665_10146259 3300025939 Bacteria 1689
178 Ga0207665_10429476 3300025939 Bacteria 1011
179 Ga0207691_10003300 3300025940 Bacteria 15729
180 Ga0207711_10166960 3300025941 Bacteria 1995
181 Ga0207689_10030062 3300025942 Bacteria 4529
182 Ga0207661_10138810 3300025944 Bacteria 2090
183 Ga0207661_10143839 3300025944 Bacteria 2055
184 Ga0207679_10146033 3300025945 Bacteria 1918
185 Ga0207679_10329826 3300025945 Bacteria 1324
186 Ga0207667_10031410 3300025949 Bacteria 5733
187 Ga0207667_10497033 3300025949 Bacteria 1237
188 Ga0207667_10518844 3300025949 Bacteria 1207
189 Ga0207712_10047690 3300025961 Bacteria 2976
190 Ga0207668_10036103 3300025972 Bacteria 3297
191 Ga0207640_10055142 3300025981 Bacteria 2602
192 Ga0207640_10133668 3300025981 Bacteria 1797
193 Ga0207677_10024294 3300026023 Bacteria 3762
194 Ga0207703_10116407 3300026035 Bacteria 2288
195 Ga0207639_10276889 3300026041 Bacteria 1474
196 Ga0207639_10399822 3300026041 Bacteria 1237
197 Ga0207678_10029067 3300026067 Bacteria 4824
198 Ga0207678_10112373 3300026067 Bacteria 2324
199 Ga0207678_10124296 3300026067 Bacteria 2201
200 Ga0207708_10005502 3300026075 Bacteria 9352
201 Ga0207702_10000065 3300026078 Bacteria 119449
202 Ga0207702_10177121 3300026078 Bacteria 1960
203 Ga0207641_10072274 3300026088 Bacteria 2970
204 Ga0207648_10012270 3300026089 Bacteria 8021
205 Ga0207674_10063355 3300026116 Bacteria 3732
206 Ga0207674_10271470 3300026116 Bacteria 1643
207 Ga0207675_100047550 3300026118 Bacteria 4005
208 Ga0207683_10069930 3300026121 Bacteria 3100
209 Ga0207698_10028860 3300026142 Bacteria 3964
210 Ga0207698_10446074 3300026142 Bacteria 1248
211 Ga0207698_10864290 3300026142 Bacteria 910
212 Ga0209179_1001012 3300027512 Bacteria 3221
213 Ga0268266_10018324 3300028379 Bacteria 5968
214 Ga0268264_10031794 3300028381 Bacteria 4328
215 Ga0265334_10034612 3300028573 Bacteria 2004
216 Ga0307517_10000795 3300028786 Bacteria 54272
217 Ga0265338_10039418 3300028800 Bacteria 4456
218 Ga0307511_10149926 3300030521 Unclassified 1342
219 Ga0265762_1008118 3300030760 Bacteria 1869
220 Ga0265330_10068962 3300031235 Bacteria 1531
221 Ga0265325_10000637 3300031241 Bacteria 25504
222 Ga0265340_10008485 3300031247 Bacteria 5545
223 Ga0265339_10110468 3300031249 Bacteria 1423
224 Ga0265339_10119059 3300031249 Bacteria 1359
225 Ga0265316_10187780 3300031344 Bacteria 1537
226 Ga0307509_10432172 3300031507 Bacteria 1015
227 Ga0307408_100367211 3300031548 Bacteria 1226
228 Ga0265313_10021263 3300031595 Bacteria 3553
229 Ga0265342_10000526 3300031712 Bacteria 40764
230 Ga0265342_10011813 3300031712 Bacteria 5951
231 Ga0307411_10245121 3300032005 Bacteria 1405
232 Ga0307507_10109639 3300033179 Bacteria 2263
233 Ga0373950_0032692 3300034818 Bacteria 969
234 Ga0373923_0002675 3300035111 Bacteria 5542
235 Ga0373923_0036793 3300035111 Bacteria 2000
236 Ga0373941_0000606 3300035115 Bacteria 7250
237 Ga0373953_0013923 3300035117 Bacteria 2883
238 Ga0373953_0172260 3300035117 Bacteria 932
239 Ga0373954_0005028 3300035118 Bacteria 5705
240 Ga0373957_0005387 3300035120 Bacteria 3963
241 Ga0373957_0037701 3300035120 Bacteria 1807
242 Ga0373943_0001129 3300035170 Bacteria 11925
243 Ga0373946_0000102 3300035171 Bacteria 24008
244 Ga0373955_0000846 3300035172 Bacteria 13098
245 Ga0373955_0004208 3300035172 Bacteria 6348
246 Ga0373935_0000109 3300035692 Bacteria 37527
247 Ga0373927_0012157 3300035695 Bacteria 5727
248 Ga0373933_0012037 3300035724 Bacteria 4777
249 Ga0373937_0000052 3300036401 Bacteria 104781
250 Ga0373937_0024305 3300036401 Bacteria 5462
251 Ga0373925_0000019 3300037068 Bacteria 170628
252 Ga0395899_0006733 3300037312 Bacteria 8900
253 Ga0395899_0030834 3300037312 Bacteria 4031
254 Ga0395899_0120602 3300037312 Bacteria 1879
255 Ga0395900_0004466 3300037418 Bacteria 14819
256 Ga0395900_0011893 3300037418 Bacteria 8897
257 Ga0395900_0031170 3300037418 Bacteria 5476
258 Ga0395898_0002730 3300037466 Bacteria 20361
259 Ga0395898_0008243 3300037466 Bacteria 11016
260 Ga0395898_0045109 3300037466 Bacteria 4334
261 Ga0395898_0048988 3300037466 Bacteria 4141
262 Ga0395898_0069658 3300037466 Bacteria 3403
263 Ga0395898_0269186 3300037466 Bacteria 1625
264 Ga0436364_1364073 3300037853 Unclassified 813
265 Ga0395901_0003226 3300038443 Bacteria 16405
266 Ga0395901_0004944 3300038443 Bacteria 13452
267 Ga0395901_0053551 3300038443 Bacteria 4193
268 Ga0395901_0069800 3300038443 Bacteria 3660
