F467691
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 597 | 285 | 597 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300042001|Ga0439441_075627|Ga0439441_075627_147_578 |
| Length | 143 |
| Sequence | MSTSSFTEAELEAFLNRMLESERAGARSLVVFLDDFPRNGETWKILRRVHEDEAHNCALIGEQLKKRGRDYSHATGEFYAKAVAIEGQPERIRFLVKGLRWAIRELEQALPRIPDPAIRQLFQGIRERHLRSVAACETAAQSP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 44 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 46 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 47 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 69 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 70 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 147 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 148 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 151 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 152 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 153 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 154 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 155 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 156 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 157 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 159 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 160 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 164 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 167 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 172 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 178 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 187 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 188 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 189 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 190 | 3300042116 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 | Metagenome | Rhizosphere |
| 191 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 192 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 193 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 194 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 195 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 196 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 266 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.01 |
| Rhizosphere | 98.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10350879 | 3300005295 | Unclassified | 918 |
| 2 | Ga0070676_10148336 | 3300005328 | Bacteria | 1499 |
| 3 | Ga0070690_100011005 | 3300005330 | Bacteria | 5282 |
| 4 | Ga0070690_100865050 | 3300005330 | Unclassified | 705 |
| 5 | Ga0070670_100595906 | 3300005331 | Bacteria | 989 |
| 6 | Ga0070670_100917462 | 3300005331 | Unclassified | 794 |
| 7 | Ga0068869_100001027 | 3300005334 | Bacteria | 16246 |
| 8 | Ga0068869_100050719 | 3300005334 | Bacteria | 3009 |
| 9 | Ga0068869_100067547 | 3300005334 | Bacteria | 2638 |
| 10 | Ga0068869_100087161 | 3300005334 | Bacteria | 2342 |
| 11 | Ga0070666_10172462 | 3300005335 | Bacteria | 1515 |
| 12 | Ga0070680_100012102 | 3300005336 | Bacteria | 6698 |
| 13 | Ga0070680_100044924 | 3300005336 | Bacteria | 3590 |
| 14 | Ga0068868_100000169 | 3300005338 | Bacteria | 42949 |
| 15 | Ga0068868_101746724 | 3300005338 | Bacteria | 587 |
| 16 | Ga0070689_100107883 | 3300005340 | Bacteria | 2211 |
| 17 | Ga0070689_100145621 | 3300005340 | Bacteria | 1908 |
| 18 | Ga0070689_100262685 | 3300005340 | Bacteria | 1427 |
| 19 | Ga0070691_10023775 | 3300005341 | Bacteria | 2847 |
| 20 | Ga0070691_10029702 | 3300005341 | Bacteria | 2558 |
| 21 | Ga0070691_10477266 | 3300005341 | Bacteria | 717 |
| 22 | Ga0070687_100000112 | 3300005343 | Bacteria | 27473 |
| 23 | Ga0070687_100058115 | 3300005343 | Bacteria | 2031 |
| 24 | Ga0070661_101006471 | 3300005344 | Unclassified | 691 |
| 25 | Ga0070692_10000260 | 3300005345 | Bacteria | 14689 |
| 26 | Ga0070692_10023013 | 3300005345 | Bacteria | 3049 |
| 27 | Ga0070669_100201390 | 3300005353 | Unclassified | 1567 |
| 28 | Ga0070669_100280704 | 3300005353 | Bacteria | 1334 |
| 29 | Ga0070675_100052510 | 3300005354 | Bacteria | 3351 |
| 30 | Ga0070675_101085039 | 3300005354 | Bacteria | 736 |
| 31 | Ga0070675_101166531 | 3300005354 | Unclassified | 709 |
| 32 | Ga0070674_101490659 | 3300005356 | Bacteria | 608 |
| 33 | Ga0070673_100205175 | 3300005364 | Bacteria | 1699 |
| 34 | Ga0070673_100485666 | 3300005364 | Bacteria | 1116 |
| 35 | Ga0070673_100508007 | 3300005364 | Bacteria | 1091 |
| 36 | Ga0070688_100217086 | 3300005365 | Bacteria | 1346 |
| 37 | Ga0070688_100248287 | 3300005365 | Bacteria | 1266 |
| 38 | Ga0070703_10003990 | 3300005406 | Bacteria | 4172 |
| 39 | Ga0070710_10536640 | 3300005437 | Bacteria | 806 |
| 40 | Ga0070701_10000840 | 3300005438 | Bacteria | 11002 |
| 41 | Ga0070701_10220157 | 3300005438 | Archaea | 1132 |
| 42 | Ga0070701_10414510 | 3300005438 | Bacteria | 856 |
| 43 | Ga0070711_100486724 | 3300005439 | Bacteria | 1015 |
| 44 | Ga0070711_101118454 | 3300005439 | Bacteria | 679 |
| 45 | Ga0070705_100000991 | 3300005440 | Bacteria | 15853 |
| 46 | Ga0070705_100045456 | 3300005440 | Bacteria | 2526 |
| 47 | Ga0070705_100467373 | 3300005440 | Bacteria | 950 |
| 48 | Ga0070700_100005957 | 3300005441 | Bacteria | 6481 |
| 49 | Ga0070700_100078017 | 3300005441 | Bacteria | 2131 |
| 50 | Ga0070700_100523958 | 3300005441 | Bacteria | 916 |
| 51 | Ga0070694_100000608 | 3300005444 | Bacteria | 19748 |
| 52 | Ga0070694_100007608 | 3300005444 | Bacteria | 6612 |
| 53 | Ga0070694_100052420 | 3300005444 | Bacteria | 2757 |
| 54 | Ga0070694_100085942 | 3300005444 | Bacteria | 2197 |
| 55 | Ga0070694_100147677 | 3300005444 | Bacteria | 1714 |
| 56 | Ga0070694_100874122 | 3300005444 | Bacteria | 741 |
| 57 | Ga0070678_100505942 | 3300005456 | Bacteria | 1066 |
| 58 | Ga0070662_100244832 | 3300005457 | Bacteria | 1439 |
| 59 | Ga0070681_10155515 | 3300005458 | Bacteria | 2212 |
| 60 | Ga0070681_11435882 | 3300005458 | Unclassified | 614 |
| 61 | Ga0068867_100001181 | 3300005459 | Bacteria | 17901 |
| 62 | Ga0068867_100853816 | 3300005459 | Bacteria | 816 |
| 63 | Ga0070706_101531988 | 3300005467 | Bacteria | 609 |
| 64 | Ga0070699_100547711 | 3300005518 | Unclassified | 1053 |
| 65 | Ga0070679_100161927 | 3300005530 | Bacteria | 2212 |
| 66 | Ga0070697_100002931 | 3300005536 | Bacteria | 13126 |
| 67 | Ga0070697_100212412 | 3300005536 | Bacteria | 1648 |
| 68 | Ga0070697_101318485 | 3300005536 | Unclassified | 644 |
| 69 | Ga0070672_100204208 | 3300005543 | Bacteria | 1653 |
| 70 | Ga0070672_100229637 | 3300005543 | Bacteria | 1559 |
| 71 | Ga0070686_100033276 | 3300005544 | Bacteria | 3166 |
| 72 | Ga0070695_100036056 | 3300005545 | Bacteria | 3111 |
| 73 | Ga0070695_100155572 | 3300005545 | Bacteria | 1599 |
| 74 | Ga0070695_100527046 | 3300005545 | Bacteria | 917 |
| 75 | Ga0070695_100573069 | 3300005545 | Bacteria | 883 |
| 76 | Ga0070696_100004235 | 3300005546 | Bacteria | 9565 |
| 77 | Ga0070696_100069732 | 3300005546 | Bacteria | 2471 |
| 78 | Ga0070696_100155071 | 3300005546 | Bacteria | 1684 |
| 79 | Ga0070696_100300305 | 3300005546 | Bacteria | 1230 |
| 80 | Ga0070696_100376353 | 3300005546 | Bacteria | 1106 |
| 81 | Ga0070693_100002169 | 3300005547 | Bacteria | 8998 |
| 82 | Ga0070693_100293022 | 3300005547 | Bacteria | 1094 |
| 83 | Ga0070704_100036923 | 3300005549 | Bacteria | 3333 |
| 84 | Ga0070704_100040539 | 3300005549 | Bacteria | 3206 |
| 85 | Ga0070704_100052885 | 3300005549 | Bacteria | 2868 |
| 86 | Ga0070704_100391375 | 3300005549 | Bacteria | 1184 |
| 87 | Ga0070704_100626626 | 3300005549 | Bacteria | 947 |
| 88 | Ga0068855_100020529 | 3300005563 | Bacteria | 7921 |
| 89 | Ga0068855_101073312 | 3300005563 | Bacteria | 843 |
| 90 | Ga0068857_100174999 | 3300005577 | Bacteria | 1952 |
| 91 | Ga0068854_100066900 | 3300005578 | Bacteria | 2616 |
| 92 | Ga0068856_100042983 | 3300005614 | Bacteria | 4446 |
| 93 | Ga0068856_100157067 | 3300005614 | Bacteria | 2285 |
| 94 | Ga0070702_100000016 | 3300005615 | Bacteria | 48066 |
| 95 | Ga0070702_100348021 | 3300005615 | Unclassified | 1043 |
| 96 | Ga0070702_100423905 | 3300005615 | Bacteria | 958 |
| 97 | Ga0068852_100204743 | 3300005616 | Bacteria | 1869 |
| 98 | Ga0068859_100006034 | 3300005617 | Bacteria | 12305 |
| 99 | Ga0068859_100307891 | 3300005617 | Bacteria | 1678 |
| 100 | Ga0068859_101701454 | 3300005617 | Bacteria | 697 |
| 101 | Ga0068859_101740163 | 3300005617 | Bacteria | 689 |
| 102 | Ga0068864_100259558 | 3300005618 | Bacteria | 1616 |
| 103 | Ga0068866_10000639 | 3300005718 | Bacteria | 15853 |
| 104 | Ga0068861_100054424 | 3300005719 | Bacteria | 3048 |
| 105 | Ga0068861_101539472 | 3300005719 | Bacteria | 653 |
| 106 | Ga0068870_10188746 | 3300005840 | Bacteria | 1242 |
| 107 | Ga0068870_10252098 | 3300005840 | Bacteria | 1095 |
| 108 | Ga0068863_100144845 | 3300005841 | Unclassified | 2272 |
| 109 | Ga0068863_101054238 | 3300005841 | Bacteria | 817 |
| 110 | Ga0068858_100317478 | 3300005842 | Bacteria | 1488 |
| 111 | Ga0068860_100001230 | 3300005843 | Bacteria | 27942 |
| 112 | Ga0068862_100009634 | 3300005844 | Bacteria | 7984 |
| 113 | Ga0068862_100100121 | 3300005844 | Bacteria | 2534 |
| 114 | Ga0068862_100117691 | 3300005844 | Unclassified | 2338 |
| 115 | Ga0068862_100132981 | 3300005844 | Bacteria | 2202 |
| 116 | Ga0068862_100973274 | 3300005844 | Unclassified | 838 |
| 117 | Ga0081455_10370863 | 3300005937 | Bacteria | 1003 |
| 118 | Ga0070715_10079721 | 3300006163 | Bacteria | 1483 |
| 119 | Ga0097621_100045926 | 3300006237 | Bacteria | 3531 |
| 120 | Ga0097621_101053829 | 3300006237 | Unclassified | 762 |
| 121 | Ga0068871_100000120 | 3300006358 | Bacteria | 49031 |
| 122 | Ga0068871_101507868 | 3300006358 | Unclassified | 635 |
| 123 | Ga0075428_100224022 | 3300006844 | Unclassified | 2030 |
| 124 | Ga0075428_100246694 | 3300006844 | Bacteria | 1925 |
| 125 | Ga0075428_100906838 | 3300006844 | Bacteria | 935 |
| 126 | Ga0075428_101179697 | 3300006844 | Bacteria | 807 |
| 127 | Ga0075430_100046667 | 3300006846 | Bacteria | 3659 |
| 128 | Ga0075430_100056622 | 3300006846 | Bacteria | 3297 |
| 129 | Ga0075430_100398811 | 3300006846 | Bacteria | 1135 |
| 130 | Ga0075430_100527181 | 3300006846 | Unclassified | 974 |
| 131 | Ga0075430_100962712 | 3300006846 | Unclassified | 703 |
| 132 | Ga0075430_101050112 | 3300006846 | Unclassified | 671 |
| 133 | Ga0075431_100094541 | 3300006847 | Bacteria | 3085 |
| 134 | Ga0075431_100124186 | 3300006847 | Bacteria | 2663 |
| 135 | Ga0075431_100239197 | 3300006847 | Bacteria | 1847 |
| 136 | Ga0075431_100571820 | 3300006847 | Bacteria | 1116 |