269 Ga0395901_0090783 3300038443 Bacteria 3197
270 Ga0436365_0660874 3300039437 Bacteria 1560
271 Ga0436365_1744458 3300039437 Bacteria 4930
272 Ga0436360_0023461 3300039438 Bacteria 1038
273 Ga0436360_0664966 3300039438 Bacteria 2748
274 Ga0436360_0801242 3300039438 Bacteria 1500
275 Ga0436361_0946582 3300039447 Bacteria 1849
276 Ga0436363_0849784 3300039450 Bacteria 3540
277 Ga0436363_0955944 3300039450 Bacteria 780
278 Ga0436362_0230272 3300039453 Bacteria 1093
279 Ga0436362_0441929 3300039453 Bacteria 2838
280 Ga0451853_1519782 3300041512 Bacteria 817
281 Ga0466969_0182572 3300044656 Bacteria 960
282 Ga0466966_0132818 3300044684 Bacteria 1523
283 Ga0466963_0200741 3300044694 Bacteria 1395
284 Ga0466971_0023321 3300044719 Bacteria 2758
285 Ga0466957_0028104 3300044842 Bacteria 3347
286 Ga0466959_0022955 3300045049 Bacteria 4613
287 Ga0466959_0034891 3300045049 Bacteria 3721
288 Ga0466959_0288530 3300045049 Bacteria 1125
289 Ga0451576_0443082 3300045051 Bacteria 1363
290 Ga0466958_0023866 3300045836 Bacteria 3595
291 Ga0466958_0345625 3300045836 Bacteria 957
292 Ga0466967_0524388 3300045976 Bacteria 1164
293 Ga0495592_0000005 3300046454 Bacteria 194493
294 Ga0495592_0063347 3300046454 Bacteria 2712
295 Ga0495603_0008037 3300046455 Bacteria 6371
296 Ga0495590_0087344 3300046457 Bacteria 1102
297 Ga0495629_0000922 3300046459 Bacteria 23637
298 Ga0495629_0005829 3300046459 Bacteria 9190
299 Ga0495638_0002707 3300046460 Bacteria 14253
300 Ga0495641_0027494 3300046461 Bacteria 2766
301 Ga0495651_0000250 3300046462 Bacteria 41725
302 Ga0495651_0072045 3300046462 Bacteria 2625
303 Ga0495653_0000017 3300046463 Bacteria 190660
304 Ga0495653_0004517 3300046463 Bacteria 11238
305 Ga0495582_0172584 3300046473 Bacteria 1231
306 Ga0495605_0113850 3300046474 Bacteria 1232
307 Ga0495662_0008987 3300046476 Bacteria 4906
308 Ga0495662_0225020 3300046476 Bacteria 925
309 Ga0495664_0000014 3300046477 Bacteria 193962
310 Ga0495584_0151242 3300046491 Bacteria 1179
311 Ga0495596_0143008 3300046500 Bacteria 929
312 Ga0495606_0035053 3300046507 Bacteria 3436
313 Ga0495608_0000120 3300046511 Bacteria 56430
314 Ga0495608_0005209 3300046511 Bacteria 9292
315 Ga0495616_0069265 3300046513 Bacteria 1711
316 Ga0495618_0000011 3300046514 Bacteria 179208
317 Ga0495618_0084382 3300046514 Bacteria 2029
318 Ga0495620_0088192 3300046515 Bacteria 1247
319 Ga0495628_0000017 3300046516 Bacteria 169983
320 Ga0495628_0006563 3300046516 Bacteria 10150
321 Ga0495630_0000747 3300046517 Bacteria 22915
322 Ga0495631_0067941 3300046518 Bacteria 1542
323 Ga0495631_0111916 3300046518 Bacteria 1174
324 Ga0495648_0001116 3300046524 Bacteria 27214
325 Ga0495648_0014291 3300046524 Bacteria 5820
326 Ga0495648_0027946 3300046524 Bacteria 3767
327 Ga0495652_0000008 3300046529 Bacteria 343637
328 Ga0495665_0057404 3300046531 Bacteria 2055
329 Ga0495640_0000024 3300046533 Bacteria 99088
330 Ga0495640_0386841 3300046533 Bacteria 860
331 Ga0495586_0054450 3300046535 Bacteria 2168
332 Ga0495587_0000076 3300046536 Bacteria 77574
333 Ga0495598_0112534 3300046537 Bacteria 914
334 Ga0495609_0070215 3300046538 Bacteria 1540
335 Ga0495597_0059168 3300046542 Bacteria 1673
336 Ga0495645_0000006 3300046543 Bacteria 382503
337 Ga0495645_0028225 3300046543 Bacteria 4077
338 Ga0495667_0000026 3300046559 Bacteria 154971
339 Ga0495667_0032158 3300046559 Bacteria 3518
340 Ga0495668_0080478 3300046616 Bacteria 1788
341 Ga0495668_0103933 3300046616 Bacteria 1554
342 Ga0495634_0006584 3300046642 Bacteria 8811
343 Ga0495634_0074399 3300046642 Bacteria 2232
344 Ga0495625_0041801 3300046660 Bacteria 3335
345 Ga0495635_0000014 3300046663 Bacteria 218080
346 Ga0495635_0018258 3300046663 Bacteria 4896
347 Ga0495588_0015777 3300046674 Bacteria 3642
348 Ga0495657_0000038 3300046675 Bacteria 117535
349 Ga0495657_0030744 3300046675 Bacteria 3757
350 Ga0495599_0000010 3300046678 Bacteria 211658
351 Ga0495599_0015415 3300046678 Bacteria 4742
352 Ga0495623_0001762 3300046679 Bacteria 14531
353 Ga0495623_0017308 3300046679 Bacteria 4656
354 Ga0495646_0000008 3300046680 Bacteria 214486
355 Ga0495646_0004910 3300046680 Bacteria 8448
356 Ga0495613_0009384 3300046689 Bacteria 7260
357 Ga0495613_0067310 3300046689 Bacteria 2614
358 Ga0495624_0033338 3300046690 Bacteria 3335
359 Ga0495671_0177068 3300046692 Bacteria 1036
360 Ga0495649_0106024 3300046694 Bacteria 1492
361 Ga0495649_0158498 3300046694 Bacteria 1187
362 Ga0495589_0050795 3300046794 Bacteria 2050
363 Ga0495600_0000046 3300046809 Bacteria 71644
364 Ga0495600_0056241 3300046809 Bacteria 2570
365 Ga0495581_0006360 3300047315 Bacteria 6851
366 Ga0495604_0000006 3300047317 Bacteria 420480
367 Ga0495604_0033930 3300047317 Bacteria 4037
368 Ga0495674_0000009 3300047319 Bacteria 310479
369 Ga0495672_0055225 3300047320 Bacteria 2319
370 Ga0495672_0087099 3300047320 Bacteria 1725
371 Ga0495672_0116220 3300047320 Bacteria 1429
372 Ga0495676_0106204 3300047321 Bacteria 2069
373 Ga0495680_0000562 3300047322 Bacteria 41888
374 Ga0495680_0012630 3300047322 Bacteria 7420
375 Ga0495675_0000290 3300047444 Bacteria 36220
376 Ga0495675_0043909 3300047444 Bacteria 2846
377 Ga0495673_0052415 3300047469 Bacteria 1783
378 Ga0495684_0000015 3300047471 Bacteria 169596
379 Ga0495684_0009374 3300047471 Bacteria 7557
380 Ga0495593_0001381 3300047673 Bacteria 14206
381 Ga0495602_0004555 3300048088 Bacteria 14464
382 Ga0495602_0076031 3300048088 Bacteria 2847
383 Ga0496100_0017397 3300048903 Bacteria 4242
384 Ga0496100_0237126 3300048903 Bacteria 1344
385 Ga0496101_0014974 3300048904 Bacteria 5218
386 Ga0496101_0023110 3300048904 Bacteria 4290
387 Ga0496102_0038572 3300048905 Bacteria 4312
388 Ga0496102_0420433 3300048905 Bacteria 1255
389 Ga0496103_0004409 3300048906 Bacteria 8539
390 Ga0496103_0189233 3300048906 Bacteria 1323
391 Ga0496104_0019068 3300048907 Bacteria 6269
392 Ga0496104_0029416 3300048907 Bacteria 5096
393 Ga0496104_0053305 3300048907 Bacteria 3821
394 Ga0496104_0294517 3300048907 Bacteria 1535
395 Ga0496105_0011065 3300048908 Bacteria 7111
396 Ga0496105_0082956 3300048908 Bacteria 2647
397 Ga0496106_0017261 3300048909 Bacteria 5341
398 Ga0496106_0033475 3300048909 Bacteria 3834
399 Ga0496106_0062909 3300048909 Bacteria 2819
400 Ga0496107_0018936 3300048910 Bacteria 4853
401 Ga0496107_0026843 3300048910 Bacteria 4086
402 Ga0496108_0221399 3300048911 Bacteria 1644
403 Ga0496109_0020079 3300048912 Bacteria 5901
404 Ga0496109_0229541 3300048912 Bacteria 1746
405 Ga0496110_0014321 3300048913 Bacteria 6580
406 Ga0496110_0029280 3300048913 Bacteria 4738
407 Ga0496111_0290926 3300048914 Bacteria 1211
408 Ga0496112_0057924 3300048915 Bacteria 3814
409 Ga0496112_0062108 3300048915 Bacteria 3684
410 Ga0496113_0005089 3300048916 Bacteria 8167
411 Ga0496113_0077735 3300048916 Bacteria 2538
412 Ga0496113_0219899 3300048916 Bacteria 1513
413 Ga0496114_0019378 3300048917 Bacteria 5512
414 Ga0496114_0033013 3300048917 Bacteria 4263
415 Ga0496115_0014499 3300048918 Bacteria 5968
416 Ga0496115_0019450 3300048918 Bacteria 5226
417 Ga0496115_0061402 3300048918 Bacteria 3029
418 Ga0496115_0068521 3300048918 Bacteria 2873
419 Ga0496115_0157336 3300048918 Bacteria 1877
420 Ga0496115_0227141 3300048918 Bacteria 1540
421 Ga0496118_0153358 3300048921 Bacteria 1438
422 Ga0496120_0155552 3300048923 Bacteria 1145
423 Ga0496121_0000379 3300048924 Bacteria 91131
424 Ga0496121_0009973 3300048924 Bacteria 10802
425 Ga0496121_0013716 3300048924 Bacteria 8685
426 Ga0496121_0030162 3300048924 Bacteria 4988
427 Ga0496121_0045878 3300048924 Bacteria 3748
428 Ga0496121_0240367 3300048924 Bacteria 1262
429 Ga0496122_0051424 3300048925 Bacteria 3131
430 Ga0496124_0259259 3300048927 Bacteria 1281
431 Ga0496126_0001884 3300048929 Bacteria 30420
432 Ga0496126_0005451 3300048929 Bacteria 14511
433 Ga0496126_0049063 3300048929 Bacteria 3855
434 Ga0496126_0062680 3300048929 Bacteria 3335
435 Ga0496126_0245966 3300048929 Bacteria 1492
436 Ga0496126_0287420 3300048929 Bacteria 1361
437 Ga0501031_0162344 3300049568 Bacteria 1460
438 Ga0501032_0045634 3300049569 Bacteria 2963
439 Ga0501032_0079876 3300049569 Bacteria 2177
440 Ga0501033_0015675 3300049570 Bacteria 5746
441 Ga0501033_0023848 3300049570 Bacteria 4615
442 Ga0501034_0000820 3300049571 Bacteria 46252
443 Ga0501034_0001125 3300049571 Bacteria 37359
444 Ga0501034_0179047 3300049571 Bacteria 2085
445 Ga0501034_0208448 3300049571 Bacteria 1910
446 Ga0501034_0287716 3300049571 Bacteria 1582
447 Ga0501034_0515795 3300049571 Bacteria 1108
448 Ga0501036_0000216 3300049572 Bacteria 38518
449 Ga0501036_0014414 3300049572 Bacteria 6583
450 Ga0501036_0060774 3300049572 Bacteria 3200
451 Ga0501036_0097754 3300049572 Bacteria 2481
452 Ga0501037_0005146 3300049573 Bacteria 9514
453 Ga0501037_0109315 3300049573 Bacteria 1992
454 Ga0501037_0304690 3300049573 Bacteria 1105