| 137 | Ga0075431_100581297 | 3300006847 | Bacteria | 1105 |
| 138 | Ga0075433_10001178 | 3300006852 | Bacteria | 18995 |
| 139 | Ga0075433_10398282 | 3300006852 | Bacteria | 1215 |
| 140 | Ga0075434_100001217 | 3300006871 | Bacteria | 21379 |
| 141 | Ga0075434_100203175 | 3300006871 | Bacteria | 2002 |
| 142 | Ga0075434_100658967 | 3300006871 | Bacteria | 1065 |
| 143 | Ga0075434_101803343 | 3300006871 | Unclassified | 619 |
| 144 | Ga0075429_100005024 | 3300006880 | Bacteria | 11389 |
| 145 | Ga0075429_100031593 | 3300006880 | Bacteria | 4601 |
| 146 | Ga0075429_100508682 | 3300006880 | Bacteria | 1055 |
| 147 | Ga0075429_100769259 | 3300006880 | Bacteria | 843 |
| 148 | Ga0075429_101629257 | 3300006880 | Bacteria | 561 |
| 149 | Ga0068865_100002861 | 3300006881 | Bacteria | 10282 |
| 150 | Ga0068865_100040371 | 3300006881 | Bacteria | 3170 |
| 151 | Ga0075436_100035671 | 3300006914 | Bacteria | 3430 |
| 152 | Ga0075436_100244127 | 3300006914 | Bacteria | 1278 |
| 153 | Ga0097620_100006034 | 3300006931 | Bacteria | 12305 |
| 154 | Ga0097620_100307891 | 3300006931 | Bacteria | 1678 |
| 155 | Ga0097620_101701404 | 3300006931 | Bacteria | 697 |
| 156 | Ga0097620_101740116 | 3300006931 | Bacteria | 689 |
| 157 | Ga0075435_100000549 | 3300007076 | Bacteria | 23038 |
| 158 | Ga0099794_10019620 | 3300007265 | Bacteria | 3051 |
| 159 | Ga0099794_10067447 | 3300007265 | Bacteria | 1747 |
| 160 | Ga0099794_10195171 | 3300007265 | Bacteria | 1036 |
| 161 | Ga0105250_10221557 | 3300009092 | Unclassified | 802 |
| 162 | Ga0111539_10023101 | 3300009094 | Bacteria | 7638 |
| 163 | Ga0111539_10066729 | 3300009094 | Bacteria | 4250 |
| 164 | Ga0111539_10250772 | 3300009094 | Bacteria | 2061 |
| 165 | Ga0111539_10406612 | 3300009094 | Bacteria | 1585 |
| 166 | Ga0111539_10838013 | 3300009094 | Bacteria | 1070 |
| 167 | Ga0111539_12494943 | 3300009094 | Unclassified | 600 |
| 168 | Ga0105245_10000259 | 3300009098 | Bacteria | 50388 |
| 169 | Ga0114129_10058621 | 3300009147 | Bacteria | 5385 |
| 170 | Ga0114129_10205743 | 3300009147 | Unclassified | 2663 |
| 171 | Ga0114129_11012575 | 3300009147 | Bacteria | 1045 |
| 172 | Ga0114129_11171499 | 3300009147 | Bacteria | 959 |
| 173 | Ga0105243_10015694 | 3300009148 | Bacteria | 5728 |
| 174 | Ga0105243_10016613 | 3300009148 | Bacteria | 5566 |
| 175 | Ga0105241_10065500 | 3300009174 | Bacteria | 2808 |
| 176 | Ga0105242_10001686 | 3300009176 | Bacteria | 17502 |
| 177 | Ga0105242_10706002 | 3300009176 | Bacteria | 987 |
| 178 | Ga0105248_10151197 | 3300009177 | Bacteria | 2619 |
| 179 | Ga0105237_10096519 | 3300009545 | Bacteria | 2946 |
| 180 | Ga0105237_10444517 | 3300009545 | Bacteria | 1302 |
| 181 | Ga0105249_10001070 | 3300009553 | Bacteria | 24290 |
| 182 | Ga0105249_10265598 | 3300009553 | Bacteria | 1707 |
| 183 | Ga0105249_10653902 | 3300009553 | Bacteria | 1109 |
| 184 | Ga0105239_10049991 | 3300010375 | Bacteria | 4585 |
| 185 | Ga0105246_10973188 | 3300011119 | Unclassified | 766 |
| 186 | Ga0157346_1008790 | 3300012480 | Bacteria | 703 |
| 187 | Ga0157378_10000576 | 3300013297 | Bacteria | 34686 |
| 188 | Ga0157378_10798011 | 3300013297 | Bacteria | 970 |
| 189 | Ga0163162_10048344 | 3300013306 | Bacteria | 4261 |
| 190 | Ga0163162_10378285 | 3300013306 | Bacteria | 1549 |
| 191 | Ga0163162_10439433 | 3300013306 | Bacteria | 1437 |
| 192 | Ga0157375_10353764 | 3300013308 | Bacteria | 1635 |
| 193 | Ga0157375_10582921 | 3300013308 | Bacteria | 1279 |
| 194 | Ga0163163_12178762 | 3300014325 | Bacteria | 613 |
| 195 | Ga0157380_10012036 | 3300014326 | Bacteria | 6261 |
| 196 | Ga0157380_10806534 | 3300014326 | Bacteria | 956 |
| 197 | Ga0157377_10045260 | 3300014745 | Bacteria | 2458 |
| 198 | Ga0157377_10811872 | 3300014745 | Bacteria | 691 |
| 199 | Ga0157377_10872072 | 3300014745 | Bacteria | 670 |
| 200 | Ga0157379_10304127 | 3300014968 | Bacteria | 1454 |
| 201 | Ga0157376_10004961 | 3300014969 | Bacteria | 9280 |
| 202 | Ga0207697_10446431 | 3300025315 | Unclassified | 573 |
| 203 | Ga0207653_10012421 | 3300025885 | Bacteria | 2659 |
| 204 | Ga0207642_10002463 | 3300025899 | Bacteria | 5763 |
| 205 | Ga0207685_10000844 | 3300025905 | Bacteria | 5737 |
| 206 | Ga0207685_10053669 | 3300025905 | Bacteria | 1566 |
| 207 | Ga0207685_10239433 | 3300025905 | Bacteria | 872 |
| 208 | Ga0207645_10179043 | 3300025907 | Bacteria | 1391 |
| 209 | Ga0207643_10131994 | 3300025908 | Bacteria | 1487 |
| 210 | Ga0207654_10067712 | 3300025911 | Bacteria | 2110 |
| 211 | Ga0207671_10445052 | 3300025914 | Bacteria | 1032 |
| 212 | Ga0207663_10357647 | 3300025916 | Bacteria | 1107 |
| 213 | Ga0207663_11046189 | 3300025916 | Bacteria | 655 |
| 214 | Ga0207660_10001156 | 3300025917 | Bacteria | 17635 |
| 215 | Ga0207660_10286597 | 3300025917 | Bacteria | 1308 |
| 216 | Ga0207660_10424720 | 3300025917 | Bacteria | 1073 |
| 217 | Ga0207662_10000106 | 3300025918 | Bacteria | 40137 |
| 218 | Ga0207662_10078695 | 3300025918 | Bacteria | 2007 |
| 219 | Ga0207652_10032518 | 3300025921 | Bacteria | 4387 |
| 220 | Ga0207681_10044062 | 3300025923 | Bacteria | 2989 |
| 221 | Ga0207681_10485634 | 3300025923 | Bacteria | 1009 |
| 222 | Ga0207694_11486893 | 3300025924 | Unclassified | 572 |
| 223 | Ga0207659_10732213 | 3300025926 | Bacteria | 848 |
| 224 | Ga0207687_10021347 | 3300025927 | Bacteria | 4301 |
| 225 | Ga0207686_10000883 | 3300025934 | Bacteria | 18123 |
| 226 | Ga0207709_10001408 | 3300025935 | Bacteria | 16830 |
| 227 | Ga0207709_10675100 | 3300025935 | Bacteria | 825 |
| 228 | Ga0207670_10032252 | 3300025936 | Bacteria | 3367 |
| 229 | Ga0207670_10049001 | 3300025936 | Bacteria | 2823 |
| 230 | Ga0207670_10124413 | 3300025936 | Bacteria | 1880 |
| 231 | Ga0207670_10784569 | 3300025936 | Unclassified | 793 |
| 232 | Ga0207669_11540445 | 3300025937 | Bacteria | 567 |
| 233 | Ga0207704_10007809 | 3300025938 | Bacteria | 5076 |
| 234 | Ga0207704_10522775 | 3300025938 | Bacteria | 960 |
| 235 | Ga0207704_10677748 | 3300025938 | Bacteria | 851 |
| 236 | Ga0207665_10567099 | 3300025939 | Bacteria | 883 |
| 237 | Ga0207691_10043567 | 3300025940 | Bacteria | 4135 |
| 238 | Ga0207711_10130101 | 3300025941 | Bacteria | 2256 |
| 239 | Ga0207689_10000376 | 3300025942 | Bacteria | 41990 |
| 240 | Ga0207689_10058600 | 3300025942 | Bacteria | 3167 |
| 241 | Ga0207689_10091991 | 3300025942 | Bacteria | 2492 |
| 242 | Ga0207689_10715896 | 3300025942 | Bacteria | 844 |
| 243 | Ga0207667_10016778 | 3300025949 | Bacteria | 8263 |
| 244 | Ga0207667_10330360 | 3300025949 | Bacteria | 1557 |
| 245 | Ga0207651_10075140 | 3300025960 | Bacteria | 2410 |
| 246 | Ga0207651_10226604 | 3300025960 | Unclassified | 1514 |
| 247 | Ga0207651_10254357 | 3300025960 | Bacteria | 1439 |
| 248 | Ga0207651_10818793 | 3300025960 | Bacteria | 826 |
| 249 | Ga0207712_10030519 | 3300025961 | Bacteria | 3624 |
| 250 | Ga0207668_11405169 | 3300025972 | Bacteria | 629 |
| 251 | Ga0207640_10028259 | 3300025981 | Bacteria | 3427 |
| 252 | Ga0207677_10070095 | 3300026023 | Bacteria | 2469 |
| 253 | Ga0207677_10753790 | 3300026023 | Bacteria | 868 |
| 254 | Ga0207703_10023514 | 3300026035 | Bacteria | 4842 |
| 255 | Ga0207708_10016505 | 3300026075 | Bacteria | 5554 |
| 256 | Ga0207708_10096952 | 3300026075 | Bacteria | 2279 |
| 257 | Ga0207708_10148086 | 3300026075 | Bacteria | 1846 |
| 258 | Ga0207702_10025636 | 3300026078 | Bacteria | 4894 |
| 259 | Ga0207702_10244294 | 3300026078 | Bacteria | 1683 |
| 260 | Ga0207641_10244509 | 3300026088 | Bacteria | 1673 |
| 261 | Ga0207648_10000369 | 3300026089 | Bacteria | 49386 |
| 262 | Ga0207648_10023397 | 3300026089 | Bacteria | 5534 |
| 263 | Ga0207676_10200633 | 3300026095 | Bacteria | 1762 |
| 264 | Ga0207676_10532363 | 3300026095 | Bacteria | 1120 |
| 265 | Ga0207674_10209799 | 3300026116 | Bacteria | 1897 |
| 266 | Ga0207675_100002170 | 3300026118 | Bacteria | 19503 |
| 267 | Ga0207675_100004506 | 3300026118 | Bacteria | 13456 |
| 268 | Ga0207675_100115848 | 3300026118 | Bacteria | 2532 |
| 269 | Ga0207683_10323175 | 3300026121 | Bacteria | 1413 |
| 270 | Ga0207698_10204440 | 3300026142 | Bacteria | 1771 |
| 271 | Ga0209967_1031423 | 3300027364 | Bacteria | 795 |
| 272 | Ga0209981_1010714 | 3300027378 | Unclassified | 1260 |
| 273 | Ga0209996_1011418 | 3300027395 | Unclassified | 1186 |
| 274 | Ga0210000_1019025 | 3300027462 | Unclassified | 1045 |
| 275 | Ga0209995_1036755 | 3300027471 | Unclassified | 824 |
| 276 | Ga0209999_1078219 | 3300027543 | Unclassified | 637 |
| 277 | Ga0209999_1113388 | 3300027543 | Unclassified | 530 |
| 278 | Ga0209982_1058843 | 3300027552 | Unclassified | 624 |
| 279 | Ga0209588_1009181 | 3300027671 | Bacteria | 2949 |
| 280 | Ga0209588_1044313 | 3300027671 | Bacteria | 1439 |
| 281 | Ga0209971_1002369 | 3300027682 | Bacteria | 4549 |
| 282 | Ga0209966_1065575 | 3300027695 | Unclassified | 790 |
| 283 | Ga0209974_10021186 | 3300027876 | Bacteria | 2153 |
| 284 | Ga0207428_10056581 | 3300027907 | Bacteria | 3116 |
| 285 | Ga0207428_10197767 | 3300027907 | Unclassified | 1513 |
| 286 | Ga0268265_10001333 | 3300028380 | Bacteria | 21108 |
| 287 | Ga0268265_10292366 | 3300028380 | Unclassified | 1463 |
| 288 | Ga0268264_10001450 | 3300028381 | Bacteria | 22200 |
| 289 | Ga0307408_100035927 | 3300031548 | Bacteria | 3480 |
| 290 | Ga0307408_100700443 | 3300031548 | Bacteria | 910 |
| 291 | Ga0307405_10450637 | 3300031731 | Bacteria | 1020 |
| 292 | Ga0307410_10327131 | 3300031852 | Bacteria | 1218 |
| 293 | Ga0307407_10207850 | 3300031903 | Bacteria | 1316 |
| 294 | Ga0307409_101135992 | 3300031995 | Unclassified | 803 |
| 295 | Ga0307416_100034206 | 3300032002 | Bacteria | 3864 |
| 296 | Ga0307416_100165906 | 3300032002 | Bacteria | 2048 |
| 297 | Ga0307411_10450218 | 3300032005 | Bacteria | 1077 |
| 298 | Ga0373930_0004645 | 3300034816 | Bacteria | 2247 |
| 299 | Ga0373948_0008200 | 3300034817 | Bacteria | 1774 |
| 300 | Ga0373950_0002063 | 3300034818 | Bacteria | 2724 |
| 301 | Ga0373958_0008124 | 3300034819 | Unclassified | 1692 |
| 302 | Ga0373959_0005159 | 3300034820 | Bacteria | 2138 |
| 303 | Ga0373928_0002841 | 3300035084 | Bacteria | 3338 |
| 304 | Ga0373929_0008161 | 3300035085 | Bacteria | 1927 |
| 305 | Ga0373940_0017306 | 3300035088 | Bacteria | 1796 |
| 306 | Ga0373944_0011272 | 3300035089 | Bacteria | 2446 |
| 307 | Ga0373949_0020097 | 3300035090 | Bacteria | 1526 |
| 308 | Ga0373952_0249653 | 3300035092 | Bacteria | 537 |
| 309 | Ga0373923_0387169 | 3300035111 | Unclassified | 671 |
| 310 | Ga0373932_0250153 | 3300035112 | Unclassified | 646 |