455 Ga0501038_0006074 3300049574 Bacteria 11174
456 Ga0501039_0026448 3300049575 Bacteria 4458
457 Ga0501039_0174457 3300049575 Bacteria 1690
458 Ga0501039_0563018 3300049575 Bacteria 894
459 Ga0501040_0069631 3300049576 Bacteria 2427
460 Ga0501042_0092209 3300049578 Bacteria 2175
461 Ga0501043_0015175 3300049579 Bacteria 6031
462 Ga0501043_0098536 3300049579 Bacteria 2297
463 Ga0501043_0211111 3300049579 Bacteria 1504
464 Ga0501043_0343488 3300049579 Bacteria 1135
465 Ga0501046_0022736 3300049580 Bacteria 5163
466 Ga0501046_0329987 3300049580 Bacteria 1110
467 Ga0501047_0000124 3300049581 Bacteria 94721
468 Ga0501047_0020987 3300049581 Bacteria 6274
469 Ga0501047_0031487 3300049581 Bacteria 5115
470 Ga0501047_0042307 3300049581 Bacteria 4403
471 Ga0501047_0063347 3300049581 Bacteria 3567
472 Ga0501047_0126793 3300049581 Bacteria 2433
473 Ga0501047_0177862 3300049581 Bacteria 1995
474 Ga0501047_0206390 3300049581 Bacteria 1824
475 Ga0501047_0403068 3300049581 Bacteria 1200
476 Ga0501047_0543241 3300049581 Bacteria 987
477 Ga0501048_0000375 3300049582 Bacteria 31006
478 Ga0501048_0036599 3300049582 Bacteria 3527
479 Ga0501048_0127865 3300049582 Bacteria 1797
480 Ga0501048_0190198 3300049582 Bacteria 1454
481 Ga0501068_0025771 3300049584 Bacteria 3460
482 Ga0501068_0034891 3300049584 Bacteria 3002
483 Ga0501069_0070596 3300049585 Bacteria 1957
484 Ga0501069_0140713 3300049585 Bacteria 1384
485 Ga0501070_0005433 3300049586 Bacteria 10881
486 Ga0501070_0006434 3300049586 Bacteria 9998
487 Ga0501070_0011664 3300049586 Bacteria 7420
488 Ga0501070_0017012 3300049586 Bacteria 6101
489 Ga0501070_0066428 3300049586 Bacteria 2986
490 Ga0501070_0084243 3300049586 Bacteria 2632
491 Ga0501070_0276679 3300049586 Bacteria 1370
492 Ga0501070_0381020 3300049586 Bacteria 1142
493 Ga0501071_0185670 3300049587 Bacteria 1558
494 Ga0501072_0028683 3300049588 Bacteria 4345
495 Ga0501072_0030148 3300049588 Bacteria 4240
496 Ga0501072_0122695 3300049588 Bacteria 2070
497 Ga0501073_0020023 3300049589 Bacteria 4824
498 Ga0501073_0067590 3300049589 Bacteria 2491
499 Ga0501074_0008002 3300049590 Bacteria 7654
500 Ga0501074_0049370 3300049590 Bacteria 3038
501 Ga0501075_0084329 3300049591 Bacteria 2407
502 Ga0501079_0095376 3300049741 Bacteria 2305
503 Ga0501079_0164516 3300049741 Bacteria 1730
504 Ga0501080_0000074 3300049742 Bacteria 66985
505 Ga0501080_0001072 3300049742 Bacteria 22512
506 Ga0501080_0012977 3300049742 Bacteria 7649
507 Ga0501080_0045690 3300049742 Bacteria 4077
508 Ga0501080_0067635 3300049742 Bacteria 3323
509 Ga0501080_0471235 3300049742 Bacteria 1124
510 Ga0501081_0235527 3300049743 Bacteria 1334
511 Ga0501083_0000485 3300049744 Bacteria 25494
512 Ga0501083_0016561 3300049744 Bacteria 5156
513 Ga0501083_0091156 3300049744 Bacteria 2012
514 Ga0501035_0010744 3300049822 Bacteria 8477
515 Ga0501035_0023095 3300049822 Bacteria 5708
516 Ga0501035_0120474 3300049822 Bacteria 2294
517 Ga0501035_0143031 3300049822 Bacteria 2079
518 Ga0501035_0223362 3300049822 Bacteria 1607
519 Ga0501035_0261889 3300049822 Bacteria 1465
520 Ga0501044_0001469 3300049823 Bacteria 27682
521 Ga0501044_0004040 3300049823 Bacteria 16460
522 Ga0501044_0018563 3300049823 Bacteria 7452
523 Ga0501044_0021657 3300049823 Bacteria 6853
524 Ga0501044_0028028 3300049823 Bacteria 5944
525 Ga0501044_0135348 3300049823 Bacteria 2455
526 Ga0501044_0283880 3300049823 Bacteria 1588
527 Ga0501044_0343729 3300049823 Bacteria 1413
528 Ga0501044_0473406 3300049823 Bacteria 1156
529 Ga0501045_0296189 3300049824 Bacteria 1204
530 nmdc:mga0yw44_11049_c1 3300050492 Bacteria 4639
531 nmdc:mga0sz30_605_c1 3300050516 Bacteria 8800
532 Ga0495601_0000007 3300053077 Bacteria 365972
533 Ga0495601_0030403 3300053077 Bacteria 3353
534 Ga0495612_0000015 3300053078 Bacteria 167816
535 Ga0495595_0000023 3300053084 Bacteria 108096
536 Ga0495595_0058782 3300053084 Bacteria 1796
537 Ga0495595_0061524 3300053084 Bacteria 1759
538 Ga0495595_0066037 3300053084 Bacteria 1702
539 Ga0495619_0000017 3300053085 Bacteria 219276
540 Ga0495619_0004886 3300053085 Bacteria 8510
541 Ga0500651_0007303 3300053093 Bacteria 6447
542 Ga0500640_003749 3300053095 Bacteria 5386
543 Ga0500641_0158982 3300053096 Bacteria 975
544 Ga0500554_005425 3300053102 Bacteria 2780
545 Ga0500572_000313 3300053111 Bacteria 17306
546 Ga0500595_000352 3300053119 Bacteria 30036
547 Ga0500595_022175 3300053119 Bacteria 2253
548 Ga0500595_077290 3300053119 Bacteria 979
549 Ga0500614_003828 3300053123 Bacteria 3220
550 Ga0500642_0039206 3300053130 Bacteria 2035
551 Ga0500568_0010278 3300053139 Bacteria 4392
552 Ga0500603_002597 3300053150 Bacteria 3943
553 Ga0500616_0000001 3300053153 Bacteria 1986011
554 Ga0500616_0075614 3300053153 Bacteria 1704
555 Ga0500639_000012 3300053163 Bacteria 127545
556 Ga0500636_0016436 3300053177 Bacteria 4363
557 Ga0500636_0183273 3300053177 Bacteria 1122
558 Ga0500637_0041804 3300053178 Bacteria 2590
559 Ga0500645_070334 3300053730 Bacteria 1005
560 Ga0500596_004084 3300053735 Bacteria 2706
561 Ga0500601_000068 3300053737 Bacteria 21333
562 Ga0501084_0039973 3300054114 Bacteria 3923
563 Ga0501082_0155478 3300060353 Bacteria 1987
564 Ga0501082_0203073 3300060353 Bacteria 1724
565 Ga0466962_0038269 3300061719 Bacteria 2297
566 2513893163 2513237141 Bacteria 8496279
567 2528856147 2528768022 Bacteria 10457665
568 2824667315 2824661429 Bacteria 9877870
569 2876764556 2876761206 Bacteria 10111113
570 2879100697 2879099564 Bacteria 10442239
571 2932791846 2932784394 Bacteria 9704911
572 2932815587 2932809354 Bacteria 9135765
573 2932819341 2932818245 Bacteria 9955613
574 2932836030 2932828146 Bacteria 9745859
575 2935646758 2935638405 Bacteria 10015038
576 2935647780 2935638405 Bacteria 10015038
577 2935674532 2935665750 Bacteria 9571747
578 2935674803 2935665750 Bacteria 9571747
579 2935677391 2935675223 Bacteria 9928132
580 2935690628 2935684952 Bacteria 9590419
581 2935717676 2935713505 Bacteria 9608509
582 2935727174 2935722832 Bacteria 9608746
583 2935735944 2935732158 Bacteria 9706831
584 2935744785 2935741537 Bacteria 9707219
585 2935755637 2935750917 Bacteria 9590372
586 2935768306 2935760218 Bacteria 9817913
587 2935809325 2935801545 Bacteria 9301974
588 2935819459 2935810662 Bacteria 9401221
589 2935836052 2935827899 Bacteria 10038562
590 2935837264 2935827899 Bacteria 10038562
591 2935871684 2935864058 Bacteria 9784707
592 2935881949 2935873716 Bacteria 9632195
593 2935998782 2935992306 Bacteria 9802711
594 2936046304 2936037263 Bacteria 9446081
595 2940561082 2940556831 Bacteria 9590747
596 8016514478 8016511872 Bacteria 9921665
597 8017061947 8017057580 Bacteria 10023680
598 Ga0495686_0090636
599 JGI24750J21931_1001116
600 JGI24745J21846_1002382
601 JGI24742J22300_10002490
602 JGI25404J52841_10000037
603 JGI25404J52841_10013541
604 Ga0065165_1000871
605 Ga0070658_10492765
606 Ga0070676_10061996
607 Ga0070690_100019635
608 Ga0070670_100116127
609 Ga0070677_10026501
610 Ga0070666_10053355
611 Ga0070680_100007057
612 Ga0070680_100190575
613 Ga0070680_100268980
614 Ga0070680_100280949
615 Ga0070682_100059440
616 Ga0070682_100404761
617 Ga0068868_100038969
618 Ga0068868_100041854
619 Ga0070689_100320318
620 Ga0070687_100014116
621 Ga0070668_100021220
622 Ga0070671_100016972
623 Ga0070671_100412529
624 Ga0070671_100469844
625 Ga0070674_100068429
626 Ga0070673_100039769
627 Ga0070688_100091152
628 Ga0070659_100280948
629 Ga0070709_10002397
630 Ga0070714_100634076
631 Ga0070713_100353275
632 Ga0070701_10040725
633 Ga0070711_100005259
634 Ga0070700_100033252
635 Ga0070663_100025531
636 Ga0070678_100091331
637 Ga0070678_100255470
638 Ga0070678_100530500
639 Ga0070662_100195141
640 Ga0070681_10026710
641 Ga0070681_10363907
642 Ga0070681_10554346
643 Ga0070685_10026465
644 Ga0070706_100114352
645 Ga0070679_100013883
646 Ga0070679_100014231
647 Ga0070679_100061797
648 Ga0070679_100150212
649 Ga0070679_100167155
650 Ga0070679_100296424
651 Ga0070684_100032554
652 Ga0068853_100093701
653 Ga0070672_100020347
654 Ga0070686_100015124
655 Ga0070665_100030140
656 Ga0070665_100498653
657 Ga0068855_100084259
658 Ga0068855_100246269
659 Ga0068855_100373464
660 Ga0068855_100809781
661 Ga0070664_100142314
662 Ga0070664_100497040
663 Ga0068854_100151427
664 Ga0068856_100028189
665 Ga0068856_100202283
666 Ga0068852_100018955
667 Ga0068852_100491276
668 Ga0068859_100117174
669 Ga0068864_100012057
670 Ga0068864_100104631
671 Ga0068851_10169433
672 Ga0068870_10011153
673 Ga0068863_100080102
674 Ga0068858_100123115
675 Ga0068860_100085631
676 Ga0068860_100153786
677 Ga0081455_10090226
678 Ga0081540_1000728
679 Ga0081540_1007266
680 Ga0081540_1009654
681 Ga0081540_1015505
682 Ga0081540_1044772
683 Ga0070717_10335550
684 Ga0075365_10125639
685 Ga0075368_10045724
686 Ga0075368_10066450