| 311 | Ga0373939_0000843 | 3300035114 | Bacteria | 7604 |
| 312 | Ga0373941_0076758 | 3300035115 | Bacteria | 1120 |
| 313 | Ga0373945_0000803 | 3300035116 | Bacteria | 9198 |
| 314 | Ga0373953_0019607 | 3300035117 | Bacteria | 2518 |
| 315 | Ga0373954_0000025 | 3300035118 | Bacteria | 57365 |
| 316 | Ga0373954_0468917 | 3300035118 | Bacteria | 624 |
| 317 | Ga0373957_0416913 | 3300035120 | Unclassified | 579 |
| 318 | Ga0373960_0081733 | 3300035121 | Bacteria | 1018 |
| 319 | Ga0373943_0017959 | 3300035170 | Bacteria | 3244 |
| 320 | Ga0373943_0043183 | 3300035170 | Bacteria | 2188 |
| 321 | Ga0373955_0090708 | 3300035172 | Bacteria | 1741 |
| 322 | Ga0373942_0017248 | 3300035207 | Bacteria | 1778 |
| 323 | Ga0373942_0024601 | 3300035207 | Bacteria | 1545 |
| 324 | Ga0373942_0116589 | 3300035207 | Bacteria | 831 |
| 325 | Ga0373961_0033576 | 3300035241 | Unclassified | 1446 |
| 326 | Ga0373962_0045832 | 3300035242 | Unclassified | 1246 |
| 327 | Ga0373962_0097040 | 3300035242 | Bacteria | 915 |
| 328 | Ga0373924_0025146 | 3300035410 | Bacteria | 2352 |
| 329 | Ga0373931_0000757 | 3300035691 | Bacteria | 13493 |
| 330 | Ga0373931_0030990 | 3300035691 | Bacteria | 2756 |
| 331 | Ga0373931_0902126 | 3300035691 | Bacteria | 594 |
| 332 | Ga0373935_0084677 | 3300035692 | Unclassified | 2065 |
| 333 | Ga0373927_0004507 | 3300035695 | Bacteria | 9742 |
| 334 | Ga0373933_0009587 | 3300035724 | Bacteria | 5287 |
| 335 | Ga0373947_0023879 | 3300035725 | Bacteria | 3559 |
| 336 | Ga0373947_0065372 | 3300035725 | Bacteria | 2218 |
| 337 | Ga0373937_0000296 | 3300036401 | Bacteria | 47231 |
| 338 | Ga0373937_0420667 | 3300036401 | Bacteria | 1268 |
| 339 | Ga0373925_0084870 | 3300037068 | Bacteria | 2413 |
| 340 | Ga0373925_0144241 | 3300037068 | Bacteria | 1865 |
| 341 | Ga0439453_0006709 | 3300041408 | Bacteria | 1804 |
| 342 | Ga0451798_0434765 | 3300041458 | Unclassified | 1006 |
| 343 | Ga0439441_002673 | 3300042001 | Bacteria | 2535 |
| 344 | Ga0439441_002805 | 3300042001 | Bacteria | 2493 |
| 345 | Ga0439441_075627 | 3300042001 | Bacteria | 727 |
| 346 | Ga0439443_001850 | 3300042003 | Bacteria | 2433 |
| 347 | Ga0439443_003516 | 3300042003 | Bacteria | 1980 |
| 348 | Ga0450912_001908 | 3300042116 | Bacteria | 1340 |
| 349 | Ga0439435_0001098 | 3300042436 | Bacteria | 4820 |
| 350 | Ga0439435_0115476 | 3300042436 | Bacteria | 836 |
| 351 | Ga0439444_0013279 | 3300042437 | Bacteria | 1362 |
| 352 | Ga0439464_0029632 | 3300042439 | Bacteria | 1530 |
| 353 | Ga0439460_0002280 | 3300042461 | Bacteria | 4618 |
| 354 | Ga0439440_0122219 | 3300042993 | Unclassified | 726 |
| 355 | Ga0453683_0301783 | 3300044673 | Bacteria | 1025 |
| 356 | Ga0451576_0019708 | 3300045051 | Bacteria | 7361 |
| 357 | Ga0451576_0086242 | 3300045051 | Bacteria | 3265 |
| 358 | Ga0451576_0413739 | 3300045051 | Bacteria | 1414 |
| 359 | Ga0451576_1709527 | 3300045051 | Bacteria | 651 |
| 360 | Ga0495592_0054986 | 3300046454 | Bacteria | 2946 |
| 361 | Ga0495592_0245129 | 3300046454 | Bacteria | 1187 |
| 362 | Ga0495603_0002444 | 3300046455 | Bacteria | 10930 |
| 363 | Ga0495580_0014828 | 3300046472 | Bacteria | 5906 |
| 364 | Ga0495582_0214431 | 3300046473 | Unclassified | 1101 |
| 365 | Ga0495639_0284630 | 3300046475 | Unclassified | 822 |
| 366 | Ga0495662_0042761 | 3300046476 | Bacteria | 2187 |
| 367 | Ga0495662_0112671 | 3300046476 | Bacteria | 1333 |
| 368 | Ga0495594_0088660 | 3300046499 | Bacteria | 1732 |
| 369 | Ga0495608_0003114 | 3300046511 | Bacteria | 11849 |
| 370 | Ga0495608_0268199 | 3300046511 | Unclassified | 1062 |
| 371 | Ga0495618_0241270 | 3300046514 | Bacteria | 1136 |
| 372 | Ga0495628_0003126 | 3300046516 | Bacteria | 14870 |
| 373 | Ga0495628_0252454 | 3300046516 | Bacteria | 1316 |
| 374 | Ga0495630_0093151 | 3300046517 | Bacteria | 2277 |
| 375 | Ga0495630_0235832 | 3300046517 | Unclassified | 1398 |
| 376 | Ga0495630_0255696 | 3300046517 | Bacteria | 1338 |
| 377 | Ga0495632_0341681 | 3300046519 | Bacteria | 659 |
| 378 | Ga0495666_0012596 | 3300046526 | Bacteria | 4215 |
| 379 | Ga0495666_0031611 | 3300046526 | Bacteria | 2593 |
| 380 | Ga0495640_0026929 | 3300046533 | Bacteria | 4149 |
| 381 | Ga0495640_0161317 | 3300046533 | Bacteria | 1436 |
| 382 | Ga0495586_0002520 | 3300046535 | Bacteria | 9923 |
| 383 | Ga0495586_0007991 | 3300046535 | Bacteria | 5643 |
| 384 | Ga0495586_0084587 | 3300046535 | Bacteria | 1746 |
| 385 | Ga0495587_0304803 | 3300046536 | Bacteria | 890 |
| 386 | Ga0495587_0816520 | 3300046536 | Bacteria | 509 |
| 387 | Ga0495598_0014252 | 3300046537 | Bacteria | 1986 |
| 388 | Ga0495621_0121421 | 3300046539 | Unclassified | 1010 |
| 389 | Ga0495621_0127489 | 3300046539 | Bacteria | 988 |
| 390 | Ga0495621_0136267 | 3300046539 | Bacteria | 958 |
| 391 | Ga0495667_0711713 | 3300046559 | Bacteria | 622 |
| 392 | Ga0495656_0095620 | 3300046615 | Bacteria | 1366 |
| 393 | Ga0495634_0015948 | 3300046642 | Bacteria | 5382 |
| 394 | Ga0495634_0019528 | 3300046642 | Bacteria | 4814 |
| 395 | Ga0495599_0192532 | 3300046678 | Bacteria | 1254 |
| 396 | Ga0495623_0341826 | 3300046679 | Bacteria | 817 |
| 397 | Ga0495647_0008364 | 3300046681 | Bacteria | 3477 |
| 398 | Ga0495647_0080515 | 3300046681 | Bacteria | 1320 |
| 399 | Ga0495658_0016177 | 3300046683 | Bacteria | 3839 |
| 400 | Ga0495658_0126672 | 3300046683 | Bacteria | 1550 |
| 401 | Ga0495669_0212004 | 3300046684 | Bacteria | 927 |
| 402 | Ga0495613_0502523 | 3300046689 | Unclassified | 816 |
| 403 | Ga0495624_0071460 | 3300046690 | Bacteria | 2159 |
| 404 | Ga0495624_0171823 | 3300046690 | Bacteria | 1322 |
| 405 | Ga0495600_0017655 | 3300046809 | Bacteria | 4540 |
| 406 | Ga0495581_0054153 | 3300047315 | Bacteria | 2316 |
| 407 | Ga0495581_0196768 | 3300047315 | Bacteria | 1179 |
| 408 | Ga0495604_0012460 | 3300047317 | Bacteria | 6763 |
| 409 | Ga0495604_0507987 | 3300047317 | Bacteria | 781 |
| 410 | Ga0495636_0003637 | 3300047318 | Bacteria | 5986 |
| 411 | Ga0495636_0410717 | 3300047318 | Unclassified | 646 |
| 412 | Ga0495674_0302768 | 3300047319 | Unclassified | 1305 |
| 413 | Ga0495676_0033938 | 3300047321 | Bacteria | 4288 |
| 414 | Ga0495680_0001252 | 3300047322 | Bacteria | 27832 |
| 415 | Ga0495675_0344130 | 3300047444 | Bacteria | 878 |
| 416 | Ga0495675_0458868 | 3300047444 | Bacteria | 736 |
| 417 | Ga0495593_0129245 | 3300047673 | Bacteria | 1283 |
| 418 | Ga0495593_0443864 | 3300047673 | Unclassified | 649 |
| 419 | Ga0496102_1191361 | 3300048905 | Unclassified | 681 |
| 420 | Ga0496104_1336030 | 3300048907 | Bacteria | 620 |
| 421 | Ga0496108_1011850 | 3300048911 | Bacteria | 709 |
| 422 | Ga0496110_0480501 | 3300048913 | Bacteria | 1132 |
| 423 | Ga0496111_0177314 | 3300048914 | Bacteria | 1584 |
| 424 | Ga0501031_0128239 | 3300049568 | Bacteria | 1657 |
| 425 | Ga0501031_0315176 | 3300049568 | Bacteria | 1013 |
| 426 | Ga0501032_0135795 | 3300049569 | Bacteria | 1621 |
| 427 | Ga0501033_0006483 | 3300049570 | Bacteria | 9157 |
| 428 | Ga0501033_0064748 | 3300049570 | Bacteria | 2690 |
| 429 | Ga0501033_0176408 | 3300049570 | Bacteria | 1533 |
| 430 | Ga0501034_0228161 | 3300049571 | Bacteria | 1812 |
| 431 | Ga0501036_0001252 | 3300049572 | Bacteria | 19463 |
| 432 | Ga0501036_0139919 | 3300049572 | Bacteria | 2042 |
| 433 | Ga0501036_0153867 | 3300049572 | Bacteria | 1940 |
| 434 | Ga0501036_0260633 | 3300049572 | Bacteria | 1452 |
| 435 | Ga0501036_0487825 | 3300049572 | Bacteria | 1026 |
| 436 | Ga0501036_1682518 | 3300049572 | Bacteria | 511 |
| 437 | Ga0501037_0059065 | 3300049573 | Bacteria | 2798 |
| 438 | Ga0501038_0001280 | 3300049574 | Bacteria | 22839 |
| 439 | Ga0501038_0162383 | 3300049574 | Bacteria | 1814 |
| 440 | Ga0501038_0224201 | 3300049574 | Unclassified | 1499 |
| 441 | Ga0501038_0501590 | 3300049574 | Bacteria | 928 |
| 442 | Ga0501038_0606154 | 3300049574 | Bacteria | 828 |
| 443 | Ga0501039_0003867 | 3300049575 | Bacteria | 11243 |
| 444 | Ga0501039_0011180 | 3300049575 | Bacteria | 6839 |
| 445 | Ga0501039_0068920 | 3300049575 | Bacteria | 2746 |
| 446 | Ga0501039_0130960 | 3300049575 | Bacteria | 1969 |
| 447 | Ga0501039_0162058 | 3300049575 | Bacteria | 1758 |
| 448 | Ga0501040_0000052 | 3300049576 | Bacteria | 54195 |
| 449 | Ga0501040_0014654 | 3300049576 | Bacteria | 5170 |
| 450 | Ga0501040_0040385 | 3300049576 | Bacteria | 3175 |
| 451 | Ga0501040_0137477 | 3300049576 | Bacteria | 1720 |
| 452 | Ga0501040_1072328 | 3300049576 | Unclassified | 584 |
| 453 | Ga0501041_0004912 | 3300049577 | Bacteria | 7767 |
| 454 | Ga0501041_0007062 | 3300049577 | Bacteria | 6589 |
| 455 | Ga0501041_0021075 | 3300049577 | Bacteria | 3904 |
| 456 | Ga0501041_0048287 | 3300049577 | Bacteria | 2592 |
| 457 | Ga0501041_0133537 | 3300049577 | Bacteria | 1546 |
| 458 | Ga0501041_0332119 | 3300049577 | Unclassified | 960 |
| 459 | Ga0501041_0385927 | 3300049577 | Bacteria | 886 |
| 460 | Ga0501041_0634247 | 3300049577 | Unclassified | 683 |
| 461 | Ga0501042_0000048 | 3300049578 | Bacteria | 40877 |
| 462 | Ga0501042_0082936 | 3300049578 | Bacteria | 2298 |
| 463 | Ga0501042_0089138 | 3300049578 | Bacteria | 2213 |
| 464 | Ga0501042_0098856 | 3300049578 | Bacteria | 2098 |
| 465 | Ga0501042_0254314 | 3300049578 | Bacteria | 1268 |
| 466 | Ga0501042_0375749 | 3300049578 | Bacteria | 1029 |
| 467 | Ga0501042_0388668 | 3300049578 | Bacteria | 1010 |
| 468 | Ga0501042_1145217 | 3300049578 | Bacteria | 567 |
| 469 | Ga0501043_0267785 | 3300049579 | Bacteria | 1312 |
| 470 | Ga0501043_0888998 | 3300049579 | Unclassified | 639 |
| 471 | Ga0501046_0000271 | 3300049580 | Bacteria | 52841 |
| 472 | Ga0501046_0033342 | 3300049580 | Bacteria | 4162 |
| 473 | Ga0501046_0169694 | 3300049580 | Unclassified | 1638 |
| 474 | Ga0501046_0299664 | 3300049580 | Bacteria | 1174 |
| 475 | Ga0501046_0320880 | 3300049580 | Bacteria | 1129 |
| 476 | Ga0501046_0820828 | 3300049580 | Bacteria | 651 |
| 477 | Ga0501047_0968679 | 3300049581 | Unclassified | 664 |
| 478 | Ga0501047_1116506 | 3300049581 | Unclassified | 602 |
| 479 | Ga0501048_0001409 | 3300049582 | Bacteria | 18204 |
| 480 | Ga0501048_0012758 | 3300049582 | Bacteria | 6248 |
| 481 | Ga0501048_0075515 | 3300049582 | Bacteria | 2378 |
| 482 | Ga0501048_0107314 | 3300049582 | Bacteria | 1971 |
| 483 | Ga0501048_0191710 | 3300049582 | Bacteria | 1448 |
| 484 | Ga0501048_0242220 | 3300049582 | Bacteria | 1280 |
| 485 | Ga0501068_0001255 | 3300049584 | Bacteria | 13472 |
| 486 | Ga0501068_0244803 | 3300049584 | Bacteria | 1142 |
| 487 | Ga0501069_0237927 | 3300049585 | Unclassified | 1061 |