687 Ga0070716_100121115
688 Ga0070716_100383630
689 Ga0070712_100021895
690 Ga0075367_10019338
691 Ga0097621_100245454
692 Ga0068871_100038203
693 Ga0068865_100456987
694 Ga0097620_100117180
695 Ga0099794_10002150
696 Ga0105247_10032975
697 Ga0105247_10050778
698 Ga0105242_10539429
699 Ga0105248_10116978
700 Ga0105238_10036835
701 Ga0105238_10040099
702 Ga0105238_10068535
703 Ga0105238_10155694
704 Ga0105249_10047546
705 Ga0105246_10062714
706 Ga0157373_10177131
707 Ga0157371_10000551
708 Ga0157371_10342787
709 Ga0157370_10030043
710 Ga0157370_10114455
711 Ga0157369_10029196
712 Ga0157369_10501761
713 Ga0157378_10258257
714 Ga0163162_10025336
715 Ga0163162_10175803
716 Ga0157372_10020195
717 Ga0157372_10334350
718 Ga0157375_10027376
719 Ga0163163_10020990
720 Ga0163163_10094061
721 Ga0182008_10036068
722 Ga0157377_10008442
723 Ga0157379_10275094
724 Ga0157376_10147536
725 Ga0157376_10611085
726 Ga0182005_1039502
727 Ga0163161_10060239
728 Ga0213873_10004290
729 Ga0213872_10024646
730 Ga0213876_10099821
731 Ga0213871_10002000
732 Ga0209233_1002797
733 Ga0207426_1001403
734 Ga0207656_10016200
735 Ga0207710_10006598
736 Ga0207688_10014779
737 Ga0207643_10008861
738 Ga0207705_10038394
739 Ga0207705_10181959
740 Ga0207654_10125391
741 Ga0207707_10076907
742 Ga0207707_10077417
743 Ga0207707_10240537
744 Ga0207671_10052927
745 Ga0207671_10113265
746 Ga0207671_10338058
747 Ga0207693_10096385
748 Ga0207693_10108029
749 Ga0207660_10008964
750 Ga0207660_10150235
751 Ga0207660_10253802
752 Ga0207662_10006695
753 Ga0207657_10041981
754 Ga0207657_10060137
755 Ga0207657_10154229
756 Ga0207652_10015661
757 Ga0207652_10019037
758 Ga0207652_10021845
759 Ga0207652_10460290
760 Ga0207694_10086873
761 Ga0207694_10254054
762 Ga0207659_10078262
763 Ga0207687_10099966
764 Ga0207700_10263837
765 Ga0207700_10303239
766 Ga0207664_10080309
767 Ga0207644_10029116
768 Ga0207644_10173500
769 Ga0207690_10146439
770 Ga0207706_10256738
771 Ga0207709_10024830
772 Ga0207670_10246236
773 Ga0207669_10045445
774 Ga0207665_10146259
775 Ga0207665_10429476
776 Ga0207691_10003300
777 Ga0207711_10166960
778 Ga0207689_10030062
779 Ga0207661_10138810
780 Ga0207661_10143839
781 Ga0207679_10146033
782 Ga0207679_10329826
783 Ga0207667_10031410
784 Ga0207667_10497033
785 Ga0207667_10518844
786 Ga0207712_10047690
787 Ga0207668_10036103
788 Ga0207640_10055142
789 Ga0207640_10133668
790 Ga0207677_10024294
791 Ga0207703_10116407
792 Ga0207639_10276889
793 Ga0207639_10399822
794 Ga0207678_10029067
795 Ga0207678_10112373
796 Ga0207678_10124296
797 Ga0207708_10005502
798 Ga0207702_10000065
799 Ga0207702_10177121
800 Ga0207641_10072274
801 Ga0207648_10012270
802 Ga0207674_10063355
803 Ga0207674_10271470
804 Ga0207675_100047550
805 Ga0207683_10069930
806 Ga0207698_10028860
807 Ga0207698_10446074
808 Ga0207698_10864290
809 Ga0209179_1001012
810 Ga0268266_10018324
811 Ga0268264_10031794
812 Ga0265334_10034612
813 Ga0307517_10000795
814 Ga0265338_10039418
815 Ga0307511_10149926
816 Ga0265762_1008118
817 Ga0265330_10068962
818 Ga0265325_10000637
819 Ga0265340_10008485
820 Ga0265339_10110468
821 Ga0265339_10119059
822 Ga0265316_10187780
823 Ga0307509_10432172
824 Ga0307408_100367211
825 Ga0265313_10021263
826 Ga0265342_10000526
827 Ga0265342_10011813
828 Ga0307411_10245121
829 Ga0307507_10109639
830 Ga0373950_0032692
831 Ga0373923_0002675
832 Ga0373923_0036793
833 Ga0373941_0000606
834 Ga0373953_0013923
835 Ga0373953_0172260
836 Ga0373954_0005028
837 Ga0373957_0005387
838 Ga0373957_0037701
839 Ga0373943_0001129
840 Ga0373946_0000102
841 Ga0373955_0000846
842 Ga0373955_0004208
843 Ga0373935_0000109
844 Ga0373927_0012157
845 Ga0373933_0012037
846 Ga0373937_0000052
847 Ga0373937_0024305
848 Ga0373925_0000019
849 Ga0395899_0006733
850 Ga0395899_0030834
851 Ga0395899_0120602
852 Ga0395900_0004466
853 Ga0395900_0011893
854 Ga0395900_0031170
855 Ga0395898_0002730
856 Ga0395898_0008243
857 Ga0395898_0045109
858 Ga0395898_0048988
859 Ga0395898_0069658
860 Ga0395898_0269186
861 Ga0436364_1364073
862 Ga0395901_0003226
863 Ga0395901_0004944
864 Ga0395901_0053551
865 Ga0395901_0069800
866 Ga0395901_0090783
867 Ga0436365_0660874
868 Ga0436365_1744458
869 Ga0436360_0023461
870 Ga0436360_0664966
871 Ga0436360_0801242
872 Ga0436361_0946582
873 Ga0436363_0849784
874 Ga0436363_0955944
875 Ga0436362_0230272
876 Ga0436362_0441929
877 Ga0451853_1519782
878 Ga0466969_0182572
879 Ga0466966_0132818
880 Ga0466963_0200741
881 Ga0466971_0023321
882 Ga0466957_0028104
883 Ga0466959_0022955
884 Ga0466959_0034891
885 Ga0466959_0288530
886 Ga0451576_0443082
887 Ga0466958_0023866
888 Ga0466958_0345625
889 Ga0466967_0524388
890 Ga0495592_0000005
891 Ga0495592_0063347
892 Ga0495603_0008037
893 Ga0495590_0087344
894 Ga0495629_0000922
895 Ga0495629_0005829
896 Ga0495638_0002707
897 Ga0495641_0027494
898 Ga0495651_0000250
899 Ga0495651_0072045
900 Ga0495653_0000017
901 Ga0495653_0004517
902 Ga0495582_0172584
903 Ga0495605_0113850
904 Ga0495662_0008987
905 Ga0495662_0225020
906 Ga0495664_0000014
907 Ga0495584_0151242
908 Ga0495596_0143008
909 Ga0495606_0035053
910 Ga0495608_0000120
911 Ga0495608_0005209
912 Ga0495616_0069265
913 Ga0495618_0000011
914 Ga0495618_0084382
915 Ga0495620_0088192
916 Ga0495628_0000017
917 Ga0495628_0006563
918 Ga0495630_0000747
919 Ga0495631_0067941
920 Ga0495631_0111916
921 Ga0495648_0001116
922 Ga0495648_0014291
923 Ga0495648_0027946
924 Ga0495652_0000008
925 Ga0495665_0057404
926 Ga0495640_0000024
927 Ga0495640_0386841
928 Ga0495586_0054450
929 Ga0495587_0000076
930 Ga0495598_0112534
931 Ga0495609_0070215
932 Ga0495597_0059168
933 Ga0495645_0000006
934 Ga0495645_0028225
935 Ga0495667_0000026
936 Ga0495667_0032158
937 Ga0495668_0080478
938 Ga0495668_0103933
939 Ga0495634_0006584
940 Ga0495634_0074399
941 Ga0495625_0041801
942 Ga0495635_0000014
943 Ga0495635_0018258
944 Ga0495588_0015777
945 Ga0495657_0000038
946 Ga0495657_0030744
947 Ga0495599_0000010
948 Ga0495599_0015415
949 Ga0495623_0001762
950 Ga0495623_0017308
951 Ga0495646_0000008
952 Ga0495646_0004910
953 Ga0495613_0009384
954 Ga0495613_0067310
955 Ga0495624_0033338
956 Ga0495671_0177068
957 Ga0495649_0106024
958 Ga0495649_0158498
959 Ga0495589_0050795
960 Ga0495600_0000046
961 Ga0495600_0056241
962 Ga0495581_0006360
963 Ga0495604_0000006
964 Ga0495604_0033930
965 Ga0495674_0000009
966 Ga0495672_0055225
967 Ga0495672_0087099
968 Ga0495672_0116220
969 Ga0495676_0106204
970 Ga0495680_0000562
971 Ga0495680_0012630
972 Ga0495675_0000290
973 Ga0495675_0043909
974 Ga0495673_0052415
975 Ga0495684_0000015
976 Ga0495684_0009374
977 Ga0495593_0001381
978 Ga0495602_0004555
979 Ga0495602_0076031
980 Ga0496100_0017397
981 Ga0496100_0237126
982 Ga0496101_0014974
983 Ga0496101_0023110
984 Ga0496102_0038572
985 Ga0496102_0420433
986 Ga0496103_0004409
987 Ga0496103_0189233
988 Ga0496104_0019068
989 Ga0496104_0029416
990 Ga0496104_0053305
991 Ga0496104_0294517
992 Ga0496105_0011065
993 Ga0496105_0082956
994 Ga0496106_0017261
995 Ga0496106_0033475
996 Ga0496106_0062909
997 Ga0496107_0018936
998 Ga0496107_0026843
999 Ga0496108_0221399
1000 Ga0496109_0020079
1001 Ga0496109_0229541
1002 Ga0496110_0014321
1003 Ga0496110_0029280
1004 Ga0496111_0290926
1005 Ga0496112_0057924
1006 Ga0496112_0062108
1007 Ga0496113_0005089
1008 Ga0496113_0077735
1009 Ga0496113_0219899
1010 Ga0496114_0019378
1011 Ga0496114_0033013
1012 Ga0496115_0014499
1013 Ga0496115_0019450
1014 Ga0496115_0061402
1015 Ga0496115_0068521
1016 Ga0496115_0157336
1017 Ga0496115_0227141
1018 Ga0496118_0153358
1019 Ga0496120_0155552
1020 Ga0496121_0000379
1021 Ga0496121_0009973
1022 Ga0496121_0013716
1023 Ga0496121_0030162
1024 Ga0496121_0045878
1025 Ga0496121_0240367
1026 Ga0496122_0051424
1027 Ga0496124_0259259
1028 Ga0496126_0001884
1029 Ga0496126_0005451
1030 Ga0496126_0049063
1031 Ga0496126_0062680
1032 Ga0496126_0245966
1033 Ga0496126_0287420
1034 Ga0501031_0162344
1035 Ga0501032_0045634
1036 Ga0501032_0079876
1037 Ga0501033_0015675
1038 Ga0501033_0023848
1039 Ga0501034_0000820
1040 Ga0501034_0001125
1041 Ga0501034_0179047
1042 Ga0501034_0208448
1043 Ga0501034_0287716
1044 Ga0501034_0515795
1045 Ga0501036_0000216
1046 Ga0501036_0014414
1047 Ga0501036_0060774
1048 Ga0501036_0097754
1049 Ga0501037_0005146
1050 Ga0501037_0109315
1051 Ga0501037_0304690
1052 Ga0501038_0006074
1053 Ga0501039_0026448
1054 Ga0501039_0174457
1055 Ga0501039_0563018
1056 Ga0501040_0069631
1057 Ga0501042_0092209
1058 Ga0501043_0015175
1059 Ga0501043_0098536
1060 Ga0501043_0211111
1061 Ga0501043_0343488
1062 Ga0501046_0022736
1063 Ga0501046_0329987
1064 Ga0501047_0000124
1065 Ga0501047_0020987
1066 Ga0501047_0031487
1067 Ga0501047_0042307
1068 Ga0501047_0063347
1069 Ga0501047_0126793
1070 Ga0501047_0177862
1071 Ga0501047_0206390
1072 Ga0501047_0403068
1073 Ga0501047_0543241
1074 Ga0501048_0000375
1075 Ga0501048_0036599