| 488 | Ga0501070_0050478 | 3300049586 | Bacteria | 3454 |
| 489 | Ga0501070_1032761 | 3300049586 | Bacteria | 636 |
| 490 | Ga0501070_1057055 | 3300049586 | Bacteria | 628 |
| 491 | Ga0501070_1122520 | 3300049586 | Bacteria | 606 |
| 492 | Ga0501071_0004018 | 3300049587 | Bacteria | 9285 |
| 493 | Ga0501071_0042588 | 3300049587 | Bacteria | 3254 |
| 494 | Ga0501071_0171196 | 3300049587 | Bacteria | 1625 |
| 495 | Ga0501071_0235177 | 3300049587 | Bacteria | 1381 |
| 496 | Ga0501071_0373149 | 3300049587 | Bacteria | 1087 |
| 497 | Ga0501071_0536636 | 3300049587 | Bacteria | 898 |
| 498 | Ga0501072_0003349 | 3300049588 | Bacteria | 12056 |
| 499 | Ga0501072_0007259 | 3300049588 | Bacteria | 8408 |
| 500 | Ga0501072_0077568 | 3300049588 | Bacteria | 2630 |
| 501 | Ga0501072_0295779 | 3300049588 | Bacteria | 1287 |
| 502 | Ga0501072_0382906 | 3300049588 | Bacteria | 1116 |
| 503 | Ga0501072_0463748 | 3300049588 | Bacteria | 1003 |
| 504 | Ga0501072_0505204 | 3300049588 | Unclassified | 956 |
| 505 | Ga0501072_0567784 | 3300049588 | Bacteria | 895 |
| 506 | Ga0501073_0292830 | 3300049589 | Bacteria | 1123 |
| 507 | Ga0501074_0185062 | 3300049590 | Bacteria | 1485 |
| 508 | Ga0501074_0596145 | 3300049590 | Bacteria | 781 |
| 509 | Ga0501075_0000751 | 3300049591 | Bacteria | 20223 |
| 510 | Ga0501075_0001243 | 3300049591 | Bacteria | 16533 |
| 511 | Ga0501075_0004209 | 3300049591 | Bacteria | 9719 |
| 512 | Ga0501075_0006255 | 3300049591 | Bacteria | 8186 |
| 513 | Ga0501075_0318341 | 3300049591 | Bacteria | 1185 |
| 514 | Ga0501075_0370922 | 3300049591 | Bacteria | 1091 |
| 515 | Ga0501076_0000290 | 3300049592 | Bacteria | 31327 |
| 516 | Ga0501076_0004123 | 3300049592 | Bacteria | 10278 |
| 517 | Ga0501076_0006671 | 3300049592 | Bacteria | 8374 |
| 518 | Ga0501076_0049968 | 3300049592 | Bacteria | 3308 |
| 519 | Ga0501076_0422233 | 3300049592 | Bacteria | 1097 |
| 520 | Ga0501076_0446732 | 3300049592 | Bacteria | 1064 |
| 521 | Ga0501077_0013249 | 3300049593 | Bacteria | 5167 |
| 522 | Ga0501077_0075065 | 3300049593 | Bacteria | 2141 |
| 523 | Ga0501077_0130649 | 3300049593 | Unclassified | 1592 |
| 524 | Ga0501077_0194241 | 3300049593 | Unclassified | 1289 |
| 525 | Ga0501077_0214809 | 3300049593 | Bacteria | 1222 |
| 526 | Ga0501077_0387852 | 3300049593 | Bacteria | 892 |
| 527 | Ga0501217_268940 | 3300049661 | Bacteria | 555 |
| 528 | Ga0501079_0000061 | 3300049741 | Bacteria | 48925 |
| 529 | Ga0501079_0007164 | 3300049741 | Bacteria | 8418 |
| 530 | Ga0501079_0008802 | 3300049741 | Bacteria | 7649 |
| 531 | Ga0501079_0263103 | 3300049741 | Bacteria | 1348 |
| 532 | Ga0501080_0023332 | 3300049742 | Bacteria | 5737 |
| 533 | Ga0501080_0072729 | 3300049742 | Bacteria | 3199 |
| 534 | Ga0501080_0093367 | 3300049742 | Bacteria | 2794 |
| 535 | Ga0501080_0189211 | 3300049742 | Bacteria | 1892 |
| 536 | Ga0501080_0718718 | 3300049742 | Bacteria | 880 |
| 537 | Ga0501081_0000110 | 3300049743 | Bacteria | 34989 |
| 538 | Ga0501081_0017440 | 3300049743 | Bacteria | 4752 |
| 539 | Ga0501081_0019693 | 3300049743 | Bacteria | 4495 |
| 540 | Ga0501081_0138525 | 3300049743 | Bacteria | 1743 |
| 541 | Ga0501081_0180246 | 3300049743 | Bacteria | 1528 |
| 542 | Ga0501083_0062766 | 3300049744 | Bacteria | 2479 |
| 543 | Ga0501083_0288170 | 3300049744 | Bacteria | 1068 |
| 544 | Ga0501035_0025479 | 3300049822 | Bacteria | 5422 |
| 545 | Ga0501035_0064885 | 3300049822 | Bacteria | 3244 |
| 546 | Ga0501045_0002891 | 3300049824 | Bacteria | 11734 |
| 547 | Ga0501045_0003109 | 3300049824 | Bacteria | 11349 |
| 548 | Ga0501045_0046875 | 3300049824 | Bacteria | 3147 |
| 549 | Ga0501045_0421884 | 3300049824 | Bacteria | 992 |
| 550 | Ga0501045_0584635 | 3300049824 | Unclassified | 827 |
| 551 | Ga0501045_0876077 | 3300049824 | Bacteria | 660 |
| 552 | Ga0501045_1180477 | 3300049824 | Unclassified | 559 |
| 553 | nmdc:mga05p37_158605_c1 | 3300050507 | Bacteria | 2764 |
| 554 | nmdc:mga05p37_182086_c1 | 3300050507 | Bacteria | 2555 |
| 555 | nmdc:mga05p37_822026_c1 | 3300050507 | Bacteria | 1013 |
| 556 | nmdc:mga09592_1286525_c1 | 3300050508 | Bacteria | 602 |
| 557 | nmdc:mga09592_308869_c1 | 3300050508 | Bacteria | 1371 |
| 558 | nmdc:mga09592_840078_c1 | 3300050508 | Bacteria | 775 |
| 559 | nmdc:mga0qj67_12428_c1 | 3300050509 | Bacteria | 6414 |
| 560 | nmdc:mga0qj67_38378_c1 | 3300050509 | Bacteria | 3757 |
| 561 | nmdc:mga0qj67_429707_c1 | 3300050509 | Bacteria | 1065 |
| 562 | nmdc:mga0qj67_606262_c1 | 3300050509 | Bacteria | 876 |
| 563 | nmdc:mga0qj67_869443_c1 | 3300050509 | Unclassified | 711 |
| 564 | nmdc:mga06r32_244463_c1 | 3300050510 | Bacteria | 1782 |
| 565 | nmdc:mga06r32_306953_c1 | 3300050510 | Unclassified | 1572 |
| 566 | nmdc:mga06r32_417511_c1 | 3300050510 | Bacteria | 1323 |
| 567 | nmdc:mga06r32_539078_c1 | 3300050510 | Unclassified | 1142 |
| 568 | nmdc:mga08y16_122930_c1 | 3300050511 | Bacteria | 2701 |
| 569 | nmdc:mga08y16_165342_c1 | 3300050511 | Bacteria | 2299 |
| 570 | nmdc:mga08y16_291646_c1 | 3300050511 | Bacteria | 1682 |
| 571 | nmdc:mga08y16_508132_c1 | 3300050511 | Bacteria | 1224 |
| 572 | nmdc:mga08y16_58516_c1 | 3300050511 | Bacteria | 4027 |
| 573 | nmdc:mga0n895_12822_c1 | 3300050512 | Bacteria | 7531 |
| 574 | nmdc:mga0n895_332827_c1 | 3300050512 | Unclassified | 1538 |
| 575 | nmdc:mga0n895_42989_c1 | 3300050512 | Bacteria | 4400 |
| 576 | nmdc:mga0n895_637378_c1 | 3300050512 | Unclassified | 1065 |
| 577 | nmdc:mga0rr50_23642_c1 | 3300050513 | Bacteria | 4242 |
| 578 | nmdc:mga0rr50_440041_c1 | 3300050513 | Bacteria | 1104 |
| 579 | nmdc:mga0rr50_73863_c1 | 3300050513 | Bacteria | 2608 |
| 580 | nmdc:mga08x19_5960_c1 | 3300050514 | Bacteria | 7209 |
| 581 | nmdc:mga0a205_1704_c1 | 3300050515 | Bacteria | 18985 |
| 582 | nmdc:mga0a205_376390_c1 | 3300050515 | Bacteria | 1285 |
| 583 | Ga0495601_0186945 | 3300053077 | Bacteria | 1354 |
| 584 | Ga0501084_0001172 | 3300054114 | Bacteria | 20445 |
| 585 | Ga0501084_0077254 | 3300054114 | Bacteria | 2791 |
| 586 | Ga0501084_0568026 | 3300054114 | Bacteria | 958 |
| 587 | Ga0501084_0786754 | 3300054114 | Unclassified | 801 |
| 588 | Ga0590071_012766 | 3300059421 | Bacteria | 1969 |
| 589 | Ga0501082_0000430 | 3300060353 | Bacteria | 37227 |
| 590 | Ga0501082_0006714 | 3300060353 | Bacteria | 9953 |
| 591 | Ga0501082_0065190 | 3300060353 | Bacteria | 3137 |
| 592 | Ga0501082_0525503 | 3300060353 | Bacteria | 1034 |
| 593 | Ga0501082_1081139 | 3300060353 | Bacteria | 701 |
| 594 | Ga0530510_0000048 | 3300061734 | Bacteria | 56268 |
| 595 | Ga0530510_0000186 | 3300061734 | Bacteria | 37940 |
| 596 | Ga0530510_0078101 | 3300061734 | Bacteria | 2406 |
| 597 | Ga0530510_0924785 | 3300061734 | Bacteria | 667 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005844 | Ga0068862_100117691 | Ga0068862_1001176912 | 107 |
| 2 | 3300009553 | Ga0105249_10653902 | Ga0105249_106539023 | 107 |
| 3 | 3300013306 | Ga0163162_10048344 | Ga0163162_100483448 | 107 |
| 4 | 3300028380 | Ga0268265_10292366 | Ga0268265_102923661 | 107 |
| 5 | 3300006846 | Ga0075430_100398811 | Ga0075430_1003988112 | 122 |
| 6 | 3300006846 | Ga0075430_100527181 | Ga0075430_1005271812 | 122 |
| 7 | 3300006847 | Ga0075431_100124186 | Ga0075431_1001241863 | 122 |
| 8 | 3300006880 | Ga0075429_100769259 | Ga0075429_1007692592 | 122 |
| 9 | 3300009147 | Ga0114129_10205743 | Ga0114129_102057433 | 122 |
| 10 | 3300027364 | Ga0209967_1031423 | Ga0209967_10314232 | 122 |
| 11 | 3300027378 | Ga0209981_1010714 | Ga0209981_10107142 | 122 |
| 12 | 3300027395 | Ga0209996_1011418 | Ga0209996_10114182 | 122 |
| 13 | 3300027471 | Ga0209995_1036755 | Ga0209995_10367552 | 122 |
| 14 | 3300027552 | Ga0209982_1058843 | Ga0209982_10588432 | 122 |
| 15 | 3300027682 | Ga0209971_1002369 | Ga0209971_10023694 | 122 |
| 16 | 3300027876 | Ga0209974_10021186 | Ga0209974_100211861 | 122 |
| 17 | 3300041408 | Ga0439453_0006709 | Ga0439453_0006709_690_1058 | 122 |
| 18 | 3300042001 | Ga0439441_002673 | Ga0439441_002673_463_831 | 122 |
| 19 | 3300042003 | Ga0439443_003516 | Ga0439443_003516_121_489 | 122 |
| 20 | 3300042436 | Ga0439435_0115476 | Ga0439435_0115476_452_820 | 122 |
| 21 | 3300050507 | nmdc:mga05p37_182086_c1 | nmdc:mga05p37_182086_c1_516_884 | 122 |
| 22 | 3300050509 | nmdc:mga0qj67_429707_c1 | nmdc:mga0qj67_429707_c1_318_686 | 122 |
| 23 | 3300050510 | nmdc:mga06r32_539078_c1 | nmdc:mga06r32_539078_c1_177_545 | 122 |
| 24 | 3300005330 | Ga0070690_100865050 | Ga0070690_1008650502 | 123 |
| 25 | 3300005354 | Ga0070675_101166531 | Ga0070675_1011665312 | 123 |
| 26 | 3300005364 | Ga0070673_100205175 | Ga0070673_1002051754 | 123 |
| 27 | 3300005444 | Ga0070694_100085942 | Ga0070694_1000859423 | 123 |
| 28 | 3300005459 | Ga0068867_100853816 | Ga0068867_1008538162 | 123 |
| 29 | 3300005536 | Ga0070697_100212412 | Ga0070697_1002124123 | 123 |
| 30 | 3300005545 | Ga0070695_100527046 | Ga0070695_1005270462 | 123 |
| 31 | 3300005545 | Ga0070695_100573069 | Ga0070695_1005730692 | 123 |
| 32 | 3300005546 | Ga0070696_100376353 | Ga0070696_1003763531 | 123 |
| 33 | 3300005549 | Ga0070704_100626626 | Ga0070704_1006266262 | 123 |
| 34 | 3300005617 | Ga0068859_101701454 | Ga0068859_1017014542 | 123 |
| 35 | 3300005844 | Ga0068862_100973274 | Ga0068862_1009732742 | 123 |
| 36 | 3300006237 | Ga0097621_101053829 | Ga0097621_1010538292 | 123 |
| 37 | 3300006871 | Ga0075434_100203175 | Ga0075434_1002031753 | 123 |
| 38 | 3300006871 | Ga0075434_100658967 | Ga0075434_1006589673 | 123 |
| 39 | 3300006871 | Ga0075434_101803343 | Ga0075434_1018033432 | 123 |
| 40 | 3300006931 | Ga0097620_101701404 | Ga0097620_1017014042 | 123 |
| 41 | 3300009094 | Ga0111539_10066729 | Ga0111539_100667293 | 123 |
| 42 | 3300014325 | Ga0163163_12178762 | Ga0163163_121787621 | 123 |
| 43 | 3300025936 | Ga0207670_10049001 | Ga0207670_100490014 | 123 |
| 44 | 3300025939 | Ga0207665_10567099 | Ga0207665_105670992 | 123 |
| 45 | 3300025960 | Ga0207651_10075140 | Ga0207651_100751405 | 123 |
| 46 | 3300026095 | Ga0207676_10532363 | Ga0207676_105323633 | 123 |
| 47 | 3300027543 | Ga0209999_1113388 | Ga0209999_11133882 | 123 |
| 48 | 3300035111 | Ga0373923_0387169 | Ga0373923_0387169_57_428 | 123 |
| 49 | 3300035117 | Ga0373953_0019607 | Ga0373953_0019607_1691_2062 | 123 |
| 50 | 3300035118 | Ga0373954_0000025 | Ga0373954_0000025_1281_1652 | 123 |
| 51 | 3300035120 | Ga0373957_0416913 | Ga0373957_0416913_69_440 | 123 |
| 52 | 3300035172 | Ga0373955_0090708 | Ga0373955_0090708_1089_1460 | 123 |
| 53 | 3300035410 | Ga0373924_0025146 | Ga0373924_0025146_1290_1661 | 123 |
| 54 | 3300035724 | Ga0373933_0009587 | Ga0373933_0009587_4080_4451 | 123 |
| 55 | 3300036401 | Ga0373937_0000296 | Ga0373937_0000296_32304_32675 | 123 |
| 56 | 3300041458 | Ga0451798_0434765 | Ga0451798_0434765_105_476 | 123 |
| 57 | 3300044673 | Ga0453683_0301783 | Ga0453683_0301783_40_411 | 123 |
| 58 | 3300045051 | Ga0451576_0413739 | Ga0451576_0413739_743_1114 | 123 |
| 59 | 3300046454 | Ga0495592_0054986 | Ga0495592_0054986_1932_2303 | 123 |
| 60 | 3300046475 | Ga0495639_0284630 | Ga0495639_0284630_310_681 | 123 |
| 61 | 3300046476 | Ga0495662_0042761 | Ga0495662_0042761_635_1006 | 123 |
| 62 | 3300046476 | Ga0495662_0112671 | Ga0495662_0112671_221_592 | 123 |
| 63 | 3300046511 | Ga0495608_0003114 | Ga0495608_0003114_6206_6577 | 123 |
| 64 | 3300046511 | Ga0495608_0268199 | Ga0495608_0268199_462_833 | 123 |
| 65 | 3300046514 | Ga0495618_0241270 | Ga0495618_0241270_299_670 | 123 |
| 66 | 3300046516 | Ga0495628_0003126 | Ga0495628_0003126_13120_13491 | 123 |
| 67 | 3300046517 | Ga0495630_0093151 | Ga0495630_0093151_359_730 | 123 |
| 68 | 3300046517 | Ga0495630_0255696 | Ga0495630_0255696_352_723 | 123 |
| 69 | 3300046526 | Ga0495666_0031611 | Ga0495666_0031611_525_896 | 123 |
| 70 | 3300046533 | Ga0495640_0026929 | Ga0495640_0026929_3106_3477 | 123 |
| 71 | 3300046533 | Ga0495640_0161317 | Ga0495640_0161317_401_772 | 123 |
| 72 | 3300046535 | Ga0495586_0002520 | Ga0495586_0002520_639_1010 | 123 |
| 73 | 3300046535 | Ga0495586_0084587 | Ga0495586_0084587_604_975 | 123 |
| 74 | 3300046536 | Ga0495587_0304803 | Ga0495587_0304803_265_636 | 123 |
| 75 | 3300046536 | Ga0495587_0816520 | Ga0495587_0816520_100_471 | 123 |
| 76 | 3300046539 | Ga0495621_0136267 | Ga0495621_0136267_168_539 | 123 |
| 77 | 3300046642 | Ga0495634_0015948 | Ga0495634_0015948_2267_2638 | 123 |
| 78 | 3300046642 | Ga0495634_0019528 | Ga0495634_0019528_2903_3274 | 123 |
| 79 | 3300046681 | Ga0495647_0080515 | Ga0495647_0080515_512_883 | 123 |
| 80 | 3300046683 | Ga0495658_0126672 | Ga0495658_0126672_836_1207 | 123 |
| 81 | 3300046689 | Ga0495613_0502523 | Ga0495613_0502523_148_519 | 123 |
| 82 | 3300046690 | Ga0495624_0071460 | Ga0495624_0071460_736_1107 | 123 |
| 83 | 3300046690 | Ga0495624_0171823 | Ga0495624_0171823_746_1117 | 123 |
| 84 | 3300046809 | Ga0495600_0017655 | Ga0495600_0017655_2855_3226 | 123 |
| 85 | 3300047315 | Ga0495581_0196768 | Ga0495581_0196768_657_1028 | 123 |
| 86 | 3300047317 | Ga0495604_0012460 | Ga0495604_0012460_5750_6121 | 123 |
| 87 | 3300047317 | Ga0495604_0507987 | Ga0495604_0507987_145_516 | 123 |
| 88 | 3300047318 | Ga0495636_0003637 | Ga0495636_0003637_1123_1494 | 123 |
| 89 | 3300047319 | Ga0495674_0302768 | Ga0495674_0302768_777_1148 | 123 |
| 90 | 3300047322 | Ga0495680_0001252 | Ga0495680_0001252_21692_22063 | 123 |
| 91 | 3300047444 | Ga0495675_0344130 | Ga0495675_0344130_457_828 | 123 |
| 92 | 3300047673 | Ga0495593_0129245 | Ga0495593_0129245_664_1035 | 123 |
| 93 | 3300047673 | Ga0495593_0443864 | Ga0495593_0443864_22_393 | 123 |
| 94 | 3300050511 | nmdc:mga08y16_291646_c1 | nmdc:mga08y16_291646_c1_976_1347 | 123 |
| 95 | 3300050512 | nmdc:mga0n895_42989_c1 | nmdc:mga0n895_42989_c1_2706_3077 | 123 |
| 96 | 3300050512 | nmdc:mga0n895_637378_c1 | nmdc:mga0n895_637378_c1_392_763 | 123 |
| 97 | 3300050513 | nmdc:mga0rr50_440041_c1 | nmdc:mga0rr50_440041_c1_128_499 | 123 |
| 98 | 3300050513 | nmdc:mga0rr50_73863_c1 | nmdc:mga0rr50_73863_c1_1665_2036 | 123 |
| 99 | 3300053077 | Ga0495601_0186945 | Ga0495601_0186945_477_848 | 123 |
| 100 | 3300005345 | Ga0070692_10023013 | Ga0070692_100230133 | 124 |
| 101 | 3300005437 | Ga0070710_10536640 | Ga0070710_105366402 | 124 |
| 102 | 3300005440 | Ga0070705_100045456 | Ga0070705_1000454562 | 124 |
| 103 | 3300005444 | Ga0070694_100052420 | Ga0070694_1000524203 | 124 |
| 104 | 3300005546 | Ga0070696_100155071 | Ga0070696_1001550713 | 124 |
| 105 | 3300005549 | Ga0070704_100052885 | Ga0070704_1000528853 | 124 |
| 106 | 3300005615 | Ga0070702_100423905 | Ga0070702_1004239052 | 124 |
| 107 | 3300006846 | Ga0075430_100056622 | Ga0075430_1000566224 | 124 |
| 108 | 3300006847 | Ga0075431_100239197 | Ga0075431_1002391972 | 124 |
| 109 | 3300009147 | Ga0114129_11012575 | Ga0114129_110125752 | 124 |
| 110 | 3300049572 | Ga0501036_1682518 | Ga0501036_1682518_92_466 | 124 |
| 111 | 3300049586 | Ga0501070_1032761 | Ga0501070_1032761_205_579 | 124 |
| 112 | 3300049588 | Ga0501072_0505204 | Ga0501072_0505204_561_938 | 124 |
| 113 | 3300050507 | nmdc:mga05p37_822026_c1 | nmdc:mga05p37_822026_c1_238_612 | 124 |
| 114 | 3300050509 | nmdc:mga0qj67_12428_c1 | nmdc:mga0qj67_12428_c1_2200_2595 | 124 |
| 115 | 3300050510 | nmdc:mga06r32_244463_c1 | nmdc:mga06r32_244463_c1_906_1301 | 124 |
| 116 | 3300061734 | Ga0530510_0924785 | Ga0530510_0924785_211_585 | 124 |
| 117 | 3300005295 | Ga0065707_10350879 | Ga0065707_103508792 | 125 |
| 118 | 3300005328 | Ga0070676_10148336 | Ga0070676_101483362 | 125 |
| 119 | 3300005330 | Ga0070690_100011005 | Ga0070690_1000110052 | 125 |
| 120 | 3300005331 | Ga0070670_100595906 | Ga0070670_1005959062 | 125 |
| 121 | 3300005331 | Ga0070670_100917462 | Ga0070670_1009174621 | 125 |
| 122 | 3300005334 | Ga0068869_100001027 | Ga0068869_1000010272 | 125 |
| 123 | 3300005334 | Ga0068869_100050719 | Ga0068869_1000507193 | 125 |
| 124 | 3300005334 | Ga0068869_100067547 | Ga0068869_1000675472 | 125 |
| 125 | 3300005334 | Ga0068869_100087161 | Ga0068869_1000871613 | 125 |
| 126 | 3300005335 | Ga0070666_10172462 | Ga0070666_101724623 | 125 |
| 127 | 3300005336 | Ga0070680_100012102 | Ga0070680_1000121025 | 125 |
| 128 | 3300005336 | Ga0070680_100044924 | Ga0070680_1000449242 | 125 |
| 129 | 3300005338 | Ga0068868_100000169 | Ga0068868_1000001699 | 125 |
| 130 | 3300005338 | Ga0068868_101746724 | Ga0068868_1017467241 | 125 |
| 131 | 3300005340 | Ga0070689_100107883 | Ga0070689_1001078832 | 125 |
| 132 | 3300005340 | Ga0070689_100145621 | Ga0070689_1001456213 | 125 |
| 133 | 3300005340 | Ga0070689_100262685 | Ga0070689_1002626851 | 125 |
| 134 | 3300005341 | Ga0070691_10023775 | Ga0070691_100237753 | 125 |
| 135 | 3300005341 | Ga0070691_10029702 | Ga0070691_100297022 | 125 |
| 136 | 3300005341 | Ga0070691_10477266 | Ga0070691_104772662 | 125 |
| 137 | 3300005343 | Ga0070687_100000112 | Ga0070687_10000011230 | 125 |
| 138 | 3300005343 | Ga0070687_100058115 | Ga0070687_1000581153 | 125 |
| 139 | 3300005344 | Ga0070661_101006471 | Ga0070661_1010064711 | 125 |
| 140 | 3300005345 | Ga0070692_10000260 | Ga0070692_100002607 | 125 |
| 141 | 3300005353 | Ga0070669_100201390 | Ga0070669_1002013902 | 125 |
| 142 | 3300005353 | Ga0070669_100280704 | Ga0070669_1002807042 | 125 |
| 143 | 3300005354 | Ga0070675_100052510 | Ga0070675_1000525102 | 125 |
| 144 | 3300005354 | Ga0070675_101085039 | Ga0070675_1010850391 | 125 |
| 145 | 3300005356 | Ga0070674_101490659 | Ga0070674_1014906591 | 125 |
| 146 | 3300005364 | Ga0070673_100485666 | Ga0070673_1004856661 | 125 |
| 147 | 3300005364 | Ga0070673_100508007 | Ga0070673_1005080072 | 125 |
| 148 | 3300005365 | Ga0070688_100217086 | Ga0070688_1002170862 | 125 |
| 149 | 3300005365 | Ga0070688_100248287 | Ga0070688_1002482872 | 125 |
| 150 | 3300005406 | Ga0070703_10003990 | Ga0070703_100039903 | 125 |
| 151 | 3300005438 | Ga0070701_10000840 | Ga0070701_100008403 | 125 |
| 152 | 3300005438 | Ga0070701_10220157 | Ga0070701_102201572 | 125 |
| 153 | 3300005438 | Ga0070701_10414510 | Ga0070701_104145102 | 125 |
| 154 | 3300005439 | Ga0070711_100486724 | Ga0070711_1004867241 | 125 |
| 155 | 3300005439 | Ga0070711_101118454 | Ga0070711_1011184542 | 125 |
| 156 | 3300005440 | Ga0070705_100000991 | Ga0070705_10000099120 | 125 |
| 157 | 3300005440 | Ga0070705_100467373 | Ga0070705_1004673731 | 125 |
| 158 | 3300005441 | Ga0070700_100005957 | Ga0070700_1000059573 | 125 |
| 159 | 3300005441 | Ga0070700_100078017 | Ga0070700_1000780172 | 125 |
| 160 | 3300005441 | Ga0070700_100523958 | Ga0070700_1005239582 | 125 |
| 161 | 3300005444 | Ga0070694_100000608 | Ga0070694_1000006082 | 125 |
| 162 | 3300005444 | Ga0070694_100007608 | Ga0070694_1000076082 | 125 |
| 163 | 3300005444 | Ga0070694_100147677 | Ga0070694_1001476772 | 125 |
| 164 | 3300005444 | Ga0070694_100874122 | Ga0070694_1008741222 | 125 |
| 165 | 3300005456 | Ga0070678_100505942 | Ga0070678_1005059422 | 125 |
| 166 | 3300005457 | Ga0070662_100244832 | Ga0070662_1002448322 | 125 |
| 167 | 3300005458 | Ga0070681_10155515 | Ga0070681_101555153 | 125 |
| 168 | 3300005458 | Ga0070681_11435882 | Ga0070681_114358821 | 125 |
| 169 | 3300005459 | Ga0068867_100001181 | Ga0068867_10000118110 | 125 |
| 170 | 3300005467 | Ga0070706_101531988 | Ga0070706_1015319882 | 125 |
| 171 | 3300005518 | Ga0070699_100547711 | Ga0070699_1005477112 | 125 |
| 172 | 3300005530 | Ga0070679_100161927 | Ga0070679_1001619273 | 125 |
| 173 | 3300005536 | Ga0070697_100002931 | Ga0070697_1000029316 | 125 |
| 174 | 3300005536 | Ga0070697_101318485 | Ga0070697_1013184852 | 125 |
| 175 | 3300005543 | Ga0070672_100204208 | Ga0070672_1002042083 | 125 |
| 176 | 3300005543 | Ga0070672_100229637 | Ga0070672_1002296372 | 125 |
| 177 | 3300005544 | Ga0070686_100033276 | Ga0070686_1000332762 | 125 |
| 178 | 3300005545 | Ga0070695_100036056 | Ga0070695_1000360566 | 125 |
| 179 | 3300005545 | Ga0070695_100155572 | Ga0070695_1001555722 | 125 |
| 180 | 3300005546 | Ga0070696_100004235 | Ga0070696_1000042353 | 125 |
| 181 | 3300005546 | Ga0070696_100069732 | Ga0070696_1000697323 | 125 |
| 182 | 3300005546 | Ga0070696_100300305 | Ga0070696_1003003052 | 125 |
| 183 | 3300005547 | Ga0070693_100002169 | Ga0070693_1000021698 | 125 |
| 184 | 3300005547 | Ga0070693_100293022 | Ga0070693_1002930222 | 125 |
| 185 | 3300005549 | Ga0070704_100036923 | Ga0070704_1000369234 | 125 |
| 186 | 3300005549 | Ga0070704_100040539 | Ga0070704_1000405392 | 125 |
| 187 | 3300005549 | Ga0070704_100391375 | Ga0070704_1003913752 | 125 |
| 188 | 3300005563 | Ga0068855_100020529 | Ga0068855_1000205295 | 125 |
| 189 | 3300005563 | Ga0068855_101073312 | Ga0068855_1010733122 | 125 |
| 190 | 3300005577 | Ga0068857_100174999 | Ga0068857_1001749992 | 125 |
| 191 | 3300005578 | Ga0068854_100066900 | Ga0068854_1000669003 | 125 |
| 192 | 3300005614 | Ga0068856_100042983 | Ga0068856_1000429832 | 125 |
| 193 | 3300005614 | Ga0068856_100157067 | Ga0068856_1001570673 | 125 |
| 194 | 3300005615 | Ga0070702_100000016 | Ga0070702_1000000162 | 125 |
| 195 | 3300005615 | Ga0070702_100348021 | Ga0070702_1003480212 | 125 |
| 196 | 3300005616 | Ga0068852_100204743 | Ga0068852_1002047432 | 125 |