1076 Ga0501048_0127865
1077 Ga0501048_0190198
1078 Ga0501068_0025771
1079 Ga0501068_0034891
1080 Ga0501069_0070596
1081 Ga0501069_0140713
1082 Ga0501070_0005433
1083 Ga0501070_0006434
1084 Ga0501070_0011664
1085 Ga0501070_0017012
1086 Ga0501070_0066428
1087 Ga0501070_0084243
1088 Ga0501070_0276679
1089 Ga0501070_0381020
1090 Ga0501071_0185670
1091 Ga0501072_0028683
1092 Ga0501072_0030148
1093 Ga0501072_0122695
1094 Ga0501073_0020023
1095 Ga0501073_0067590
1096 Ga0501074_0008002
1097 Ga0501074_0049370
1098 Ga0501075_0084329
1099 Ga0501079_0095376
1100 Ga0501079_0164516
1101 Ga0501080_0000074
1102 Ga0501080_0001072
1103 Ga0501080_0012977
1104 Ga0501080_0045690
1105 Ga0501080_0067635
1106 Ga0501080_0471235
1107 Ga0501081_0235527
1108 Ga0501083_0000485
1109 Ga0501083_0016561
1110 Ga0501083_0091156
1111 Ga0501035_0010744
1112 Ga0501035_0023095
1113 Ga0501035_0120474
1114 Ga0501035_0143031
1115 Ga0501035_0223362
1116 Ga0501035_0261889
1117 Ga0501044_0001469
1118 Ga0501044_0004040
1119 Ga0501044_0018563
1120 Ga0501044_0021657
1121 Ga0501044_0028028
1122 Ga0501044_0135348
1123 Ga0501044_0283880
1124 Ga0501044_0343729
1125 Ga0501044_0473406
1126 Ga0501045_0296189
1127 nmdc:mga0yw44_11049_c1
1128 nmdc:mga0sz30_605_c1
1129 Ga0495601_0000007
1130 Ga0495601_0030403
1131 Ga0495612_0000015
1132 Ga0495595_0000023
1133 Ga0495595_0058782
1134 Ga0495595_0061524
1135 Ga0495595_0066037
1136 Ga0495619_0000017
1137 Ga0495619_0004886
1138 Ga0500651_0007303
1139 Ga0500640_003749
1140 Ga0500641_0158982
1141 Ga0500554_005425
1142 Ga0500572_000313
1143 Ga0500595_000352
1144 Ga0500595_022175
1145 Ga0500595_077290
1146 Ga0500614_003828
1147 Ga0500642_0039206
1148 Ga0500568_0010278
1149 Ga0500603_002597
1150 Ga0500616_0000001
1151 Ga0500616_0075614
1152 Ga0500639_000012
1153 Ga0500636_0016436
1154 Ga0500636_0183273
1155 Ga0500637_0041804
1156 Ga0500645_070334
1157 Ga0500596_004084
1158 Ga0500601_000068
1159 Ga0501084_0039973
1160 Ga0501082_0155478
1161 Ga0501082_0203073
1162 Ga0466962_0038269
1163 2513893163
1164 2528856147
1165 2824667315
1166 2876764556
1167 2879100697
1168 2932791846
1169 2932815587
1170 2932819341
1171 2932836030
1172 2935646758
1173 2935647780
1174 2935674532
1175 2935674803
1176 2935677391
1177 2935690628
1178 2935717676
1179 2935727174
1180 2935735944
1181 2935744785
1182 2935755637
1183 2935768306
1184 2935809325
1185 2935819459
1186 2935836052
1187 2935837264
1188 2935871684
1189 2935881949
1190 2935998782
1191 2936046304
1192 2940561082
1193 8016514478
1194 8017061947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13618

Gluconate_2-dh3

Gluconate 2-dehydrogenase subunit 3

111

266

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zdw-assembly1.cif.gz_BBB crystal structure of the ribonuclease core of r3b2 0.3314 53 201
6zdw-assembly1.cif.gz_BBB crystal structure of the ribonuclease core of r3b2 0.3152 53 201
6qq6-assembly1.cif.gz_B cryo-em structure of dimeric quinol dependent nitric oxide reductase (qnor) val495ala mutant from alcaligenes xylosoxidans 0.3086 52 190
5ola-assembly2.cif.gz_F structure of mitochondrial transcription elongation complex in complex with elongation factor tefm 0.3037 55 206
8br8-assembly1.cif.gz_SF giardia ribosome in post-t state (a1) 0.2458 42 200
ID Description Score Start End Superfamily
af_B6TKL5_43_228_3.10.280.10 Alpha Beta;Roll;Mitochondrial Matrix Protein; Chain A;Mitochondrial glycoprotein 0.4692 139 185 3.10.280.10
af_Q0IZP8_34_222_3.10.280.10 Alpha Beta;Roll;Mitochondrial Matrix Protein; Chain A;Mitochondrial glycoprotein 0.444 138 184 3.10.280.10
af_O94675_51_268_3.10.280.10 Alpha Beta;Roll;Mitochondrial Matrix Protein; Chain A;Mitochondrial glycoprotein 0.4403 137 184 3.10.280.10
af_I1KVJ8_43_226_3.10.280.10 Alpha Beta;Roll;Mitochondrial Matrix Protein; Chain A;Mitochondrial glycoprotein 0.4345 140 202 3.10.280.10
af_Q6UVM3_183_287_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3701 126 184 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A535WWK5-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9148 47 208
AF-B7BFQ2-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.9053 51 208
AF-A0A8B4HC81-F1-model_v4 deleted 0.9015 126 204
AF-A0A7W1NL35-F1-model_v4 Gluconate 2-dehydrogenase subunit 3 family protein 0.8992 52 208
AF-A0A6J4Q664-F1-model_v4 Glucose-methanol-choline (GMC) oxidoreductase:NAD binding site 0.8966 44 207 GO:0016614
GO:0050660

Map