| 197 | 3300005617 | Ga0068859_100006034 | Ga0068859_1000060343 | 125 |
| 198 | 3300005617 | Ga0068859_100307891 | Ga0068859_1003078912 | 125 |
| 199 | 3300005617 | Ga0068859_101740163 | Ga0068859_1017401632 | 125 |
| 200 | 3300005618 | Ga0068864_100259558 | Ga0068864_1002595581 | 125 |
| 201 | 3300005718 | Ga0068866_10000639 | Ga0068866_100006392 | 125 |
| 202 | 3300005719 | Ga0068861_100054424 | Ga0068861_1000544244 | 125 |
| 203 | 3300005719 | Ga0068861_101539472 | Ga0068861_1015394722 | 125 |
| 204 | 3300005840 | Ga0068870_10188746 | Ga0068870_101887462 | 125 |
| 205 | 3300005840 | Ga0068870_10252098 | Ga0068870_102520982 | 125 |
| 206 | 3300005841 | Ga0068863_100144845 | Ga0068863_1001448453 | 125 |
| 207 | 3300005841 | Ga0068863_101054238 | Ga0068863_1010542382 | 125 |
| 208 | 3300005842 | Ga0068858_100317478 | Ga0068858_1003174782 | 125 |
| 209 | 3300005843 | Ga0068860_100001230 | Ga0068860_1000012304 | 125 |
| 210 | 3300005844 | Ga0068862_100009634 | Ga0068862_1000096348 | 125 |
| 211 | 3300005844 | Ga0068862_100100121 | Ga0068862_1001001212 | 125 |
| 212 | 3300005844 | Ga0068862_100132981 | Ga0068862_1001329812 | 125 |
| 213 | 3300005937 | Ga0081455_10370863 | Ga0081455_103708631 | 125 |
| 214 | 3300006163 | Ga0070715_10079721 | Ga0070715_100797212 | 125 |
| 215 | 3300006237 | Ga0097621_100045926 | Ga0097621_1000459264 | 125 |
| 216 | 3300006358 | Ga0068871_100000120 | Ga0068871_10000012065 | 125 |
| 217 | 3300006358 | Ga0068871_101507868 | Ga0068871_1015078682 | 125 |
| 218 | 3300006844 | Ga0075428_100224022 | Ga0075428_1002240223 | 125 |
| 219 | 3300006844 | Ga0075428_100246694 | Ga0075428_1002466942 | 125 |
| 220 | 3300006844 | Ga0075428_100906838 | Ga0075428_1009068382 | 125 |
| 221 | 3300006844 | Ga0075428_101179697 | Ga0075428_1011796972 | 125 |
| 222 | 3300006846 | Ga0075430_100046667 | Ga0075430_1000466673 | 125 |
| 223 | 3300006846 | Ga0075430_100962712 | Ga0075430_1009627122 | 125 |
| 224 | 3300006846 | Ga0075430_101050112 | Ga0075430_1010501122 | 125 |
| 225 | 3300006847 | Ga0075431_100094541 | Ga0075431_1000945413 | 125 |
| 226 | 3300006847 | Ga0075431_100571820 | Ga0075431_1005718202 | 125 |
| 227 | 3300006847 | Ga0075431_100581297 | Ga0075431_1005812972 | 125 |
| 228 | 3300006852 | Ga0075433_10001178 | Ga0075433_1000117820 | 125 |
| 229 | 3300006852 | Ga0075433_10398282 | Ga0075433_103982822 | 125 |
| 230 | 3300006871 | Ga0075434_100001217 | Ga0075434_1000012172 | 125 |
| 231 | 3300006880 | Ga0075429_100005024 | Ga0075429_1000050245 | 125 |
| 232 | 3300006880 | Ga0075429_100031593 | Ga0075429_1000315936 | 125 |
| 233 | 3300006880 | Ga0075429_100508682 | Ga0075429_1005086822 | 125 |
| 234 | 3300006880 | Ga0075429_101629257 | Ga0075429_1016292572 | 125 |
| 235 | 3300006881 | Ga0068865_100002861 | Ga0068865_1000028613 | 125 |
| 236 | 3300006881 | Ga0068865_100040371 | Ga0068865_1000403712 | 125 |
| 237 | 3300006914 | Ga0075436_100035671 | Ga0075436_1000356713 | 125 |
| 238 | 3300006914 | Ga0075436_100244127 | Ga0075436_1002441272 | 125 |
| 239 | 3300006931 | Ga0097620_100006034 | Ga0097620_10000603412 | 125 |
| 240 | 3300006931 | Ga0097620_100307891 | Ga0097620_1003078912 | 125 |
| 241 | 3300006931 | Ga0097620_101740116 | Ga0097620_1017401162 | 125 |
| 242 | 3300007076 | Ga0075435_100000549 | Ga0075435_1000005494 | 125 |
| 243 | 3300007265 | Ga0099794_10019620 | Ga0099794_100196204 | 125 |
| 244 | 3300007265 | Ga0099794_10067447 | Ga0099794_100674472 | 125 |
| 245 | 3300007265 | Ga0099794_10195171 | Ga0099794_101951712 | 125 |
| 246 | 3300009092 | Ga0105250_10221557 | Ga0105250_102215572 | 125 |
| 247 | 3300009094 | Ga0111539_10023101 | Ga0111539_100231016 | 125 |
| 248 | 3300009094 | Ga0111539_10250772 | Ga0111539_102507722 | 125 |
| 249 | 3300009094 | Ga0111539_10406612 | Ga0111539_104066122 | 125 |
| 250 | 3300009094 | Ga0111539_10838013 | Ga0111539_108380132 | 125 |
| 251 | 3300009094 | Ga0111539_12494943 | Ga0111539_124949432 | 125 |
| 252 | 3300009098 | Ga0105245_10000259 | Ga0105245_1000025948 | 125 |
| 253 | 3300009147 | Ga0114129_10058621 | Ga0114129_100586214 | 125 |
| 254 | 3300009147 | Ga0114129_11171499 | Ga0114129_111714992 | 125 |
| 255 | 3300009148 | Ga0105243_10015694 | Ga0105243_100156943 | 125 |
| 256 | 3300009148 | Ga0105243_10016613 | Ga0105243_100166132 | 125 |
| 257 | 3300009174 | Ga0105241_10065500 | Ga0105241_100655003 | 125 |
| 258 | 3300009176 | Ga0105242_10001686 | Ga0105242_1000168621 | 125 |
| 259 | 3300009176 | Ga0105242_10706002 | Ga0105242_107060022 | 125 |
| 260 | 3300009177 | Ga0105248_10151197 | Ga0105248_101511973 | 125 |
| 261 | 3300009545 | Ga0105237_10096519 | Ga0105237_100965192 | 125 |
| 262 | 3300009545 | Ga0105237_10444517 | Ga0105237_104445172 | 125 |
| 263 | 3300009553 | Ga0105249_10001070 | Ga0105249_100010702 | 125 |
| 264 | 3300009553 | Ga0105249_10265598 | Ga0105249_102655982 | 125 |
| 265 | 3300010375 | Ga0105239_10049991 | Ga0105239_100499913 | 125 |
| 266 | 3300011119 | Ga0105246_10973188 | Ga0105246_109731881 | 125 |
| 267 | 3300012480 | Ga0157346_1008790 | Ga0157346_10087902 | 125 |
| 268 | 3300013297 | Ga0157378_10000576 | Ga0157378_100005762 | 125 |
| 269 | 3300013297 | Ga0157378_10798011 | Ga0157378_107980112 | 125 |
| 270 | 3300013306 | Ga0163162_10378285 | Ga0163162_103782853 | 125 |
| 271 | 3300013306 | Ga0163162_10439433 | Ga0163162_104394333 | 125 |
| 272 | 3300013308 | Ga0157375_10353764 | Ga0157375_103537642 | 125 |
| 273 | 3300013308 | Ga0157375_10582921 | Ga0157375_105829212 | 125 |
| 274 | 3300014326 | Ga0157380_10012036 | Ga0157380_100120365 | 125 |
| 275 | 3300014326 | Ga0157380_10806534 | Ga0157380_108065342 | 125 |
| 276 | 3300014745 | Ga0157377_10045260 | Ga0157377_100452603 | 125 |
| 277 | 3300014745 | Ga0157377_10811872 | Ga0157377_108118722 | 125 |
| 278 | 3300014745 | Ga0157377_10872072 | Ga0157377_108720721 | 125 |
| 279 | 3300014968 | Ga0157379_10304127 | Ga0157379_103041272 | 125 |
| 280 | 3300014969 | Ga0157376_10004961 | Ga0157376_100049614 | 125 |
| 281 | 3300025315 | Ga0207697_10446431 | Ga0207697_104464312 | 125 |
| 282 | 3300025885 | Ga0207653_10012421 | Ga0207653_100124212 | 125 |
| 283 | 3300025899 | Ga0207642_10002463 | Ga0207642_100024633 | 125 |
| 284 | 3300025905 | Ga0207685_10000844 | Ga0207685_100008444 | 125 |
| 285 | 3300025905 | Ga0207685_10053669 | Ga0207685_100536692 | 125 |
| 286 | 3300025905 | Ga0207685_10239433 | Ga0207685_102394332 | 125 |
| 287 | 3300025907 | Ga0207645_10179043 | Ga0207645_101790432 | 125 |
| 288 | 3300025908 | Ga0207643_10131994 | Ga0207643_101319942 | 125 |
| 289 | 3300025911 | Ga0207654_10067712 | Ga0207654_100677123 | 125 |
| 290 | 3300025914 | Ga0207671_10445052 | Ga0207671_104450522 | 125 |
| 291 | 3300025916 | Ga0207663_10357647 | Ga0207663_103576472 | 125 |
| 292 | 3300025916 | Ga0207663_11046189 | Ga0207663_110461892 | 125 |
| 293 | 3300025917 | Ga0207660_10001156 | Ga0207660_100011563 | 125 |
| 294 | 3300025917 | Ga0207660_10286597 | Ga0207660_102865972 | 125 |
| 295 | 3300025917 | Ga0207660_10424720 | Ga0207660_104247202 | 125 |
| 296 | 3300025918 | Ga0207662_10000106 | Ga0207662_1000010623 | 125 |
| 297 | 3300025918 | Ga0207662_10078695 | Ga0207662_100786952 | 125 |
| 298 | 3300025921 | Ga0207652_10032518 | Ga0207652_100325182 | 125 |
| 299 | 3300025923 | Ga0207681_10044062 | Ga0207681_100440623 | 125 |
| 300 | 3300025923 | Ga0207681_10485634 | Ga0207681_104856342 | 125 |
| 301 | 3300025924 | Ga0207694_11486893 | Ga0207694_114868931 | 125 |
| 302 | 3300025926 | Ga0207659_10732213 | Ga0207659_107322132 | 125 |
| 303 | 3300025927 | Ga0207687_10021347 | Ga0207687_100213473 | 125 |
| 304 | 3300025934 | Ga0207686_10000883 | Ga0207686_1000088325 | 125 |
| 305 | 3300025935 | Ga0207709_10001408 | Ga0207709_100014087 | 125 |
| 306 | 3300025935 | Ga0207709_10675100 | Ga0207709_106751002 | 125 |
| 307 | 3300025936 | Ga0207670_10032252 | Ga0207670_100322523 | 125 |
| 308 | 3300025936 | Ga0207670_10124413 | Ga0207670_101244133 | 125 |
| 309 | 3300025936 | Ga0207670_10784569 | Ga0207670_107845691 | 125 |
| 310 | 3300025937 | Ga0207669_11540445 | Ga0207669_115404452 | 125 |
| 311 | 3300025938 | Ga0207704_10007809 | Ga0207704_100078093 | 125 |
| 312 | 3300025938 | Ga0207704_10522775 | Ga0207704_105227752 | 125 |
| 313 | 3300025938 | Ga0207704_10677748 | Ga0207704_106777482 | 125 |
| 314 | 3300025940 | Ga0207691_10043567 | Ga0207691_100435674 | 125 |
| 315 | 3300025941 | Ga0207711_10130101 | Ga0207711_101301012 | 125 |
| 316 | 3300025942 | Ga0207689_10000376 | Ga0207689_100003768 | 125 |
| 317 | 3300025942 | Ga0207689_10058600 | Ga0207689_100586002 | 125 |
| 318 | 3300025942 | Ga0207689_10091991 | Ga0207689_100919912 | 125 |
| 319 | 3300025942 | Ga0207689_10715896 | Ga0207689_107158962 | 125 |
| 320 | 3300025949 | Ga0207667_10016778 | Ga0207667_100167787 | 125 |
| 321 | 3300025949 | Ga0207667_10330360 | Ga0207667_103303602 | 125 |
| 322 | 3300025960 | Ga0207651_10226604 | Ga0207651_102266043 | 125 |
| 323 | 3300025960 | Ga0207651_10254357 | Ga0207651_102543572 | 125 |
| 324 | 3300025960 | Ga0207651_10818793 | Ga0207651_108187932 | 125 |
| 325 | 3300025961 | Ga0207712_10030519 | Ga0207712_100305193 | 125 |
| 326 | 3300025972 | Ga0207668_11405169 | Ga0207668_114051692 | 125 |
| 327 | 3300025981 | Ga0207640_10028259 | Ga0207640_100282592 | 125 |
| 328 | 3300026023 | Ga0207677_10070095 | Ga0207677_100700953 | 125 |
| 329 | 3300026023 | Ga0207677_10753790 | Ga0207677_107537902 | 125 |
| 330 | 3300026035 | Ga0207703_10023514 | Ga0207703_100235145 | 125 |
| 331 | 3300026075 | Ga0207708_10016505 | Ga0207708_100165055 | 125 |
| 332 | 3300026075 | Ga0207708_10096952 | Ga0207708_100969522 | 125 |
| 333 | 3300026075 | Ga0207708_10148086 | Ga0207708_101480863 | 125 |
| 334 | 3300026078 | Ga0207702_10025636 | Ga0207702_100256362 | 125 |
| 335 | 3300026078 | Ga0207702_10244294 | Ga0207702_102442942 | 125 |
| 336 | 3300026088 | Ga0207641_10244509 | Ga0207641_102445092 | 125 |
| 337 | 3300026089 | Ga0207648_10000369 | Ga0207648_100003693 | 125 |
| 338 | 3300026089 | Ga0207648_10023397 | Ga0207648_100233977 | 125 |
| 339 | 3300026095 | Ga0207676_10200633 | Ga0207676_102006332 | 125 |
| 340 | 3300026116 | Ga0207674_10209799 | Ga0207674_102097992 | 125 |
| 341 | 3300026118 | Ga0207675_100002170 | Ga0207675_10000217022 | 125 |
| 342 | 3300026118 | Ga0207675_100004506 | Ga0207675_1000045063 | 125 |
| 343 | 3300026118 | Ga0207675_100115848 | Ga0207675_1001158483 | 125 |
| 344 | 3300026121 | Ga0207683_10323175 | Ga0207683_103231753 | 125 |
| 345 | 3300026142 | Ga0207698_10204440 | Ga0207698_102044403 | 125 |
| 346 | 3300027462 | Ga0210000_1019025 | Ga0210000_10190252 | 125 |
| 347 | 3300027543 | Ga0209999_1078219 | Ga0209999_10782191 | 125 |
| 348 | 3300027671 | Ga0209588_1009181 | Ga0209588_10091812 | 125 |
| 349 | 3300027671 | Ga0209588_1044313 | Ga0209588_10443132 | 125 |
| 350 | 3300027695 | Ga0209966_1065575 | Ga0209966_10655752 | 125 |
| 351 | 3300027907 | Ga0207428_10056581 | Ga0207428_100565813 | 125 |
| 352 | 3300027907 | Ga0207428_10197767 | Ga0207428_101977673 | 125 |
| 353 | 3300028380 | Ga0268265_10001333 | Ga0268265_1000133328 | 125 |
| 354 | 3300028381 | Ga0268264_10001450 | Ga0268264_1000145029 | 125 |
| 355 | 3300031548 | Ga0307408_100035927 | Ga0307408_1000359273 | 125 |
| 356 | 3300031548 | Ga0307408_100700443 | Ga0307408_1007004432 | 125 |
| 357 | 3300031731 | Ga0307405_10450637 | Ga0307405_104506371 | 125 |
| 358 | 3300031852 | Ga0307410_10327131 | Ga0307410_103271312 | 125 |
| 359 | 3300031903 | Ga0307407_10207850 | Ga0307407_102078502 | 125 |
| 360 | 3300031995 | Ga0307409_101135992 | Ga0307409_1011359922 | 125 |
| 361 | 3300032002 | Ga0307416_100034206 | Ga0307416_1000342062 | 125 |
| 362 | 3300032002 | Ga0307416_100165906 | Ga0307416_1001659062 | 125 |
| 363 | 3300032005 | Ga0307411_10450218 | Ga0307411_104502182 | 125 |
| 364 | 3300034816 | Ga0373930_0004645 | Ga0373930_0004645_1000_1419 | 125 |
| 365 | 3300034817 | Ga0373948_0008200 | Ga0373948_0008200_955_1374 | 125 |
| 366 | 3300034818 | Ga0373950_0002063 | Ga0373950_0002063_1114_1533 | 125 |
| 367 | 3300034819 | Ga0373958_0008124 | Ga0373958_0008124_223_642 | 125 |
| 368 | 3300034820 | Ga0373959_0005159 | Ga0373959_0005159_1276_1695 | 125 |
| 369 | 3300035084 | Ga0373928_0002841 | Ga0373928_0002841_1437_1856 | 125 |
| 370 | 3300035085 | Ga0373929_0008161 | Ga0373929_0008161_608_1027 | 125 |
| 371 | 3300035088 | Ga0373940_0017306 | Ga0373940_0017306_941_1360 | 125 |
| 372 | 3300035089 | Ga0373944_0011272 | Ga0373944_0011272_1753_2136 | 125 |
| 373 | 3300035090 | Ga0373949_0020097 | Ga0373949_0020097_365_784 | 125 |
| 374 | 3300035092 | Ga0373952_0249653 | Ga0373952_0249653_92_475 | 125 |
| 375 | 3300035112 | Ga0373932_0250153 | Ga0373932_0250153_35_454 | 125 |
| 376 | 3300035114 | Ga0373939_0000843 | Ga0373939_0000843_2877_3296 | 125 |
| 377 | 3300035115 | Ga0373941_0076758 | Ga0373941_0076758_609_1028 | 125 |
| 378 | 3300035116 | Ga0373945_0000803 | Ga0373945_0000803_1968_2351 | 125 |
| 379 | 3300035118 | Ga0373954_0468917 | Ga0373954_0468917_69_446 | 125 |
| 380 | 3300035121 | Ga0373960_0081733 | Ga0373960_0081733_261_680 | 125 |
| 381 | 3300035170 | Ga0373943_0017959 | Ga0373943_0017959_1499_1882 | 125 |
| 382 | 3300035170 | Ga0373943_0043183 | Ga0373943_0043183_1313_1732 | 125 |
| 383 | 3300035207 | Ga0373942_0017248 | Ga0373942_0017248_1055_1474 | 125 |
| 384 | 3300035207 | Ga0373942_0024601 | Ga0373942_0024601_827_1210 | 125 |
| 385 | 3300035207 | Ga0373942_0116589 | Ga0373942_0116589_366_749 | 125 |
| 386 | 3300035241 | Ga0373961_0033576 | Ga0373961_0033576_809_1228 | 125 |
| 387 | 3300035242 | Ga0373962_0045832 | Ga0373962_0045832_728_1147 | 125 |
| 388 | 3300035242 | Ga0373962_0097040 | Ga0373962_0097040_457_900 | 125 |
| 389 | 3300035691 | Ga0373931_0000757 | Ga0373931_0000757_10061_10480 | 125 |
| 390 | 3300035691 | Ga0373931_0030990 | Ga0373931_0030990_1629_2033 | 125 |
| 391 | 3300035691 | Ga0373931_0902126 | Ga0373931_0902126_142_525 | 125 |
| 392 | 3300035692 | Ga0373935_0084677 | Ga0373935_0084677_1115_1498 | 125 |
| 393 | 3300035695 | Ga0373927_0004507 | Ga0373927_0004507_6724_7107 | 125 |
| 394 | 3300035725 | Ga0373947_0023879 | Ga0373947_0023879_568_951 | 125 |
| 395 | 3300035725 | Ga0373947_0065372 | Ga0373947_0065372_253_672 | 125 |
| 396 | 3300036401 | Ga0373937_0420667 | Ga0373937_0420667_237_614 | 125 |
| 397 | 3300037068 | Ga0373925_0084870 | Ga0373925_0084870_1548_1931 | 125 |
| 398 | 3300037068 | Ga0373925_0144241 | Ga0373925_0144241_1207_1626 | 125 |
| 399 | 3300042001 | Ga0439441_002805 | Ga0439441_002805_1182_1565 | 125 |
| 400 | 3300042001 | Ga0439441_075627 | Ga0439441_075627_147_578 | 125 |
| 401 | 3300042003 | Ga0439443_001850 | Ga0439443_001850_245_628 | 125 |
| 402 | 3300042116 | Ga0450912_001908 | Ga0450912_001908_232_615 | 125 |
| 403 | 3300042436 | Ga0439435_0001098 | Ga0439435_0001098_762_1145 | 125 |
| 404 | 3300042437 | Ga0439444_0013279 | Ga0439444_0013279_435_818 | 125 |
| 405 | 3300042439 | Ga0439464_0029632 | Ga0439464_0029632_698_1081 | 125 |
| 406 | 3300042461 | Ga0439460_0002280 | Ga0439460_0002280_3444_3827 | 125 |
| 407 | 3300042993 | Ga0439440_0122219 | Ga0439440_0122219_171_554 | 125 |
| 408 | 3300045051 | Ga0451576_0019708 | Ga0451576_0019708_2210_2629 | 125 |
| 409 | 3300045051 | Ga0451576_0086242 | Ga0451576_0086242_1393_1797 | 125 |
| 410 | 3300045051 | Ga0451576_1709527 | Ga0451576_1709527_176_592 | 125 |
| 411 | 3300046454 | Ga0495592_0245129 | Ga0495592_0245129_389_766 | 125 |
| 412 | 3300046455 | Ga0495603_0002444 | Ga0495603_0002444_9972_10355 | 125 |
| 413 | 3300046472 | Ga0495580_0014828 | Ga0495580_0014828_4643_5026 | 125 |
| 414 | 3300046473 | Ga0495582_0214431 | Ga0495582_0214431_164_547 | 125 |
| 415 | 3300046499 | Ga0495594_0088660 | Ga0495594_0088660_308_691 | 125 |
| 416 | 3300046516 | Ga0495628_0252454 | Ga0495628_0252454_254_631 | 125 |
| 417 | 3300046517 | Ga0495630_0235832 | Ga0495630_0235832_559_942 | 125 |
| 418 | 3300046519 | Ga0495632_0341681 | Ga0495632_0341681_234_611 | 125 |
| 419 | 3300046526 | Ga0495666_0012596 | Ga0495666_0012596_2635_3018 | 125 |
| 420 | 3300046535 | Ga0495586_0007991 | Ga0495586_0007991_3525_3908 | 125 |
| 421 | 3300046537 | Ga0495598_0014252 | Ga0495598_0014252_431_808 | 125 |
| 422 | 3300046539 | Ga0495621_0121421 | Ga0495621_0121421_347_733 | 125 |
| 423 | 3300046539 | Ga0495621_0127489 | Ga0495621_0127489_281_658 | 125 |
| 424 | 3300046559 | Ga0495667_0711713 | Ga0495667_0711713_35_412 | 125 |
| 425 | 3300046615 | Ga0495656_0095620 | Ga0495656_0095620_456_833 | 125 |
| 426 | 3300046678 | Ga0495599_0192532 | Ga0495599_0192532_419_796 | 125 |
| 427 | 3300046679 | Ga0495623_0341826 | Ga0495623_0341826_380_757 | 125 |
| 428 | 3300046681 | Ga0495647_0008364 | Ga0495647_0008364_2702_3085 | 125 |
| 429 | 3300046683 | Ga0495658_0016177 | Ga0495658_0016177_432_815 | 125 |
| 430 | 3300046684 | Ga0495669_0212004 | Ga0495669_0212004_15_392 | 125 |
| 431 | 3300047315 | Ga0495581_0054153 | Ga0495581_0054153_1226_1609 | 125 |
| 432 | 3300047318 | Ga0495636_0410717 | Ga0495636_0410717_185_562 | 125 |
| 433 | 3300047321 | Ga0495676_0033938 | Ga0495676_0033938_3623_4006 | 125 |
| 434 | 3300047444 | Ga0495675_0458868 | Ga0495675_0458868_322_699 | 125 |
| 435 | 3300048905 | Ga0496102_1191361 | Ga0496102_1191361_153_557 | 125 |
| 436 | 3300048907 | Ga0496104_1336030 | Ga0496104_1336030_171_554 | 125 |
| 437 | 3300048911 | Ga0496108_1011850 | Ga0496108_1011850_162_620 | 125 |
| 438 | 3300048913 | Ga0496110_0480501 | Ga0496110_0480501_481_939 | 125 |
| 439 | 3300048914 | Ga0496111_0177314 | Ga0496111_0177314_145_603 | 125 |
| 440 | 3300049568 | Ga0501031_0128239 | Ga0501031_0128239_1060_1497 | 125 |
| 441 | 3300049568 | Ga0501031_0315176 | Ga0501031_0315176_608_991 | 125 |
| 442 | 3300049569 | Ga0501032_0135795 | Ga0501032_0135795_250_657 | 125 |
| 443 | 3300049570 | Ga0501033_0006483 | Ga0501033_0006483_1911_2318 | 125 |
| 444 | 3300049570 | Ga0501033_0064748 | Ga0501033_0064748_619_996 | 125 |
| 445 | 3300049570 | Ga0501033_0176408 | Ga0501033_0176408_221_658 | 125 |
| 446 | 3300049571 | Ga0501034_0228161 | Ga0501034_0228161_259_666 | 125 |
| 447 | 3300049572 | Ga0501036_0001252 | Ga0501036_0001252_6770_7177 | 125 |
| 448 | 3300049572 | Ga0501036_0139919 | Ga0501036_0139919_233_616 | 125 |
| 449 | 3300049572 | Ga0501036_0153867 | Ga0501036_0153867_83_466 | 125 |
| 450 | 3300049572 | Ga0501036_0260633 | Ga0501036_0260633_130_567 | 125 |
| 451 | 3300049572 | Ga0501036_0487825 | Ga0501036_0487825_486_896 | 125 |
| 452 | 3300049573 | Ga0501037_0059065 | Ga0501037_0059065_1102_1509 | 125 |
| 453 | 3300049574 | Ga0501038_0001280 | Ga0501038_0001280_13962_14369 | 125 |
| 454 | 3300049574 | Ga0501038_0162383 | Ga0501038_0162383_980_1357 | 125 |
| 455 | 3300049574 | Ga0501038_0224201 | Ga0501038_0224201_623_1006 | 125 |
| 456 | 3300049574 | Ga0501038_0501590 | Ga0501038_0501590_52_435 | 125 |
| 457 | 3300049574 | Ga0501038_0606154 | Ga0501038_0606154_249_632 | 125 |
| 458 | 3300049575 | Ga0501039_0003867 | Ga0501039_0003867_10321_10758 | 125 |
| 459 | 3300049575 | Ga0501039_0011180 | Ga0501039_0011180_5668_6075 | 125 |
| 460 | 3300049575 | Ga0501039_0068920 | Ga0501039_0068920_1022_1399 | 125 |
| 461 | 3300049575 | Ga0501039_0130960 | Ga0501039_0130960_585_1037 | 125 |
| 462 | 3300049575 | Ga0501039_0162058 | Ga0501039_0162058_760_1143 | 125 |
| 463 | 3300049576 | Ga0501040_0000052 | Ga0501040_0000052_44681_45088 | 125 |
| 464 | 3300049576 | Ga0501040_0014654 | Ga0501040_0014654_173_556 | 125 |
| 465 | 3300049576 | Ga0501040_0040385 | Ga0501040_0040385_1739_2116 | 125 |
| 466 | 3300049576 | Ga0501040_0137477 | Ga0501040_0137477_513_896 | 125 |
| 467 | 3300049576 | Ga0501040_1072328 | Ga0501040_1072328_99_482 | 125 |
| 468 | 3300049577 | Ga0501041_0004912 | Ga0501041_0004912_363_770 | 125 |
| 469 | 3300049577 | Ga0501041_0007062 | Ga0501041_0007062_2341_2778 | 125 |
| 470 | 3300049577 | Ga0501041_0021075 | Ga0501041_0021075_668_1051 | 125 |
| 471 | 3300049577 | Ga0501041_0048287 | Ga0501041_0048287_1267_1644 | 125 |
| 472 | 3300049577 | Ga0501041_0133537 | Ga0501041_0133537_461_844 | 125 |
| 473 | 3300049577 | Ga0501041_0332119 | Ga0501041_0332119_458_868 | 125 |
| 474 | 3300049577 | Ga0501041_0385927 | Ga0501041_0385927_168_620 | 125 |
| 475 | 3300049577 | Ga0501041_0634247 | Ga0501041_0634247_169_552 | 125 |
| 476 | 3300049578 | Ga0501042_0000048 | Ga0501042_0000048_40345_40752 | 125 |
| 477 | 3300049578 | Ga0501042_0082936 | Ga0501042_0082936_1503_1940 | 125 |
| 478 | 3300049578 | Ga0501042_0089138 | Ga0501042_0089138_586_963 | 125 |
| 479 | 3300049578 | Ga0501042_0098856 | Ga0501042_0098856_1497_1880 | 125 |
| 480 | 3300049578 | Ga0501042_0254314 | Ga0501042_0254314_139_522 | 125 |
| 481 | 3300049578 | Ga0501042_0375749 | Ga0501042_0375749_296_679 | 125 |
| 482 | 3300049578 | Ga0501042_0388668 | Ga0501042_0388668_464_847 | 125 |
| 483 | 3300049578 | Ga0501042_1145217 | Ga0501042_1145217_73_450 | 125 |
| 484 | 3300049579 | Ga0501043_0267785 | Ga0501043_0267785_130_513 | 125 |
| 485 | 3300049579 | Ga0501043_0888998 | Ga0501043_0888998_100_507 | 125 |
| 486 | 3300049580 | Ga0501046_0000271 | Ga0501046_0000271_7928_8335 | 125 |
| 487 | 3300049580 | Ga0501046_0033342 | Ga0501046_0033342_2989_3372 | 125 |
| 488 | 3300049580 | Ga0501046_0169694 | Ga0501046_0169694_843_1220 | 125 |
| 489 | 3300049580 | Ga0501046_0299664 | Ga0501046_0299664_372_755 | 125 |
| 490 | 3300049580 | Ga0501046_0320880 | Ga0501046_0320880_199_588 | 125 |
| 491 | 3300049580 | Ga0501046_0820828 | Ga0501046_0820828_190_597 | 125 |
| 492 | 3300049581 | Ga0501047_0968679 | Ga0501047_0968679_243_650 | 125 |
| 493 | 3300049581 | Ga0501047_1116506 | Ga0501047_1116506_158_535 | 125 |
| 494 | 3300049582 | Ga0501048_0001409 | Ga0501048_0001409_9353_9760 | 125 |
| 495 | 3300049582 | Ga0501048_0012758 | Ga0501048_0012758_1802_2185 | 125 |
| 496 | 3300049582 | Ga0501048_0075515 | Ga0501048_0075515_852_1235 | 125 |
| 497 | 3300049582 | Ga0501048_0107314 | Ga0501048_0107314_193_630 | 125 |
| 498 | 3300049582 | Ga0501048_0191710 | Ga0501048_0191710_1024_1401 | 125 |
| 499 | 3300049582 | Ga0501048_0242220 | Ga0501048_0242220_692_1144 | 125 |
| 500 | 3300049584 | Ga0501068_0001255 | Ga0501068_0001255_1232_1639 | 125 |
| 501 | 3300049584 | Ga0501068_0244803 | Ga0501068_0244803_658_1041 | 125 |
| 502 | 3300049585 | Ga0501069_0237927 | Ga0501069_0237927_162_569 | 125 |
| 503 | 3300049586 | Ga0501070_0050478 | Ga0501070_0050478_1137_1544 | 125 |
| 504 | 3300049586 | Ga0501070_1057055 | Ga0501070_1057055_136_519 | 125 |
| 505 | 3300049586 | Ga0501070_1122520 | Ga0501070_1122520_39_422 | 125 |
| 506 | 3300049587 | Ga0501071_0004018 | Ga0501071_0004018_6011_6448 | 125 |
| 507 | 3300049587 | Ga0501071_0042588 | Ga0501071_0042588_1777_2160 | 125 |
| 508 | 3300049587 | Ga0501071_0171196 | Ga0501071_0171196_876_1259 | 125 |
| 509 | 3300049587 | Ga0501071_0235177 | Ga0501071_0235177_153_536 | 125 |
| 510 | 3300049587 | Ga0501071_0373149 | Ga0501071_0373149_320_703 | 125 |
| 511 | 3300049587 | Ga0501071_0536636 | Ga0501071_0536636_290_742 | 125 |
| 512 | 3300049588 | Ga0501072_0003349 | Ga0501072_0003349_8801_9208 | 125 |
| 513 | 3300049588 | Ga0501072_0007259 | Ga0501072_0007259_3068_3451 | 125 |
| 514 | 3300049588 | Ga0501072_0077568 | Ga0501072_0077568_572_955 | 125 |
| 515 | 3300049588 | Ga0501072_0295779 | Ga0501072_0295779_53_460 | 125 |
| 516 | 3300049588 | Ga0501072_0382906 | Ga0501072_0382906_552_1004 | 125 |
| 517 | 3300049588 | Ga0501072_0463748 | Ga0501072_0463748_210_587 | 125 |
| 518 | 3300049588 | Ga0501072_0567784 | Ga0501072_0567784_196_633 | 125 |
| 519 | 3300049589 | Ga0501073_0292830 | Ga0501073_0292830_355_762 | 125 |
| 520 | 3300049590 | Ga0501074_0185062 | Ga0501074_0185062_95_502 | 125 |
| 521 | 3300049590 | Ga0501074_0596145 | Ga0501074_0596145_278_661 | 125 |
| 522 | 3300049591 | Ga0501075_0000751 | Ga0501075_0000751_11788_12195 | 125 |
| 523 | 3300049591 | Ga0501075_0001243 | Ga0501075_0001243_7022_7405 | 125 |
| 524 | 3300049591 | Ga0501075_0004209 | Ga0501075_0004209_5273_5710 | 125 |
| 525 | 3300049591 | Ga0501075_0006255 | Ga0501075_0006255_127_579 | 125 |
| 526 | 3300049591 | Ga0501075_0318341 | Ga0501075_0318341_47_430 | 125 |
| 527 | 3300049591 | Ga0501075_0370922 | Ga0501075_0370922_549_932 | 125 |
| 528 | 3300049592 | Ga0501076_0000290 | Ga0501076_0000290_5491_5874 | 125 |
| 529 | 3300049592 | Ga0501076_0004123 | Ga0501076_0004123_4447_4884 | 125 |
| 530 | 3300049592 | Ga0501076_0006671 | Ga0501076_0006671_2043_2450 | 125 |
| 531 | 3300049592 | Ga0501076_0049968 | Ga0501076_0049968_2452_2835 | 125 |
| 532 | 3300049592 | Ga0501076_0422233 | Ga0501076_0422233_596_1006 | 125 |
| 533 | 3300049592 | Ga0501076_0446732 | Ga0501076_0446732_491_943 | 125 |
| 534 | 3300049593 | Ga0501077_0013249 | Ga0501077_0013249_1403_1810 | 125 |
| 535 | 3300049593 | Ga0501077_0075065 | Ga0501077_0075065_1622_2005 | 125 |
| 536 | 3300049593 | Ga0501077_0130649 | Ga0501077_0130649_529_969 | 125 |
| 537 | 3300049593 | Ga0501077_0194241 | Ga0501077_0194241_772_1155 | 125 |
| 538 | 3300049593 | Ga0501077_0214809 | Ga0501077_0214809_493_930 | 125 |
| 539 | 3300049593 | Ga0501077_0387852 | Ga0501077_0387852_158_610 | 125 |
| 540 | 3300049661 | Ga0501217_268940 | Ga0501217_268940_152_532 | 125 |
| 541 | 3300049741 | Ga0501079_0000061 | Ga0501079_0000061_39579_39986 | 125 |
| 542 | 3300049741 | Ga0501079_0007164 | Ga0501079_0007164_2740_3123 | 125 |
| 543 | 3300049741 | Ga0501079_0008802 | Ga0501079_0008802_3628_4065 | 125 |
| 544 | 3300049741 | Ga0501079_0263103 | Ga0501079_0263103_627_1034 | 125 |
| 545 | 3300049742 | Ga0501080_0023332 | Ga0501080_0023332_2584_2991 | 125 |
| 546 | 3300049742 | Ga0501080_0072729 | Ga0501080_0072729_1313_1696 | 125 |
| 547 | 3300049742 | Ga0501080_0093367 | Ga0501080_0093367_2016_2453 | 125 |
| 548 | 3300049742 | Ga0501080_0189211 | Ga0501080_0189211_194_577 | 125 |
| 549 | 3300049742 | Ga0501080_0718718 | Ga0501080_0718718_131_583 | 125 |
| 550 | 3300049743 | Ga0501081_0000110 | Ga0501081_0000110_9412_9819 | 125 |
| 551 | 3300049743 | Ga0501081_0017440 | Ga0501081_0017440_4232_4669 | 125 |
| 552 | 3300049743 | Ga0501081_0019693 | Ga0501081_0019693_596_979 | 125 |
| 553 | 3300049743 | Ga0501081_0138525 | Ga0501081_0138525_1260_1712 | 125 |
| 554 | 3300049743 | Ga0501081_0180246 | Ga0501081_0180246_291_737 | 125 |
| 555 | 3300049744 | Ga0501083_0062766 | Ga0501083_0062766_1692_2129 | 125 |
| 556 | 3300049744 | Ga0501083_0288170 | Ga0501083_0288170_380_787 | 125 |
| 557 | 3300049822 | Ga0501035_0025479 | Ga0501035_0025479_53_490 | 125 |
| 558 | 3300049822 | Ga0501035_0064885 | Ga0501035_0064885_213_620 | 125 |
| 559 | 3300049824 | Ga0501045_0002891 | Ga0501045_0002891_1044_1451 | 125 |
| 560 | 3300049824 | Ga0501045_0003109 | Ga0501045_0003109_3835_4272 | 125 |
| 561 | 3300049824 | Ga0501045_0046875 | Ga0501045_0046875_644_1027 | 125 |
| 562 | 3300049824 | Ga0501045_0421884 | Ga0501045_0421884_61_444 | 125 |
| 563 | 3300049824 | Ga0501045_0584635 | Ga0501045_0584635_336_719 | 125 |
| 564 | 3300049824 | Ga0501045_0876077 | Ga0501045_0876077_78_461 | 125 |
| 565 | 3300049824 | Ga0501045_1180477 | Ga0501045_1180477_30_413 | 125 |
| 566 | 3300050507 | nmdc:mga05p37_158605_c1 | nmdc:mga05p37_158605_c1_2302_2706 | 125 |
| 567 | 3300050508 | nmdc:mga09592_1286525_c1 | nmdc:mga09592_1286525_c1_120_497 | 125 |
| 568 | 3300050508 | nmdc:mga09592_308869_c1 | nmdc:mga09592_308869_c1_210_587 | 125 |
| 569 | 3300050508 | nmdc:mga09592_840078_c1 | nmdc:mga09592_840078_c1_59_442 | 125 |
| 570 | 3300050509 | nmdc:mga0qj67_38378_c1 | nmdc:mga0qj67_38378_c1_557_940 | 125 |
| 571 | 3300050509 | nmdc:mga0qj67_606262_c1 | nmdc:mga0qj67_606262_c1_116_493 | 125 |
| 572 | 3300050509 | nmdc:mga0qj67_869443_c1 | nmdc:mga0qj67_869443_c1_103_486 | 125 |
| 573 | 3300050510 | nmdc:mga06r32_306953_c1 | nmdc:mga06r32_306953_c1_260_664 | 125 |
| 574 | 3300050510 | nmdc:mga06r32_417511_c1 | nmdc:mga06r32_417511_c1_414_872 | 125 |
| 575 | 3300050511 | nmdc:mga08y16_122930_c1 | nmdc:mga08y16_122930_c1_211_615 | 125 |
| 576 | 3300050511 | nmdc:mga08y16_165342_c1 | nmdc:mga08y16_165342_c1_1005_1382 | 125 |
| 577 | 3300050511 | nmdc:mga08y16_508132_c1 | nmdc:mga08y16_508132_c1_76_453 | 125 |
| 578 | 3300050511 | nmdc:mga08y16_58516_c1 | nmdc:mga08y16_58516_c1_2648_3031 | 125 |
| 579 | 3300050512 | nmdc:mga0n895_12822_c1 | nmdc:mga0n895_12822_c1_1057_1440 | 125 |
| 580 | 3300050512 | nmdc:mga0n895_332827_c1 | nmdc:mga0n895_332827_c1_593_997 | 125 |
| 581 | 3300050513 | nmdc:mga0rr50_23642_c1 | nmdc:mga0rr50_23642_c1_3244_3627 | 125 |
| 582 | 3300050514 | nmdc:mga08x19_5960_c1 | nmdc:mga08x19_5960_c1_466_849 | 125 |
| 583 | 3300050515 | nmdc:mga0a205_1704_c1 | nmdc:mga0a205_1704_c1_16639_17022 | 125 |
| 584 | 3300050515 | nmdc:mga0a205_376390_c1 | nmdc:mga0a205_376390_c1_398_802 | 125 |
| 585 | 3300054114 | Ga0501084_0001172 | Ga0501084_0001172_8344_8751 | 125 |
| 586 | 3300054114 | Ga0501084_0077254 | Ga0501084_0077254_2204_2641 | 125 |
| 587 | 3300054114 | Ga0501084_0568026 | Ga0501084_0568026_26_409 | 125 |
| 588 | 3300054114 | Ga0501084_0786754 | Ga0501084_0786754_188_571 | 125 |
| 589 | 3300059421 | Ga0590071_012766 | Ga0590071_012766_1460_1843 | 125 |
| 590 | 3300060353 | Ga0501082_0000430 | Ga0501082_0000430_284_691 | 125 |
| 591 | 3300060353 | Ga0501082_0006714 | Ga0501082_0006714_4172_4609 | 125 |
| 592 | 3300060353 | Ga0501082_0065190 | Ga0501082_0065190_2663_3046 | 125 |
| 593 | 3300060353 | Ga0501082_0525503 | Ga0501082_0525503_358_810 | 125 |
| 594 | 3300060353 | Ga0501082_1081139 | Ga0501082_1081139_27_410 | 125 |
| 595 | 3300061734 | Ga0530510_0000048 | Ga0530510_0000048_8218_8601 | 125 |
| 596 | 3300061734 | Ga0530510_0000186 | Ga0530510_0000186_29505_29912 | 125 |
| 597 | 3300061734 | Ga0530510_0078101 | Ga0530510_0078101_1592_1975 | 125 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2gv9-assembly2.cif.gz_B | crystal structure of the herpes simplex virus type 1 dna polymerase | 0.9237 | 73 | 121 |
| 2ib0-assembly1.cif.gz_B | crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis | 0.8825 | 2 | 121 |
| 2ib0-assembly1.cif.gz_A | crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis | 0.8765 | 2 | 125 |
| 3hiu-assembly1.cif.gz_A | the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 | 0.8538 | 2 | 124 |
| 4kvr-assembly1.cif.gz_A | crystal structure of prochlorococcus marinus aldehyde-deformylating oxygenase (mutant v41y) | 0.8521 | 2 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gv9B05 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain | 0.9397 | 75 | 121 | 1.10.287.690 |
| af_O45806_8_315_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.9081 | 74 | 116 | 1.20.1070.10 |
| 2ib0B00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8825 | 2 | 121 | 1.20.1260.10 |
| af_A0A0P0XEB1_1_59_1.20.58.80 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit | 0.8802 | 75 | 121 | 1.20.58.80 |
| 2ib0A01 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.8765 | 2 | 125 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3YET9-F1-model_v4 | DUF6306 domain-containing protein | 0.986 | 1 | 125 |
|
| AF-A0A3N5NAJ6-F1-model_v4 | 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) | 0.9818 | 2 | 122 |
GO:0005524
GO:0009396 GO:0030272 GO:0035999 |
| AF-A0A1F3YET9-F1-model_v4 | DUF6306 domain-containing protein | 0.9783 | 1 | 125 |
|
| AF-A0A2I6S6W0-F1-model_v4 | DUF6306 domain-containing protein | 0.9742 | 2 | 125 |
|
| AF-W7X0T4-F1-model_v4 | DUF6306 domain-containing protein | 0.9626 | 2 | 120 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar