F467691

General Info

Members Datasets Scaffolds Average Seq Length
597 285 597 131

Family's Representative Sequence

Representative Sequence 3300042001|Ga0439441_075627|Ga0439441_075627_147_578
Length 143
Sequence MSTSSFTEAELEAFLNRMLESERAGARSLVVFLDDFPRNGETWKILRRVHEDEAHNCALIGEQLKKRGRDYSHATGEFYAKAVAIEGQPERIRFLVKGLRWAIRELEQALPRIPDPAIRQLFQGIRERHLRSVAACETAAQSP

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
154 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
155 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
156 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
164 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
165 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
176 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
187 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
188 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
189 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
190 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
195 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
266 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
267 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
268 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
269 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
270 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
272 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
273 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
274 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
275 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
276 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
277 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
281 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.01
Rhizosphere 98.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10350879 3300005295 Unclassified 918
2 Ga0070676_10148336 3300005328 Bacteria 1499
3 Ga0070690_100011005 3300005330 Bacteria 5282
4 Ga0070690_100865050 3300005330 Unclassified 705
5 Ga0070670_100595906 3300005331 Bacteria 989
6 Ga0070670_100917462 3300005331 Unclassified 794
7 Ga0068869_100001027 3300005334 Bacteria 16246
8 Ga0068869_100050719 3300005334 Bacteria 3009
9 Ga0068869_100067547 3300005334 Bacteria 2638
10 Ga0068869_100087161 3300005334 Bacteria 2342
11 Ga0070666_10172462 3300005335 Bacteria 1515
12 Ga0070680_100012102 3300005336 Bacteria 6698
13 Ga0070680_100044924 3300005336 Bacteria 3590
14 Ga0068868_100000169 3300005338 Bacteria 42949
15 Ga0068868_101746724 3300005338 Bacteria 587
16 Ga0070689_100107883 3300005340 Bacteria 2211
17 Ga0070689_100145621 3300005340 Bacteria 1908
18 Ga0070689_100262685 3300005340 Bacteria 1427
19 Ga0070691_10023775 3300005341 Bacteria 2847
20 Ga0070691_10029702 3300005341 Bacteria 2558
21 Ga0070691_10477266 3300005341 Bacteria 717
22 Ga0070687_100000112 3300005343 Bacteria 27473
23 Ga0070687_100058115 3300005343 Bacteria 2031
24 Ga0070661_101006471 3300005344 Unclassified 691
25 Ga0070692_10000260 3300005345 Bacteria 14689
26 Ga0070692_10023013 3300005345 Bacteria 3049
27 Ga0070669_100201390 3300005353 Unclassified 1567
28 Ga0070669_100280704 3300005353 Bacteria 1334
29 Ga0070675_100052510 3300005354 Bacteria 3351
30 Ga0070675_101085039 3300005354 Bacteria 736
31 Ga0070675_101166531 3300005354 Unclassified 709
32 Ga0070674_101490659 3300005356 Bacteria 608
33 Ga0070673_100205175 3300005364 Bacteria 1699
34 Ga0070673_100485666 3300005364 Bacteria 1116
35 Ga0070673_100508007 3300005364 Bacteria 1091
36 Ga0070688_100217086 3300005365 Bacteria 1346
37 Ga0070688_100248287 3300005365 Bacteria 1266
38 Ga0070703_10003990 3300005406 Bacteria 4172
39 Ga0070710_10536640 3300005437 Bacteria 806
40 Ga0070701_10000840 3300005438 Bacteria 11002
41 Ga0070701_10220157 3300005438 Archaea 1132
42 Ga0070701_10414510 3300005438 Bacteria 856
43 Ga0070711_100486724 3300005439 Bacteria 1015
44 Ga0070711_101118454 3300005439 Bacteria 679
45 Ga0070705_100000991 3300005440 Bacteria 15853
46 Ga0070705_100045456 3300005440 Bacteria 2526
47 Ga0070705_100467373 3300005440 Bacteria 950
48 Ga0070700_100005957 3300005441 Bacteria 6481
49 Ga0070700_100078017 3300005441 Bacteria 2131
50 Ga0070700_100523958 3300005441 Bacteria 916
51 Ga0070694_100000608 3300005444 Bacteria 19748
52 Ga0070694_100007608 3300005444 Bacteria 6612
53 Ga0070694_100052420 3300005444 Bacteria 2757
54 Ga0070694_100085942 3300005444 Bacteria 2197
55 Ga0070694_100147677 3300005444 Bacteria 1714
56 Ga0070694_100874122 3300005444 Bacteria 741
57 Ga0070678_100505942 3300005456 Bacteria 1066
58 Ga0070662_100244832 3300005457 Bacteria 1439
59 Ga0070681_10155515 3300005458 Bacteria 2212
60 Ga0070681_11435882 3300005458 Unclassified 614
61 Ga0068867_100001181 3300005459 Bacteria 17901
62 Ga0068867_100853816 3300005459 Bacteria 816
63 Ga0070706_101531988 3300005467 Bacteria 609
64 Ga0070699_100547711 3300005518 Unclassified 1053
65 Ga0070679_100161927 3300005530 Bacteria 2212
66 Ga0070697_100002931 3300005536 Bacteria 13126
67 Ga0070697_100212412 3300005536 Bacteria 1648
68 Ga0070697_101318485 3300005536 Unclassified 644
69 Ga0070672_100204208 3300005543 Bacteria 1653
70 Ga0070672_100229637 3300005543 Bacteria 1559
71 Ga0070686_100033276 3300005544 Bacteria 3166
72 Ga0070695_100036056 3300005545 Bacteria 3111
73 Ga0070695_100155572 3300005545 Bacteria 1599
74 Ga0070695_100527046 3300005545 Bacteria 917
75 Ga0070695_100573069 3300005545 Bacteria 883
76 Ga0070696_100004235 3300005546 Bacteria 9565
77 Ga0070696_100069732 3300005546 Bacteria 2471
78 Ga0070696_100155071 3300005546 Bacteria 1684
79 Ga0070696_100300305 3300005546 Bacteria 1230
80 Ga0070696_100376353 3300005546 Bacteria 1106
81 Ga0070693_100002169 3300005547 Bacteria 8998
82 Ga0070693_100293022 3300005547 Bacteria 1094
83 Ga0070704_100036923 3300005549 Bacteria 3333
84 Ga0070704_100040539 3300005549 Bacteria 3206
85 Ga0070704_100052885 3300005549 Bacteria 2868
86 Ga0070704_100391375 3300005549 Bacteria 1184
87 Ga0070704_100626626 3300005549 Bacteria 947
88 Ga0068855_100020529 3300005563 Bacteria 7921
89 Ga0068855_101073312 3300005563 Bacteria 843
90 Ga0068857_100174999 3300005577 Bacteria 1952
91 Ga0068854_100066900 3300005578 Bacteria 2616
92 Ga0068856_100042983 3300005614 Bacteria 4446
93 Ga0068856_100157067 3300005614 Bacteria 2285
94 Ga0070702_100000016 3300005615 Bacteria 48066
95 Ga0070702_100348021 3300005615 Unclassified 1043
96 Ga0070702_100423905 3300005615 Bacteria 958
97 Ga0068852_100204743 3300005616 Bacteria 1869
98 Ga0068859_100006034 3300005617 Bacteria 12305
99 Ga0068859_100307891 3300005617 Bacteria 1678
100 Ga0068859_101701454 3300005617 Bacteria 697
101 Ga0068859_101740163 3300005617 Bacteria 689
102 Ga0068864_100259558 3300005618 Bacteria 1616
103 Ga0068866_10000639 3300005718 Bacteria 15853
104 Ga0068861_100054424 3300005719 Bacteria 3048
105 Ga0068861_101539472 3300005719 Bacteria 653
106 Ga0068870_10188746 3300005840 Bacteria 1242
107 Ga0068870_10252098 3300005840 Bacteria 1095
108 Ga0068863_100144845 3300005841 Unclassified 2272
109 Ga0068863_101054238 3300005841 Bacteria 817
110 Ga0068858_100317478 3300005842 Bacteria 1488
111 Ga0068860_100001230 3300005843 Bacteria 27942
112 Ga0068862_100009634 3300005844 Bacteria 7984
113 Ga0068862_100100121 3300005844 Bacteria 2534
114 Ga0068862_100117691 3300005844 Unclassified 2338
115 Ga0068862_100132981 3300005844 Bacteria 2202
116 Ga0068862_100973274 3300005844 Unclassified 838
117 Ga0081455_10370863 3300005937 Bacteria 1003
118 Ga0070715_10079721 3300006163 Bacteria 1483
119 Ga0097621_100045926 3300006237 Bacteria 3531
120 Ga0097621_101053829 3300006237 Unclassified 762
121 Ga0068871_100000120 3300006358 Bacteria 49031
122 Ga0068871_101507868 3300006358 Unclassified 635
123 Ga0075428_100224022 3300006844 Unclassified 2030
124 Ga0075428_100246694 3300006844 Bacteria 1925
125 Ga0075428_100906838 3300006844 Bacteria 935
126 Ga0075428_101179697 3300006844 Bacteria 807
127 Ga0075430_100046667 3300006846 Bacteria 3659
128 Ga0075430_100056622 3300006846 Bacteria 3297
129 Ga0075430_100398811 3300006846 Bacteria 1135
130 Ga0075430_100527181 3300006846 Unclassified 974
131 Ga0075430_100962712 3300006846 Unclassified 703
132 Ga0075430_101050112 3300006846 Unclassified 671
133 Ga0075431_100094541 3300006847 Bacteria 3085
134 Ga0075431_100124186 3300006847 Bacteria 2663
135 Ga0075431_100239197 3300006847 Bacteria 1847
136 Ga0075431_100571820 3300006847 Bacteria 1116
137 Ga0075431_100581297 3300006847 Bacteria 1105
138 Ga0075433_10001178 3300006852 Bacteria 18995
139 Ga0075433_10398282 3300006852 Bacteria 1215
140 Ga0075434_100001217 3300006871 Bacteria 21379
141 Ga0075434_100203175 3300006871 Bacteria 2002
142 Ga0075434_100658967 3300006871 Bacteria 1065
143 Ga0075434_101803343 3300006871 Unclassified 619
144 Ga0075429_100005024 3300006880 Bacteria 11389
145 Ga0075429_100031593 3300006880 Bacteria 4601
146 Ga0075429_100508682 3300006880 Bacteria 1055
147 Ga0075429_100769259 3300006880 Bacteria 843
148 Ga0075429_101629257 3300006880 Bacteria 561
149 Ga0068865_100002861 3300006881 Bacteria 10282
150 Ga0068865_100040371 3300006881 Bacteria 3170
151 Ga0075436_100035671 3300006914 Bacteria 3430
152 Ga0075436_100244127 3300006914 Bacteria 1278
153 Ga0097620_100006034 3300006931 Bacteria 12305
154 Ga0097620_100307891 3300006931 Bacteria 1678
155 Ga0097620_101701404 3300006931 Bacteria 697
156 Ga0097620_101740116 3300006931 Bacteria 689
157 Ga0075435_100000549 3300007076 Bacteria 23038
158 Ga0099794_10019620 3300007265 Bacteria 3051
159 Ga0099794_10067447 3300007265 Bacteria 1747
160 Ga0099794_10195171 3300007265 Bacteria 1036
161 Ga0105250_10221557 3300009092 Unclassified 802
162 Ga0111539_10023101 3300009094 Bacteria 7638
163 Ga0111539_10066729 3300009094 Bacteria 4250
164 Ga0111539_10250772 3300009094 Bacteria 2061
165 Ga0111539_10406612 3300009094 Bacteria 1585
166 Ga0111539_10838013 3300009094 Bacteria 1070
167 Ga0111539_12494943 3300009094 Unclassified 600
168 Ga0105245_10000259 3300009098 Bacteria 50388
169 Ga0114129_10058621 3300009147 Bacteria 5385
170 Ga0114129_10205743 3300009147 Unclassified 2663
171 Ga0114129_11012575 3300009147 Bacteria 1045
172 Ga0114129_11171499 3300009147 Bacteria 959
173 Ga0105243_10015694 3300009148 Bacteria 5728
174 Ga0105243_10016613 3300009148 Bacteria 5566
175 Ga0105241_10065500 3300009174 Bacteria 2808
176 Ga0105242_10001686 3300009176 Bacteria 17502
177 Ga0105242_10706002 3300009176 Bacteria 987
178 Ga0105248_10151197 3300009177 Bacteria 2619
179 Ga0105237_10096519 3300009545 Bacteria 2946
180 Ga0105237_10444517 3300009545 Bacteria 1302
181 Ga0105249_10001070 3300009553 Bacteria 24290
182 Ga0105249_10265598 3300009553 Bacteria 1707
183 Ga0105249_10653902 3300009553 Bacteria 1109
184 Ga0105239_10049991 3300010375 Bacteria 4585
185 Ga0105246_10973188 3300011119 Unclassified 766
186 Ga0157346_1008790 3300012480 Bacteria 703
187 Ga0157378_10000576 3300013297 Bacteria 34686
188 Ga0157378_10798011 3300013297 Bacteria 970
189 Ga0163162_10048344 3300013306 Bacteria 4261
190 Ga0163162_10378285 3300013306 Bacteria 1549
191 Ga0163162_10439433 3300013306 Bacteria 1437
192 Ga0157375_10353764 3300013308 Bacteria 1635
193 Ga0157375_10582921 3300013308 Bacteria 1279
194 Ga0163163_12178762 3300014325 Bacteria 613
195 Ga0157380_10012036 3300014326 Bacteria 6261
196 Ga0157380_10806534 3300014326 Bacteria 956
197 Ga0157377_10045260 3300014745 Bacteria 2458
198 Ga0157377_10811872 3300014745 Bacteria 691
199 Ga0157377_10872072 3300014745 Bacteria 670
200 Ga0157379_10304127 3300014968 Bacteria 1454
201 Ga0157376_10004961 3300014969 Bacteria 9280
202 Ga0207697_10446431 3300025315 Unclassified 573
203 Ga0207653_10012421 3300025885 Bacteria 2659
204 Ga0207642_10002463 3300025899 Bacteria 5763
205 Ga0207685_10000844 3300025905 Bacteria 5737
206 Ga0207685_10053669 3300025905 Bacteria 1566
207 Ga0207685_10239433 3300025905 Bacteria 872
208 Ga0207645_10179043 3300025907 Bacteria 1391
209 Ga0207643_10131994 3300025908 Bacteria 1487
210 Ga0207654_10067712 3300025911 Bacteria 2110
211 Ga0207671_10445052 3300025914 Bacteria 1032
212 Ga0207663_10357647 3300025916 Bacteria 1107
213 Ga0207663_11046189 3300025916 Bacteria 655
214 Ga0207660_10001156 3300025917 Bacteria 17635
215 Ga0207660_10286597 3300025917 Bacteria 1308
216 Ga0207660_10424720 3300025917 Bacteria 1073
217 Ga0207662_10000106 3300025918 Bacteria 40137
218 Ga0207662_10078695 3300025918 Bacteria 2007
219 Ga0207652_10032518 3300025921 Bacteria 4387
220 Ga0207681_10044062 3300025923 Bacteria 2989
221 Ga0207681_10485634 3300025923 Bacteria 1009
222 Ga0207694_11486893 3300025924 Unclassified 572
223 Ga0207659_10732213 3300025926 Bacteria 848
224 Ga0207687_10021347 3300025927 Bacteria 4301
225 Ga0207686_10000883 3300025934 Bacteria 18123
226 Ga0207709_10001408 3300025935 Bacteria 16830
227 Ga0207709_10675100 3300025935 Bacteria 825
228 Ga0207670_10032252 3300025936 Bacteria 3367
229 Ga0207670_10049001 3300025936 Bacteria 2823
230 Ga0207670_10124413 3300025936 Bacteria 1880
231 Ga0207670_10784569 3300025936 Unclassified 793
232 Ga0207669_11540445 3300025937 Bacteria 567
233 Ga0207704_10007809 3300025938 Bacteria 5076
234 Ga0207704_10522775 3300025938 Bacteria 960
235 Ga0207704_10677748 3300025938 Bacteria 851
236 Ga0207665_10567099 3300025939 Bacteria 883
237 Ga0207691_10043567 3300025940 Bacteria 4135
238 Ga0207711_10130101 3300025941 Bacteria 2256
239 Ga0207689_10000376 3300025942 Bacteria 41990
240 Ga0207689_10058600 3300025942 Bacteria 3167
241 Ga0207689_10091991 3300025942 Bacteria 2492
242 Ga0207689_10715896 3300025942 Bacteria 844
243 Ga0207667_10016778 3300025949 Bacteria 8263
244 Ga0207667_10330360 3300025949 Bacteria 1557
245 Ga0207651_10075140 3300025960 Bacteria 2410
246 Ga0207651_10226604 3300025960 Unclassified 1514
247 Ga0207651_10254357 3300025960 Bacteria 1439
248 Ga0207651_10818793 3300025960 Bacteria 826
249 Ga0207712_10030519 3300025961 Bacteria 3624
250 Ga0207668_11405169 3300025972 Bacteria 629
251 Ga0207640_10028259 3300025981 Bacteria 3427
252 Ga0207677_10070095 3300026023 Bacteria 2469
253 Ga0207677_10753790 3300026023 Bacteria 868
254 Ga0207703_10023514 3300026035 Bacteria 4842
255 Ga0207708_10016505 3300026075 Bacteria 5554
256 Ga0207708_10096952 3300026075 Bacteria 2279
257 Ga0207708_10148086 3300026075 Bacteria 1846
258 Ga0207702_10025636 3300026078 Bacteria 4894
259 Ga0207702_10244294 3300026078 Bacteria 1683
260 Ga0207641_10244509 3300026088 Bacteria 1673
261 Ga0207648_10000369 3300026089 Bacteria 49386
262 Ga0207648_10023397 3300026089 Bacteria 5534
263 Ga0207676_10200633 3300026095 Bacteria 1762
264 Ga0207676_10532363 3300026095 Bacteria 1120
265 Ga0207674_10209799 3300026116 Bacteria 1897
266 Ga0207675_100002170 3300026118 Bacteria 19503
267 Ga0207675_100004506 3300026118 Bacteria 13456
268 Ga0207675_100115848 3300026118 Bacteria 2532
269 Ga0207683_10323175 3300026121 Bacteria 1413
270 Ga0207698_10204440 3300026142 Bacteria 1771
271 Ga0209967_1031423 3300027364 Bacteria 795
272 Ga0209981_1010714 3300027378 Unclassified 1260
273 Ga0209996_1011418 3300027395 Unclassified 1186
274 Ga0210000_1019025 3300027462 Unclassified 1045
275 Ga0209995_1036755 3300027471 Unclassified 824
276 Ga0209999_1078219 3300027543 Unclassified 637
277 Ga0209999_1113388 3300027543 Unclassified 530
278 Ga0209982_1058843 3300027552 Unclassified 624
279 Ga0209588_1009181 3300027671 Bacteria 2949
280 Ga0209588_1044313 3300027671 Bacteria 1439
281 Ga0209971_1002369 3300027682 Bacteria 4549
282 Ga0209966_1065575 3300027695 Unclassified 790
283 Ga0209974_10021186 3300027876 Bacteria 2153
284 Ga0207428_10056581 3300027907 Bacteria 3116
285 Ga0207428_10197767 3300027907 Unclassified 1513
286 Ga0268265_10001333 3300028380 Bacteria 21108
287 Ga0268265_10292366 3300028380 Unclassified 1463
288 Ga0268264_10001450 3300028381 Bacteria 22200
289 Ga0307408_100035927 3300031548 Bacteria 3480
290 Ga0307408_100700443 3300031548 Bacteria 910
291 Ga0307405_10450637 3300031731 Bacteria 1020
292 Ga0307410_10327131 3300031852 Bacteria 1218
293 Ga0307407_10207850 3300031903 Bacteria 1316
294 Ga0307409_101135992 3300031995 Unclassified 803
295 Ga0307416_100034206 3300032002 Bacteria 3864
296 Ga0307416_100165906 3300032002 Bacteria 2048
297 Ga0307411_10450218 3300032005 Bacteria 1077
298 Ga0373930_0004645 3300034816 Bacteria 2247
299 Ga0373948_0008200 3300034817 Bacteria 1774
300 Ga0373950_0002063 3300034818 Bacteria 2724
301 Ga0373958_0008124 3300034819 Unclassified 1692
302 Ga0373959_0005159 3300034820 Bacteria 2138
303 Ga0373928_0002841 3300035084 Bacteria 3338
304 Ga0373929_0008161 3300035085 Bacteria 1927
305 Ga0373940_0017306 3300035088 Bacteria 1796
306 Ga0373944_0011272 3300035089 Bacteria 2446
307 Ga0373949_0020097 3300035090 Bacteria 1526
308 Ga0373952_0249653 3300035092 Bacteria 537
309 Ga0373923_0387169 3300035111 Unclassified 671
310 Ga0373932_0250153 3300035112 Unclassified 646
311 Ga0373939_0000843 3300035114 Bacteria 7604
312 Ga0373941_0076758 3300035115 Bacteria 1120
313 Ga0373945_0000803 3300035116 Bacteria 9198
314 Ga0373953_0019607 3300035117 Bacteria 2518
315 Ga0373954_0000025 3300035118 Bacteria 57365
316 Ga0373954_0468917 3300035118 Bacteria 624
317 Ga0373957_0416913 3300035120 Unclassified 579
318 Ga0373960_0081733 3300035121 Bacteria 1018
319 Ga0373943_0017959 3300035170 Bacteria 3244
320 Ga0373943_0043183 3300035170 Bacteria 2188
321 Ga0373955_0090708 3300035172 Bacteria 1741
322 Ga0373942_0017248 3300035207 Bacteria 1778
323 Ga0373942_0024601 3300035207 Bacteria 1545
324 Ga0373942_0116589 3300035207 Bacteria 831
325 Ga0373961_0033576 3300035241 Unclassified 1446
326 Ga0373962_0045832 3300035242 Unclassified 1246
327 Ga0373962_0097040 3300035242 Bacteria 915
328 Ga0373924_0025146 3300035410 Bacteria 2352
329 Ga0373931_0000757 3300035691 Bacteria 13493
330 Ga0373931_0030990 3300035691 Bacteria 2756
331 Ga0373931_0902126 3300035691 Bacteria 594
332 Ga0373935_0084677 3300035692 Unclassified 2065
333 Ga0373927_0004507 3300035695 Bacteria 9742
334 Ga0373933_0009587 3300035724 Bacteria 5287
335 Ga0373947_0023879 3300035725 Bacteria 3559
336 Ga0373947_0065372 3300035725 Bacteria 2218
337 Ga0373937_0000296 3300036401 Bacteria 47231
338 Ga0373937_0420667 3300036401 Bacteria 1268
339 Ga0373925_0084870 3300037068 Bacteria 2413
340 Ga0373925_0144241 3300037068 Bacteria 1865
341 Ga0439453_0006709 3300041408 Bacteria 1804
342 Ga0451798_0434765 3300041458 Unclassified 1006
343 Ga0439441_002673 3300042001 Bacteria 2535
344 Ga0439441_002805 3300042001 Bacteria 2493
345 Ga0439441_075627 3300042001 Bacteria 727
346 Ga0439443_001850 3300042003 Bacteria 2433
347 Ga0439443_003516 3300042003 Bacteria 1980
348 Ga0450912_001908 3300042116 Bacteria 1340
349 Ga0439435_0001098 3300042436 Bacteria 4820
350 Ga0439435_0115476 3300042436 Bacteria 836
351 Ga0439444_0013279 3300042437 Bacteria 1362
352 Ga0439464_0029632 3300042439 Bacteria 1530
353 Ga0439460_0002280 3300042461 Bacteria 4618
354 Ga0439440_0122219 3300042993 Unclassified 726
355 Ga0453683_0301783 3300044673 Bacteria 1025
356 Ga0451576_0019708 3300045051 Bacteria 7361
357 Ga0451576_0086242 3300045051 Bacteria 3265
358 Ga0451576_0413739 3300045051 Bacteria 1414
359 Ga0451576_1709527 3300045051 Bacteria 651
360 Ga0495592_0054986 3300046454 Bacteria 2946
361 Ga0495592_0245129 3300046454 Bacteria 1187
362 Ga0495603_0002444 3300046455 Bacteria 10930
363 Ga0495580_0014828 3300046472 Bacteria 5906
364 Ga0495582_0214431 3300046473 Unclassified 1101
365 Ga0495639_0284630 3300046475 Unclassified 822
366 Ga0495662_0042761 3300046476 Bacteria 2187
367 Ga0495662_0112671 3300046476 Bacteria 1333
368 Ga0495594_0088660 3300046499 Bacteria 1732
369 Ga0495608_0003114 3300046511 Bacteria 11849
370 Ga0495608_0268199 3300046511 Unclassified 1062
371 Ga0495618_0241270 3300046514 Bacteria 1136
372 Ga0495628_0003126 3300046516 Bacteria 14870
373 Ga0495628_0252454 3300046516 Bacteria 1316
374 Ga0495630_0093151 3300046517 Bacteria 2277
375 Ga0495630_0235832 3300046517 Unclassified 1398
376 Ga0495630_0255696 3300046517 Bacteria 1338
377 Ga0495632_0341681 3300046519 Bacteria 659
378 Ga0495666_0012596 3300046526 Bacteria 4215
379 Ga0495666_0031611 3300046526 Bacteria 2593
380 Ga0495640_0026929 3300046533 Bacteria 4149
381 Ga0495640_0161317 3300046533 Bacteria 1436
382 Ga0495586_0002520 3300046535 Bacteria 9923
383 Ga0495586_0007991 3300046535 Bacteria 5643
384 Ga0495586_0084587 3300046535 Bacteria 1746
385 Ga0495587_0304803 3300046536 Bacteria 890
386 Ga0495587_0816520 3300046536 Bacteria 509
387 Ga0495598_0014252 3300046537 Bacteria 1986
388 Ga0495621_0121421 3300046539 Unclassified 1010
389 Ga0495621_0127489 3300046539 Bacteria 988
390 Ga0495621_0136267 3300046539 Bacteria 958
391 Ga0495667_0711713 3300046559 Bacteria 622
392 Ga0495656_0095620 3300046615 Bacteria 1366
393 Ga0495634_0015948 3300046642 Bacteria 5382
394 Ga0495634_0019528 3300046642 Bacteria 4814
395 Ga0495599_0192532 3300046678 Bacteria 1254
396 Ga0495623_0341826 3300046679 Bacteria 817
397 Ga0495647_0008364 3300046681 Bacteria 3477
398 Ga0495647_0080515 3300046681 Bacteria 1320
399 Ga0495658_0016177 3300046683 Bacteria 3839
400 Ga0495658_0126672 3300046683 Bacteria 1550
401 Ga0495669_0212004 3300046684 Bacteria 927
402 Ga0495613_0502523 3300046689 Unclassified 816
403 Ga0495624_0071460 3300046690 Bacteria 2159
404 Ga0495624_0171823 3300046690 Bacteria 1322
405 Ga0495600_0017655 3300046809 Bacteria 4540
406 Ga0495581_0054153 3300047315 Bacteria 2316
407 Ga0495581_0196768 3300047315 Bacteria 1179
408 Ga0495604_0012460 3300047317 Bacteria 6763
409 Ga0495604_0507987 3300047317 Bacteria 781
410 Ga0495636_0003637 3300047318 Bacteria 5986
411 Ga0495636_0410717 3300047318 Unclassified 646
412 Ga0495674_0302768 3300047319 Unclassified 1305
413 Ga0495676_0033938 3300047321 Bacteria 4288
414 Ga0495680_0001252 3300047322 Bacteria 27832
415 Ga0495675_0344130 3300047444 Bacteria 878
416 Ga0495675_0458868 3300047444 Bacteria 736
417 Ga0495593_0129245 3300047673 Bacteria 1283
418 Ga0495593_0443864 3300047673 Unclassified 649
419 Ga0496102_1191361 3300048905 Unclassified 681
420 Ga0496104_1336030 3300048907 Bacteria 620
421 Ga0496108_1011850 3300048911 Bacteria 709
422 Ga0496110_0480501 3300048913 Bacteria 1132
423 Ga0496111_0177314 3300048914 Bacteria 1584
424 Ga0501031_0128239 3300049568 Bacteria 1657
425 Ga0501031_0315176 3300049568 Bacteria 1013
426 Ga0501032_0135795 3300049569 Bacteria 1621
427 Ga0501033_0006483 3300049570 Bacteria 9157
428 Ga0501033_0064748 3300049570 Bacteria 2690
429 Ga0501033_0176408 3300049570 Bacteria 1533
430 Ga0501034_0228161 3300049571 Bacteria 1812
431 Ga0501036_0001252 3300049572 Bacteria 19463
432 Ga0501036_0139919 3300049572 Bacteria 2042
433 Ga0501036_0153867 3300049572 Bacteria 1940
434 Ga0501036_0260633 3300049572 Bacteria 1452
435 Ga0501036_0487825 3300049572 Bacteria 1026
436 Ga0501036_1682518 3300049572 Bacteria 511
437 Ga0501037_0059065 3300049573 Bacteria 2798
438 Ga0501038_0001280 3300049574 Bacteria 22839
439 Ga0501038_0162383 3300049574 Bacteria 1814
440 Ga0501038_0224201 3300049574 Unclassified 1499
441 Ga0501038_0501590 3300049574 Bacteria 928
442 Ga0501038_0606154 3300049574 Bacteria 828
443 Ga0501039_0003867 3300049575 Bacteria 11243
444 Ga0501039_0011180 3300049575 Bacteria 6839
445 Ga0501039_0068920 3300049575 Bacteria 2746
446 Ga0501039_0130960 3300049575 Bacteria 1969
447 Ga0501039_0162058 3300049575 Bacteria 1758
448 Ga0501040_0000052 3300049576 Bacteria 54195
449 Ga0501040_0014654 3300049576 Bacteria 5170
450 Ga0501040_0040385 3300049576 Bacteria 3175
451 Ga0501040_0137477 3300049576 Bacteria 1720
452 Ga0501040_1072328 3300049576 Unclassified 584
453 Ga0501041_0004912 3300049577 Bacteria 7767
454 Ga0501041_0007062 3300049577 Bacteria 6589
455 Ga0501041_0021075 3300049577 Bacteria 3904
456 Ga0501041_0048287 3300049577 Bacteria 2592
457 Ga0501041_0133537 3300049577 Bacteria 1546
458 Ga0501041_0332119 3300049577 Unclassified 960
459 Ga0501041_0385927 3300049577 Bacteria 886
460 Ga0501041_0634247 3300049577 Unclassified 683
461 Ga0501042_0000048 3300049578 Bacteria 40877
462 Ga0501042_0082936 3300049578 Bacteria 2298
463 Ga0501042_0089138 3300049578 Bacteria 2213
464 Ga0501042_0098856 3300049578 Bacteria 2098
465 Ga0501042_0254314 3300049578 Bacteria 1268
466 Ga0501042_0375749 3300049578 Bacteria 1029
467 Ga0501042_0388668 3300049578 Bacteria 1010
468 Ga0501042_1145217 3300049578 Bacteria 567
469 Ga0501043_0267785 3300049579 Bacteria 1312
470 Ga0501043_0888998 3300049579 Unclassified 639
471 Ga0501046_0000271 3300049580 Bacteria 52841
472 Ga0501046_0033342 3300049580 Bacteria 4162
473 Ga0501046_0169694 3300049580 Unclassified 1638
474 Ga0501046_0299664 3300049580 Bacteria 1174
475 Ga0501046_0320880 3300049580 Bacteria 1129
476 Ga0501046_0820828 3300049580 Bacteria 651
477 Ga0501047_0968679 3300049581 Unclassified 664
478 Ga0501047_1116506 3300049581 Unclassified 602
479 Ga0501048_0001409 3300049582 Bacteria 18204
480 Ga0501048_0012758 3300049582 Bacteria 6248
481 Ga0501048_0075515 3300049582 Bacteria 2378
482 Ga0501048_0107314 3300049582 Bacteria 1971
483 Ga0501048_0191710 3300049582 Bacteria 1448
484 Ga0501048_0242220 3300049582 Bacteria 1280
485 Ga0501068_0001255 3300049584 Bacteria 13472
486 Ga0501068_0244803 3300049584 Bacteria 1142
487 Ga0501069_0237927 3300049585 Unclassified 1061
488 Ga0501070_0050478 3300049586 Bacteria 3454
489 Ga0501070_1032761 3300049586 Bacteria 636
490 Ga0501070_1057055 3300049586 Bacteria 628
491 Ga0501070_1122520 3300049586 Bacteria 606
492 Ga0501071_0004018 3300049587 Bacteria 9285
493 Ga0501071_0042588 3300049587 Bacteria 3254
494 Ga0501071_0171196 3300049587 Bacteria 1625
495 Ga0501071_0235177 3300049587 Bacteria 1381
496 Ga0501071_0373149 3300049587 Bacteria 1087
497 Ga0501071_0536636 3300049587 Bacteria 898
498 Ga0501072_0003349 3300049588 Bacteria 12056
499 Ga0501072_0007259 3300049588 Bacteria 8408
500 Ga0501072_0077568 3300049588 Bacteria 2630
501 Ga0501072_0295779 3300049588 Bacteria 1287
502 Ga0501072_0382906 3300049588 Bacteria 1116
503 Ga0501072_0463748 3300049588 Bacteria 1003
504 Ga0501072_0505204 3300049588 Unclassified 956
505 Ga0501072_0567784 3300049588 Bacteria 895
506 Ga0501073_0292830 3300049589 Bacteria 1123
507 Ga0501074_0185062 3300049590 Bacteria 1485
508 Ga0501074_0596145 3300049590 Bacteria 781
509 Ga0501075_0000751 3300049591 Bacteria 20223
510 Ga0501075_0001243 3300049591 Bacteria 16533
511 Ga0501075_0004209 3300049591 Bacteria 9719
512 Ga0501075_0006255 3300049591 Bacteria 8186
513 Ga0501075_0318341 3300049591 Bacteria 1185
514 Ga0501075_0370922 3300049591 Bacteria 1091
515 Ga0501076_0000290 3300049592 Bacteria 31327
516 Ga0501076_0004123 3300049592 Bacteria 10278
517 Ga0501076_0006671 3300049592 Bacteria 8374
518 Ga0501076_0049968 3300049592 Bacteria 3308
519 Ga0501076_0422233 3300049592 Bacteria 1097
520 Ga0501076_0446732 3300049592 Bacteria 1064
521 Ga0501077_0013249 3300049593 Bacteria 5167
522 Ga0501077_0075065 3300049593 Bacteria 2141
523 Ga0501077_0130649 3300049593 Unclassified 1592
524 Ga0501077_0194241 3300049593 Unclassified 1289
525 Ga0501077_0214809 3300049593 Bacteria 1222
526 Ga0501077_0387852 3300049593 Bacteria 892
527 Ga0501217_268940 3300049661 Bacteria 555
528 Ga0501079_0000061 3300049741 Bacteria 48925
529 Ga0501079_0007164 3300049741 Bacteria 8418
530 Ga0501079_0008802 3300049741 Bacteria 7649
531 Ga0501079_0263103 3300049741 Bacteria 1348
532 Ga0501080_0023332 3300049742 Bacteria 5737
533 Ga0501080_0072729 3300049742 Bacteria 3199
534 Ga0501080_0093367 3300049742 Bacteria 2794
535 Ga0501080_0189211 3300049742 Bacteria 1892
536 Ga0501080_0718718 3300049742 Bacteria 880
537 Ga0501081_0000110 3300049743 Bacteria 34989
538 Ga0501081_0017440 3300049743 Bacteria 4752
539 Ga0501081_0019693 3300049743 Bacteria 4495
540 Ga0501081_0138525 3300049743 Bacteria 1743
541 Ga0501081_0180246 3300049743 Bacteria 1528
542 Ga0501083_0062766 3300049744 Bacteria 2479
543 Ga0501083_0288170 3300049744 Bacteria 1068
544 Ga0501035_0025479 3300049822 Bacteria 5422
545 Ga0501035_0064885 3300049822 Bacteria 3244
546 Ga0501045_0002891 3300049824 Bacteria 11734
547 Ga0501045_0003109 3300049824 Bacteria 11349
548 Ga0501045_0046875 3300049824 Bacteria 3147
549 Ga0501045_0421884 3300049824 Bacteria 992
550 Ga0501045_0584635 3300049824 Unclassified 827
551 Ga0501045_0876077 3300049824 Bacteria 660
552 Ga0501045_1180477 3300049824 Unclassified 559
553 nmdc:mga05p37_158605_c1 3300050507 Bacteria 2764
554 nmdc:mga05p37_182086_c1 3300050507 Bacteria 2555
555 nmdc:mga05p37_822026_c1 3300050507 Bacteria 1013
556 nmdc:mga09592_1286525_c1 3300050508 Bacteria 602
557 nmdc:mga09592_308869_c1 3300050508 Bacteria 1371
558 nmdc:mga09592_840078_c1 3300050508 Bacteria 775
559 nmdc:mga0qj67_12428_c1 3300050509 Bacteria 6414
560 nmdc:mga0qj67_38378_c1 3300050509 Bacteria 3757
561 nmdc:mga0qj67_429707_c1 3300050509 Bacteria 1065
562 nmdc:mga0qj67_606262_c1 3300050509 Bacteria 876
563 nmdc:mga0qj67_869443_c1 3300050509 Unclassified 711
564 nmdc:mga06r32_244463_c1 3300050510 Bacteria 1782
565 nmdc:mga06r32_306953_c1 3300050510 Unclassified 1572
566 nmdc:mga06r32_417511_c1 3300050510 Bacteria 1323
567 nmdc:mga06r32_539078_c1 3300050510 Unclassified 1142
568 nmdc:mga08y16_122930_c1 3300050511 Bacteria 2701
569 nmdc:mga08y16_165342_c1 3300050511 Bacteria 2299
570 nmdc:mga08y16_291646_c1 3300050511 Bacteria 1682
571 nmdc:mga08y16_508132_c1 3300050511 Bacteria 1224
572 nmdc:mga08y16_58516_c1 3300050511 Bacteria 4027
573 nmdc:mga0n895_12822_c1 3300050512 Bacteria 7531
574 nmdc:mga0n895_332827_c1 3300050512 Unclassified 1538
575 nmdc:mga0n895_42989_c1 3300050512 Bacteria 4400
576 nmdc:mga0n895_637378_c1 3300050512 Unclassified 1065
577 nmdc:mga0rr50_23642_c1 3300050513 Bacteria 4242
578 nmdc:mga0rr50_440041_c1 3300050513 Bacteria 1104
579 nmdc:mga0rr50_73863_c1 3300050513 Bacteria 2608
580 nmdc:mga08x19_5960_c1 3300050514 Bacteria 7209
581 nmdc:mga0a205_1704_c1 3300050515 Bacteria 18985
582 nmdc:mga0a205_376390_c1 3300050515 Bacteria 1285
583 Ga0495601_0186945 3300053077 Bacteria 1354
584 Ga0501084_0001172 3300054114 Bacteria 20445
585 Ga0501084_0077254 3300054114 Bacteria 2791
586 Ga0501084_0568026 3300054114 Bacteria 958
587 Ga0501084_0786754 3300054114 Unclassified 801
588 Ga0590071_012766 3300059421 Bacteria 1969
589 Ga0501082_0000430 3300060353 Bacteria 37227
590 Ga0501082_0006714 3300060353 Bacteria 9953
591 Ga0501082_0065190 3300060353 Bacteria 3137
592 Ga0501082_0525503 3300060353 Bacteria 1034
593 Ga0501082_1081139 3300060353 Bacteria 701
594 Ga0530510_0000048 3300061734 Bacteria 56268
595 Ga0530510_0000186 3300061734 Bacteria 37940
596 Ga0530510_0078101 3300061734 Bacteria 2406
597 Ga0530510_0924785 3300061734 Bacteria 667

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005844 Ga0068862_100117691 Ga0068862_1001176912 107
2 3300009553 Ga0105249_10653902 Ga0105249_106539023 107
3 3300013306 Ga0163162_10048344 Ga0163162_100483448 107
4 3300028380 Ga0268265_10292366 Ga0268265_102923661 107
5 3300006846 Ga0075430_100398811 Ga0075430_1003988112 122
6 3300006846 Ga0075430_100527181 Ga0075430_1005271812 122
7 3300006847 Ga0075431_100124186 Ga0075431_1001241863 122
8 3300006880 Ga0075429_100769259 Ga0075429_1007692592 122
9 3300009147 Ga0114129_10205743 Ga0114129_102057433 122
10 3300027364 Ga0209967_1031423 Ga0209967_10314232 122
11 3300027378 Ga0209981_1010714 Ga0209981_10107142 122
12 3300027395 Ga0209996_1011418 Ga0209996_10114182 122
13 3300027471 Ga0209995_1036755 Ga0209995_10367552 122
14 3300027552 Ga0209982_1058843 Ga0209982_10588432 122
15 3300027682 Ga0209971_1002369 Ga0209971_10023694 122
16 3300027876 Ga0209974_10021186 Ga0209974_100211861 122
17 3300041408 Ga0439453_0006709 Ga0439453_0006709_690_1058 122
18 3300042001 Ga0439441_002673 Ga0439441_002673_463_831 122
19 3300042003 Ga0439443_003516 Ga0439443_003516_121_489 122
20 3300042436 Ga0439435_0115476 Ga0439435_0115476_452_820 122
21 3300050507 nmdc:mga05p37_182086_c1 nmdc:mga05p37_182086_c1_516_884 122
22 3300050509 nmdc:mga0qj67_429707_c1 nmdc:mga0qj67_429707_c1_318_686 122
23 3300050510 nmdc:mga06r32_539078_c1 nmdc:mga06r32_539078_c1_177_545 122
24 3300005330 Ga0070690_100865050 Ga0070690_1008650502 123
25 3300005354 Ga0070675_101166531 Ga0070675_1011665312 123
26 3300005364 Ga0070673_100205175 Ga0070673_1002051754 123
27 3300005444 Ga0070694_100085942 Ga0070694_1000859423 123
28 3300005459 Ga0068867_100853816 Ga0068867_1008538162 123
29 3300005536 Ga0070697_100212412 Ga0070697_1002124123 123
30 3300005545 Ga0070695_100527046 Ga0070695_1005270462 123
31 3300005545 Ga0070695_100573069 Ga0070695_1005730692 123
32 3300005546 Ga0070696_100376353 Ga0070696_1003763531 123
33 3300005549 Ga0070704_100626626 Ga0070704_1006266262 123
34 3300005617 Ga0068859_101701454 Ga0068859_1017014542 123
35 3300005844 Ga0068862_100973274 Ga0068862_1009732742 123
36 3300006237 Ga0097621_101053829 Ga0097621_1010538292 123
37 3300006871 Ga0075434_100203175 Ga0075434_1002031753 123
38 3300006871 Ga0075434_100658967 Ga0075434_1006589673 123
39 3300006871 Ga0075434_101803343 Ga0075434_1018033432 123
40 3300006931 Ga0097620_101701404 Ga0097620_1017014042 123
41 3300009094 Ga0111539_10066729 Ga0111539_100667293 123
42 3300014325 Ga0163163_12178762 Ga0163163_121787621 123
43 3300025936 Ga0207670_10049001 Ga0207670_100490014 123
44 3300025939 Ga0207665_10567099 Ga0207665_105670992 123
45 3300025960 Ga0207651_10075140 Ga0207651_100751405 123
46 3300026095 Ga0207676_10532363 Ga0207676_105323633 123
47 3300027543 Ga0209999_1113388 Ga0209999_11133882 123
48 3300035111 Ga0373923_0387169 Ga0373923_0387169_57_428 123
49 3300035117 Ga0373953_0019607 Ga0373953_0019607_1691_2062 123
50 3300035118 Ga0373954_0000025 Ga0373954_0000025_1281_1652 123
51 3300035120 Ga0373957_0416913 Ga0373957_0416913_69_440 123
52 3300035172 Ga0373955_0090708 Ga0373955_0090708_1089_1460 123
53 3300035410 Ga0373924_0025146 Ga0373924_0025146_1290_1661 123
54 3300035724 Ga0373933_0009587 Ga0373933_0009587_4080_4451 123
55 3300036401 Ga0373937_0000296 Ga0373937_0000296_32304_32675 123
56 3300041458 Ga0451798_0434765 Ga0451798_0434765_105_476 123
57 3300044673 Ga0453683_0301783 Ga0453683_0301783_40_411 123
58 3300045051 Ga0451576_0413739 Ga0451576_0413739_743_1114 123
59 3300046454 Ga0495592_0054986 Ga0495592_0054986_1932_2303 123
60 3300046475 Ga0495639_0284630 Ga0495639_0284630_310_681 123
61 3300046476 Ga0495662_0042761 Ga0495662_0042761_635_1006 123
62 3300046476 Ga0495662_0112671 Ga0495662_0112671_221_592 123
63 3300046511 Ga0495608_0003114 Ga0495608_0003114_6206_6577 123
64 3300046511 Ga0495608_0268199 Ga0495608_0268199_462_833 123
65 3300046514 Ga0495618_0241270 Ga0495618_0241270_299_670 123
66 3300046516 Ga0495628_0003126 Ga0495628_0003126_13120_13491 123
67 3300046517 Ga0495630_0093151 Ga0495630_0093151_359_730 123
68 3300046517 Ga0495630_0255696 Ga0495630_0255696_352_723 123
69 3300046526 Ga0495666_0031611 Ga0495666_0031611_525_896 123
70 3300046533 Ga0495640_0026929 Ga0495640_0026929_3106_3477 123
71 3300046533 Ga0495640_0161317 Ga0495640_0161317_401_772 123
72 3300046535 Ga0495586_0002520 Ga0495586_0002520_639_1010 123
73 3300046535 Ga0495586_0084587 Ga0495586_0084587_604_975 123
74 3300046536 Ga0495587_0304803 Ga0495587_0304803_265_636 123
75 3300046536 Ga0495587_0816520 Ga0495587_0816520_100_471 123
76 3300046539 Ga0495621_0136267 Ga0495621_0136267_168_539 123
77 3300046642 Ga0495634_0015948 Ga0495634_0015948_2267_2638 123
78 3300046642 Ga0495634_0019528 Ga0495634_0019528_2903_3274 123
79 3300046681 Ga0495647_0080515 Ga0495647_0080515_512_883 123
80 3300046683 Ga0495658_0126672 Ga0495658_0126672_836_1207 123
81 3300046689 Ga0495613_0502523 Ga0495613_0502523_148_519 123
82 3300046690 Ga0495624_0071460 Ga0495624_0071460_736_1107 123
83 3300046690 Ga0495624_0171823 Ga0495624_0171823_746_1117 123
84 3300046809 Ga0495600_0017655 Ga0495600_0017655_2855_3226 123
85 3300047315 Ga0495581_0196768 Ga0495581_0196768_657_1028 123
86 3300047317 Ga0495604_0012460 Ga0495604_0012460_5750_6121 123
87 3300047317 Ga0495604_0507987 Ga0495604_0507987_145_516 123
88 3300047318 Ga0495636_0003637 Ga0495636_0003637_1123_1494 123
89 3300047319 Ga0495674_0302768 Ga0495674_0302768_777_1148 123
90 3300047322 Ga0495680_0001252 Ga0495680_0001252_21692_22063 123
91 3300047444 Ga0495675_0344130 Ga0495675_0344130_457_828 123
92 3300047673 Ga0495593_0129245 Ga0495593_0129245_664_1035 123
93 3300047673 Ga0495593_0443864 Ga0495593_0443864_22_393 123
94 3300050511 nmdc:mga08y16_291646_c1 nmdc:mga08y16_291646_c1_976_1347 123
95 3300050512 nmdc:mga0n895_42989_c1 nmdc:mga0n895_42989_c1_2706_3077 123
96 3300050512 nmdc:mga0n895_637378_c1 nmdc:mga0n895_637378_c1_392_763 123
97 3300050513 nmdc:mga0rr50_440041_c1 nmdc:mga0rr50_440041_c1_128_499 123
98 3300050513 nmdc:mga0rr50_73863_c1 nmdc:mga0rr50_73863_c1_1665_2036 123
99 3300053077 Ga0495601_0186945 Ga0495601_0186945_477_848 123
100 3300005345 Ga0070692_10023013 Ga0070692_100230133 124
101 3300005437 Ga0070710_10536640 Ga0070710_105366402 124
102 3300005440 Ga0070705_100045456 Ga0070705_1000454562 124
103 3300005444 Ga0070694_100052420 Ga0070694_1000524203 124
104 3300005546 Ga0070696_100155071 Ga0070696_1001550713 124
105 3300005549 Ga0070704_100052885 Ga0070704_1000528853 124
106 3300005615 Ga0070702_100423905 Ga0070702_1004239052 124
107 3300006846 Ga0075430_100056622 Ga0075430_1000566224 124
108 3300006847 Ga0075431_100239197 Ga0075431_1002391972 124
109 3300009147 Ga0114129_11012575 Ga0114129_110125752 124
110 3300049572 Ga0501036_1682518 Ga0501036_1682518_92_466 124
111 3300049586 Ga0501070_1032761 Ga0501070_1032761_205_579 124
112 3300049588 Ga0501072_0505204 Ga0501072_0505204_561_938 124
113 3300050507 nmdc:mga05p37_822026_c1 nmdc:mga05p37_822026_c1_238_612 124
114 3300050509 nmdc:mga0qj67_12428_c1 nmdc:mga0qj67_12428_c1_2200_2595 124
115 3300050510 nmdc:mga06r32_244463_c1 nmdc:mga06r32_244463_c1_906_1301 124
116 3300061734 Ga0530510_0924785 Ga0530510_0924785_211_585 124
117 3300005295 Ga0065707_10350879 Ga0065707_103508792 125
118 3300005328 Ga0070676_10148336 Ga0070676_101483362 125
119 3300005330 Ga0070690_100011005 Ga0070690_1000110052 125
120 3300005331 Ga0070670_100595906 Ga0070670_1005959062 125
121 3300005331 Ga0070670_100917462 Ga0070670_1009174621 125
122 3300005334 Ga0068869_100001027 Ga0068869_1000010272 125
123 3300005334 Ga0068869_100050719 Ga0068869_1000507193 125
124 3300005334 Ga0068869_100067547 Ga0068869_1000675472 125
125 3300005334 Ga0068869_100087161 Ga0068869_1000871613 125
126 3300005335 Ga0070666_10172462 Ga0070666_101724623 125
127 3300005336 Ga0070680_100012102 Ga0070680_1000121025 125
128 3300005336 Ga0070680_100044924 Ga0070680_1000449242 125
129 3300005338 Ga0068868_100000169 Ga0068868_1000001699 125
130 3300005338 Ga0068868_101746724 Ga0068868_1017467241 125
131 3300005340 Ga0070689_100107883 Ga0070689_1001078832 125
132 3300005340 Ga0070689_100145621 Ga0070689_1001456213 125
133 3300005340 Ga0070689_100262685 Ga0070689_1002626851 125
134 3300005341 Ga0070691_10023775 Ga0070691_100237753 125
135 3300005341 Ga0070691_10029702 Ga0070691_100297022 125
136 3300005341 Ga0070691_10477266 Ga0070691_104772662 125
137 3300005343 Ga0070687_100000112 Ga0070687_10000011230 125
138 3300005343 Ga0070687_100058115 Ga0070687_1000581153 125
139 3300005344 Ga0070661_101006471 Ga0070661_1010064711 125
140 3300005345 Ga0070692_10000260 Ga0070692_100002607 125
141 3300005353 Ga0070669_100201390 Ga0070669_1002013902 125
142 3300005353 Ga0070669_100280704 Ga0070669_1002807042 125
143 3300005354 Ga0070675_100052510 Ga0070675_1000525102 125
144 3300005354 Ga0070675_101085039 Ga0070675_1010850391 125
145 3300005356 Ga0070674_101490659 Ga0070674_1014906591 125
146 3300005364 Ga0070673_100485666 Ga0070673_1004856661 125
147 3300005364 Ga0070673_100508007 Ga0070673_1005080072 125
148 3300005365 Ga0070688_100217086 Ga0070688_1002170862 125
149 3300005365 Ga0070688_100248287 Ga0070688_1002482872 125
150 3300005406 Ga0070703_10003990 Ga0070703_100039903 125
151 3300005438 Ga0070701_10000840 Ga0070701_100008403 125
152 3300005438 Ga0070701_10220157 Ga0070701_102201572 125
153 3300005438 Ga0070701_10414510 Ga0070701_104145102 125
154 3300005439 Ga0070711_100486724 Ga0070711_1004867241 125
155 3300005439 Ga0070711_101118454 Ga0070711_1011184542 125
156 3300005440 Ga0070705_100000991 Ga0070705_10000099120 125
157 3300005440 Ga0070705_100467373 Ga0070705_1004673731 125
158 3300005441 Ga0070700_100005957 Ga0070700_1000059573 125
159 3300005441 Ga0070700_100078017 Ga0070700_1000780172 125
160 3300005441 Ga0070700_100523958 Ga0070700_1005239582 125
161 3300005444 Ga0070694_100000608 Ga0070694_1000006082 125
162 3300005444 Ga0070694_100007608 Ga0070694_1000076082 125
163 3300005444 Ga0070694_100147677 Ga0070694_1001476772 125
164 3300005444 Ga0070694_100874122 Ga0070694_1008741222 125
165 3300005456 Ga0070678_100505942 Ga0070678_1005059422 125
166 3300005457 Ga0070662_100244832 Ga0070662_1002448322 125
167 3300005458 Ga0070681_10155515 Ga0070681_101555153 125
168 3300005458 Ga0070681_11435882 Ga0070681_114358821 125
169 3300005459 Ga0068867_100001181 Ga0068867_10000118110 125
170 3300005467 Ga0070706_101531988 Ga0070706_1015319882 125
171 3300005518 Ga0070699_100547711 Ga0070699_1005477112 125
172 3300005530 Ga0070679_100161927 Ga0070679_1001619273 125
173 3300005536 Ga0070697_100002931 Ga0070697_1000029316 125
174 3300005536 Ga0070697_101318485 Ga0070697_1013184852 125
175 3300005543 Ga0070672_100204208 Ga0070672_1002042083 125
176 3300005543 Ga0070672_100229637 Ga0070672_1002296372 125
177 3300005544 Ga0070686_100033276 Ga0070686_1000332762 125
178 3300005545 Ga0070695_100036056 Ga0070695_1000360566 125
179 3300005545 Ga0070695_100155572 Ga0070695_1001555722 125
180 3300005546 Ga0070696_100004235 Ga0070696_1000042353 125
181 3300005546 Ga0070696_100069732 Ga0070696_1000697323 125
182 3300005546 Ga0070696_100300305 Ga0070696_1003003052 125
183 3300005547 Ga0070693_100002169 Ga0070693_1000021698 125
184 3300005547 Ga0070693_100293022 Ga0070693_1002930222 125
185 3300005549 Ga0070704_100036923 Ga0070704_1000369234 125
186 3300005549 Ga0070704_100040539 Ga0070704_1000405392 125
187 3300005549 Ga0070704_100391375 Ga0070704_1003913752 125
188 3300005563 Ga0068855_100020529 Ga0068855_1000205295 125
189 3300005563 Ga0068855_101073312 Ga0068855_1010733122 125
190 3300005577 Ga0068857_100174999 Ga0068857_1001749992 125
191 3300005578 Ga0068854_100066900 Ga0068854_1000669003 125
192 3300005614 Ga0068856_100042983 Ga0068856_1000429832 125
193 3300005614 Ga0068856_100157067 Ga0068856_1001570673 125
194 3300005615 Ga0070702_100000016 Ga0070702_1000000162 125
195 3300005615 Ga0070702_100348021 Ga0070702_1003480212 125
196 3300005616 Ga0068852_100204743 Ga0068852_1002047432 125
197 3300005617 Ga0068859_100006034 Ga0068859_1000060343 125
198 3300005617 Ga0068859_100307891 Ga0068859_1003078912 125
199 3300005617 Ga0068859_101740163 Ga0068859_1017401632 125
200 3300005618 Ga0068864_100259558 Ga0068864_1002595581 125
201 3300005718 Ga0068866_10000639 Ga0068866_100006392 125
202 3300005719 Ga0068861_100054424 Ga0068861_1000544244 125
203 3300005719 Ga0068861_101539472 Ga0068861_1015394722 125
204 3300005840 Ga0068870_10188746 Ga0068870_101887462 125
205 3300005840 Ga0068870_10252098 Ga0068870_102520982 125
206 3300005841 Ga0068863_100144845 Ga0068863_1001448453 125
207 3300005841 Ga0068863_101054238 Ga0068863_1010542382 125
208 3300005842 Ga0068858_100317478 Ga0068858_1003174782 125
209 3300005843 Ga0068860_100001230 Ga0068860_1000012304 125
210 3300005844 Ga0068862_100009634 Ga0068862_1000096348 125
211 3300005844 Ga0068862_100100121 Ga0068862_1001001212 125
212 3300005844 Ga0068862_100132981 Ga0068862_1001329812 125
213 3300005937 Ga0081455_10370863 Ga0081455_103708631 125
214 3300006163 Ga0070715_10079721 Ga0070715_100797212 125
215 3300006237 Ga0097621_100045926 Ga0097621_1000459264 125
216 3300006358 Ga0068871_100000120 Ga0068871_10000012065 125
217 3300006358 Ga0068871_101507868 Ga0068871_1015078682 125
218 3300006844 Ga0075428_100224022 Ga0075428_1002240223 125
219 3300006844 Ga0075428_100246694 Ga0075428_1002466942 125
220 3300006844 Ga0075428_100906838 Ga0075428_1009068382 125
221 3300006844 Ga0075428_101179697 Ga0075428_1011796972 125
222 3300006846 Ga0075430_100046667 Ga0075430_1000466673 125
223 3300006846 Ga0075430_100962712 Ga0075430_1009627122 125
224 3300006846 Ga0075430_101050112 Ga0075430_1010501122 125
225 3300006847 Ga0075431_100094541 Ga0075431_1000945413 125
226 3300006847 Ga0075431_100571820 Ga0075431_1005718202 125
227 3300006847 Ga0075431_100581297 Ga0075431_1005812972 125
228 3300006852 Ga0075433_10001178 Ga0075433_1000117820 125
229 3300006852 Ga0075433_10398282 Ga0075433_103982822 125
230 3300006871 Ga0075434_100001217 Ga0075434_1000012172 125
231 3300006880 Ga0075429_100005024 Ga0075429_1000050245 125
232 3300006880 Ga0075429_100031593 Ga0075429_1000315936 125
233 3300006880 Ga0075429_100508682 Ga0075429_1005086822 125
234 3300006880 Ga0075429_101629257 Ga0075429_1016292572 125
235 3300006881 Ga0068865_100002861 Ga0068865_1000028613 125
236 3300006881 Ga0068865_100040371 Ga0068865_1000403712 125
237 3300006914 Ga0075436_100035671 Ga0075436_1000356713 125
238 3300006914 Ga0075436_100244127 Ga0075436_1002441272 125
239 3300006931 Ga0097620_100006034 Ga0097620_10000603412 125
240 3300006931 Ga0097620_100307891 Ga0097620_1003078912 125
241 3300006931 Ga0097620_101740116 Ga0097620_1017401162 125
242 3300007076 Ga0075435_100000549 Ga0075435_1000005494 125
243 3300007265 Ga0099794_10019620 Ga0099794_100196204 125
244 3300007265 Ga0099794_10067447 Ga0099794_100674472 125
245 3300007265 Ga0099794_10195171 Ga0099794_101951712 125
246 3300009092 Ga0105250_10221557 Ga0105250_102215572 125
247 3300009094 Ga0111539_10023101 Ga0111539_100231016 125
248 3300009094 Ga0111539_10250772 Ga0111539_102507722 125
249 3300009094 Ga0111539_10406612 Ga0111539_104066122 125
250 3300009094 Ga0111539_10838013 Ga0111539_108380132 125
251 3300009094 Ga0111539_12494943 Ga0111539_124949432 125
252 3300009098 Ga0105245_10000259 Ga0105245_1000025948 125
253 3300009147 Ga0114129_10058621 Ga0114129_100586214 125
254 3300009147 Ga0114129_11171499 Ga0114129_111714992 125
255 3300009148 Ga0105243_10015694 Ga0105243_100156943 125
256 3300009148 Ga0105243_10016613 Ga0105243_100166132 125
257 3300009174 Ga0105241_10065500 Ga0105241_100655003 125
258 3300009176 Ga0105242_10001686 Ga0105242_1000168621 125
259 3300009176 Ga0105242_10706002 Ga0105242_107060022 125
260 3300009177 Ga0105248_10151197 Ga0105248_101511973 125
261 3300009545 Ga0105237_10096519 Ga0105237_100965192 125
262 3300009545 Ga0105237_10444517 Ga0105237_104445172 125
263 3300009553 Ga0105249_10001070 Ga0105249_100010702 125
264 3300009553 Ga0105249_10265598 Ga0105249_102655982 125
265 3300010375 Ga0105239_10049991 Ga0105239_100499913 125
266 3300011119 Ga0105246_10973188 Ga0105246_109731881 125
267 3300012480 Ga0157346_1008790 Ga0157346_10087902 125
268 3300013297 Ga0157378_10000576 Ga0157378_100005762 125
269 3300013297 Ga0157378_10798011 Ga0157378_107980112 125
270 3300013306 Ga0163162_10378285 Ga0163162_103782853 125
271 3300013306 Ga0163162_10439433 Ga0163162_104394333 125
272 3300013308 Ga0157375_10353764 Ga0157375_103537642 125
273 3300013308 Ga0157375_10582921 Ga0157375_105829212 125
274 3300014326 Ga0157380_10012036 Ga0157380_100120365 125
275 3300014326 Ga0157380_10806534 Ga0157380_108065342 125
276 3300014745 Ga0157377_10045260 Ga0157377_100452603 125
277 3300014745 Ga0157377_10811872 Ga0157377_108118722 125
278 3300014745 Ga0157377_10872072 Ga0157377_108720721 125
279 3300014968 Ga0157379_10304127 Ga0157379_103041272 125
280 3300014969 Ga0157376_10004961 Ga0157376_100049614 125
281 3300025315 Ga0207697_10446431 Ga0207697_104464312 125
282 3300025885 Ga0207653_10012421 Ga0207653_100124212 125
283 3300025899 Ga0207642_10002463 Ga0207642_100024633 125
284 3300025905 Ga0207685_10000844 Ga0207685_100008444 125
285 3300025905 Ga0207685_10053669 Ga0207685_100536692 125
286 3300025905 Ga0207685_10239433 Ga0207685_102394332 125
287 3300025907 Ga0207645_10179043 Ga0207645_101790432 125
288 3300025908 Ga0207643_10131994 Ga0207643_101319942 125
289 3300025911 Ga0207654_10067712 Ga0207654_100677123 125
290 3300025914 Ga0207671_10445052 Ga0207671_104450522 125
291 3300025916 Ga0207663_10357647 Ga0207663_103576472 125
292 3300025916 Ga0207663_11046189 Ga0207663_110461892 125
293 3300025917 Ga0207660_10001156 Ga0207660_100011563 125
294 3300025917 Ga0207660_10286597 Ga0207660_102865972 125
295 3300025917 Ga0207660_10424720 Ga0207660_104247202 125
296 3300025918 Ga0207662_10000106 Ga0207662_1000010623 125
297 3300025918 Ga0207662_10078695 Ga0207662_100786952 125
298 3300025921 Ga0207652_10032518 Ga0207652_100325182 125
299 3300025923 Ga0207681_10044062 Ga0207681_100440623 125
300 3300025923 Ga0207681_10485634 Ga0207681_104856342 125
301 3300025924 Ga0207694_11486893 Ga0207694_114868931 125
302 3300025926 Ga0207659_10732213 Ga0207659_107322132 125
303 3300025927 Ga0207687_10021347 Ga0207687_100213473 125
304 3300025934 Ga0207686_10000883 Ga0207686_1000088325 125
305 3300025935 Ga0207709_10001408 Ga0207709_100014087 125
306 3300025935 Ga0207709_10675100 Ga0207709_106751002 125
307 3300025936 Ga0207670_10032252 Ga0207670_100322523 125
308 3300025936 Ga0207670_10124413 Ga0207670_101244133 125
309 3300025936 Ga0207670_10784569 Ga0207670_107845691 125
310 3300025937 Ga0207669_11540445 Ga0207669_115404452 125
311 3300025938 Ga0207704_10007809 Ga0207704_100078093 125
312 3300025938 Ga0207704_10522775 Ga0207704_105227752 125
313 3300025938 Ga0207704_10677748 Ga0207704_106777482 125
314 3300025940 Ga0207691_10043567 Ga0207691_100435674 125
315 3300025941 Ga0207711_10130101 Ga0207711_101301012 125
316 3300025942 Ga0207689_10000376 Ga0207689_100003768 125
317 3300025942 Ga0207689_10058600 Ga0207689_100586002 125
318 3300025942 Ga0207689_10091991 Ga0207689_100919912 125
319 3300025942 Ga0207689_10715896 Ga0207689_107158962 125
320 3300025949 Ga0207667_10016778 Ga0207667_100167787 125
321 3300025949 Ga0207667_10330360 Ga0207667_103303602 125
322 3300025960 Ga0207651_10226604 Ga0207651_102266043 125
323 3300025960 Ga0207651_10254357 Ga0207651_102543572 125
324 3300025960 Ga0207651_10818793 Ga0207651_108187932 125
325 3300025961 Ga0207712_10030519 Ga0207712_100305193 125
326 3300025972 Ga0207668_11405169 Ga0207668_114051692 125
327 3300025981 Ga0207640_10028259 Ga0207640_100282592 125
328 3300026023 Ga0207677_10070095 Ga0207677_100700953 125
329 3300026023 Ga0207677_10753790 Ga0207677_107537902 125
330 3300026035 Ga0207703_10023514 Ga0207703_100235145 125
331 3300026075 Ga0207708_10016505 Ga0207708_100165055 125
332 3300026075 Ga0207708_10096952 Ga0207708_100969522 125
333 3300026075 Ga0207708_10148086 Ga0207708_101480863 125
334 3300026078 Ga0207702_10025636 Ga0207702_100256362 125
335 3300026078 Ga0207702_10244294 Ga0207702_102442942 125
336 3300026088 Ga0207641_10244509 Ga0207641_102445092 125
337 3300026089 Ga0207648_10000369 Ga0207648_100003693 125
338 3300026089 Ga0207648_10023397 Ga0207648_100233977 125
339 3300026095 Ga0207676_10200633 Ga0207676_102006332 125
340 3300026116 Ga0207674_10209799 Ga0207674_102097992 125
341 3300026118 Ga0207675_100002170 Ga0207675_10000217022 125
342 3300026118 Ga0207675_100004506 Ga0207675_1000045063 125
343 3300026118 Ga0207675_100115848 Ga0207675_1001158483 125
344 3300026121 Ga0207683_10323175 Ga0207683_103231753 125
345 3300026142 Ga0207698_10204440 Ga0207698_102044403 125
346 3300027462 Ga0210000_1019025 Ga0210000_10190252 125
347 3300027543 Ga0209999_1078219 Ga0209999_10782191 125
348 3300027671 Ga0209588_1009181 Ga0209588_10091812 125
349 3300027671 Ga0209588_1044313 Ga0209588_10443132 125
350 3300027695 Ga0209966_1065575 Ga0209966_10655752 125
351 3300027907 Ga0207428_10056581 Ga0207428_100565813 125
352 3300027907 Ga0207428_10197767 Ga0207428_101977673 125
353 3300028380 Ga0268265_10001333 Ga0268265_1000133328 125
354 3300028381 Ga0268264_10001450 Ga0268264_1000145029 125
355 3300031548 Ga0307408_100035927 Ga0307408_1000359273 125
356 3300031548 Ga0307408_100700443 Ga0307408_1007004432 125
357 3300031731 Ga0307405_10450637 Ga0307405_104506371 125
358 3300031852 Ga0307410_10327131 Ga0307410_103271312 125
359 3300031903 Ga0307407_10207850 Ga0307407_102078502 125
360 3300031995 Ga0307409_101135992 Ga0307409_1011359922 125
361 3300032002 Ga0307416_100034206 Ga0307416_1000342062 125
362 3300032002 Ga0307416_100165906 Ga0307416_1001659062 125
363 3300032005 Ga0307411_10450218 Ga0307411_104502182 125
364 3300034816 Ga0373930_0004645 Ga0373930_0004645_1000_1419 125
365 3300034817 Ga0373948_0008200 Ga0373948_0008200_955_1374 125
366 3300034818 Ga0373950_0002063 Ga0373950_0002063_1114_1533 125
367 3300034819 Ga0373958_0008124 Ga0373958_0008124_223_642 125
368 3300034820 Ga0373959_0005159 Ga0373959_0005159_1276_1695 125
369 3300035084 Ga0373928_0002841 Ga0373928_0002841_1437_1856 125
370 3300035085 Ga0373929_0008161 Ga0373929_0008161_608_1027 125
371 3300035088 Ga0373940_0017306 Ga0373940_0017306_941_1360 125
372 3300035089 Ga0373944_0011272 Ga0373944_0011272_1753_2136 125
373 3300035090 Ga0373949_0020097 Ga0373949_0020097_365_784 125
374 3300035092 Ga0373952_0249653 Ga0373952_0249653_92_475 125
375 3300035112 Ga0373932_0250153 Ga0373932_0250153_35_454 125
376 3300035114 Ga0373939_0000843 Ga0373939_0000843_2877_3296 125
377 3300035115 Ga0373941_0076758 Ga0373941_0076758_609_1028 125
378 3300035116 Ga0373945_0000803 Ga0373945_0000803_1968_2351 125
379 3300035118 Ga0373954_0468917 Ga0373954_0468917_69_446 125
380 3300035121 Ga0373960_0081733 Ga0373960_0081733_261_680 125
381 3300035170 Ga0373943_0017959 Ga0373943_0017959_1499_1882 125
382 3300035170 Ga0373943_0043183 Ga0373943_0043183_1313_1732 125
383 3300035207 Ga0373942_0017248 Ga0373942_0017248_1055_1474 125
384 3300035207 Ga0373942_0024601 Ga0373942_0024601_827_1210 125
385 3300035207 Ga0373942_0116589 Ga0373942_0116589_366_749 125
386 3300035241 Ga0373961_0033576 Ga0373961_0033576_809_1228 125
387 3300035242 Ga0373962_0045832 Ga0373962_0045832_728_1147 125
388 3300035242 Ga0373962_0097040 Ga0373962_0097040_457_900 125
389 3300035691 Ga0373931_0000757 Ga0373931_0000757_10061_10480 125
390 3300035691 Ga0373931_0030990 Ga0373931_0030990_1629_2033 125
391 3300035691 Ga0373931_0902126 Ga0373931_0902126_142_525 125
392 3300035692 Ga0373935_0084677 Ga0373935_0084677_1115_1498 125
393 3300035695 Ga0373927_0004507 Ga0373927_0004507_6724_7107 125
394 3300035725 Ga0373947_0023879 Ga0373947_0023879_568_951 125
395 3300035725 Ga0373947_0065372 Ga0373947_0065372_253_672 125
396 3300036401 Ga0373937_0420667 Ga0373937_0420667_237_614 125
397 3300037068 Ga0373925_0084870 Ga0373925_0084870_1548_1931 125
398 3300037068 Ga0373925_0144241 Ga0373925_0144241_1207_1626 125
399 3300042001 Ga0439441_002805 Ga0439441_002805_1182_1565 125
400 3300042001 Ga0439441_075627 Ga0439441_075627_147_578 125
401 3300042003 Ga0439443_001850 Ga0439443_001850_245_628 125
402 3300042116 Ga0450912_001908 Ga0450912_001908_232_615 125
403 3300042436 Ga0439435_0001098 Ga0439435_0001098_762_1145 125
404 3300042437 Ga0439444_0013279 Ga0439444_0013279_435_818 125
405 3300042439 Ga0439464_0029632 Ga0439464_0029632_698_1081 125
406 3300042461 Ga0439460_0002280 Ga0439460_0002280_3444_3827 125
407 3300042993 Ga0439440_0122219 Ga0439440_0122219_171_554 125
408 3300045051 Ga0451576_0019708 Ga0451576_0019708_2210_2629 125
409 3300045051 Ga0451576_0086242 Ga0451576_0086242_1393_1797 125
410 3300045051 Ga0451576_1709527 Ga0451576_1709527_176_592 125
411 3300046454 Ga0495592_0245129 Ga0495592_0245129_389_766 125
412 3300046455 Ga0495603_0002444 Ga0495603_0002444_9972_10355 125
413 3300046472 Ga0495580_0014828 Ga0495580_0014828_4643_5026 125
414 3300046473 Ga0495582_0214431 Ga0495582_0214431_164_547 125
415 3300046499 Ga0495594_0088660 Ga0495594_0088660_308_691 125
416 3300046516 Ga0495628_0252454 Ga0495628_0252454_254_631 125
417 3300046517 Ga0495630_0235832 Ga0495630_0235832_559_942 125
418 3300046519 Ga0495632_0341681 Ga0495632_0341681_234_611 125
419 3300046526 Ga0495666_0012596 Ga0495666_0012596_2635_3018 125
420 3300046535 Ga0495586_0007991 Ga0495586_0007991_3525_3908 125
421 3300046537 Ga0495598_0014252 Ga0495598_0014252_431_808 125
422 3300046539 Ga0495621_0121421 Ga0495621_0121421_347_733 125
423 3300046539 Ga0495621_0127489 Ga0495621_0127489_281_658 125
424 3300046559 Ga0495667_0711713 Ga0495667_0711713_35_412 125
425 3300046615 Ga0495656_0095620 Ga0495656_0095620_456_833 125
426 3300046678 Ga0495599_0192532 Ga0495599_0192532_419_796 125
427 3300046679 Ga0495623_0341826 Ga0495623_0341826_380_757 125
428 3300046681 Ga0495647_0008364 Ga0495647_0008364_2702_3085 125
429 3300046683 Ga0495658_0016177 Ga0495658_0016177_432_815 125
430 3300046684 Ga0495669_0212004 Ga0495669_0212004_15_392 125
431 3300047315 Ga0495581_0054153 Ga0495581_0054153_1226_1609 125
432 3300047318 Ga0495636_0410717 Ga0495636_0410717_185_562 125
433 3300047321 Ga0495676_0033938 Ga0495676_0033938_3623_4006 125
434 3300047444 Ga0495675_0458868 Ga0495675_0458868_322_699 125
435 3300048905 Ga0496102_1191361 Ga0496102_1191361_153_557 125
436 3300048907 Ga0496104_1336030 Ga0496104_1336030_171_554 125
437 3300048911 Ga0496108_1011850 Ga0496108_1011850_162_620 125
438 3300048913 Ga0496110_0480501 Ga0496110_0480501_481_939 125
439 3300048914 Ga0496111_0177314 Ga0496111_0177314_145_603 125
440 3300049568 Ga0501031_0128239 Ga0501031_0128239_1060_1497 125
441 3300049568 Ga0501031_0315176 Ga0501031_0315176_608_991 125
442 3300049569 Ga0501032_0135795 Ga0501032_0135795_250_657 125
443 3300049570 Ga0501033_0006483 Ga0501033_0006483_1911_2318 125
444 3300049570 Ga0501033_0064748 Ga0501033_0064748_619_996 125
445 3300049570 Ga0501033_0176408 Ga0501033_0176408_221_658 125
446 3300049571 Ga0501034_0228161 Ga0501034_0228161_259_666 125
447 3300049572 Ga0501036_0001252 Ga0501036_0001252_6770_7177 125
448 3300049572 Ga0501036_0139919 Ga0501036_0139919_233_616 125
449 3300049572 Ga0501036_0153867 Ga0501036_0153867_83_466 125
450 3300049572 Ga0501036_0260633 Ga0501036_0260633_130_567 125
451 3300049572 Ga0501036_0487825 Ga0501036_0487825_486_896 125
452 3300049573 Ga0501037_0059065 Ga0501037_0059065_1102_1509 125
453 3300049574 Ga0501038_0001280 Ga0501038_0001280_13962_14369 125
454 3300049574 Ga0501038_0162383 Ga0501038_0162383_980_1357 125
455 3300049574 Ga0501038_0224201 Ga0501038_0224201_623_1006 125
456 3300049574 Ga0501038_0501590 Ga0501038_0501590_52_435 125
457 3300049574 Ga0501038_0606154 Ga0501038_0606154_249_632 125
458 3300049575 Ga0501039_0003867 Ga0501039_0003867_10321_10758 125
459 3300049575 Ga0501039_0011180 Ga0501039_0011180_5668_6075 125
460 3300049575 Ga0501039_0068920 Ga0501039_0068920_1022_1399 125
461 3300049575 Ga0501039_0130960 Ga0501039_0130960_585_1037 125
462 3300049575 Ga0501039_0162058 Ga0501039_0162058_760_1143 125
463 3300049576 Ga0501040_0000052 Ga0501040_0000052_44681_45088 125
464 3300049576 Ga0501040_0014654 Ga0501040_0014654_173_556 125
465 3300049576 Ga0501040_0040385 Ga0501040_0040385_1739_2116 125
466 3300049576 Ga0501040_0137477 Ga0501040_0137477_513_896 125
467 3300049576 Ga0501040_1072328 Ga0501040_1072328_99_482 125
468 3300049577 Ga0501041_0004912 Ga0501041_0004912_363_770 125
469 3300049577 Ga0501041_0007062 Ga0501041_0007062_2341_2778 125
470 3300049577 Ga0501041_0021075 Ga0501041_0021075_668_1051 125
471 3300049577 Ga0501041_0048287 Ga0501041_0048287_1267_1644 125
472 3300049577 Ga0501041_0133537 Ga0501041_0133537_461_844 125
473 3300049577 Ga0501041_0332119 Ga0501041_0332119_458_868 125
474 3300049577 Ga0501041_0385927 Ga0501041_0385927_168_620 125
475 3300049577 Ga0501041_0634247 Ga0501041_0634247_169_552 125
476 3300049578 Ga0501042_0000048 Ga0501042_0000048_40345_40752 125
477 3300049578 Ga0501042_0082936 Ga0501042_0082936_1503_1940 125
478 3300049578 Ga0501042_0089138 Ga0501042_0089138_586_963 125
479 3300049578 Ga0501042_0098856 Ga0501042_0098856_1497_1880 125
480 3300049578 Ga0501042_0254314 Ga0501042_0254314_139_522 125
481 3300049578 Ga0501042_0375749 Ga0501042_0375749_296_679 125
482 3300049578 Ga0501042_0388668 Ga0501042_0388668_464_847 125
483 3300049578 Ga0501042_1145217 Ga0501042_1145217_73_450 125
484 3300049579 Ga0501043_0267785 Ga0501043_0267785_130_513 125
485 3300049579 Ga0501043_0888998 Ga0501043_0888998_100_507 125
486 3300049580 Ga0501046_0000271 Ga0501046_0000271_7928_8335 125
487 3300049580 Ga0501046_0033342 Ga0501046_0033342_2989_3372 125
488 3300049580 Ga0501046_0169694 Ga0501046_0169694_843_1220 125
489 3300049580 Ga0501046_0299664 Ga0501046_0299664_372_755 125
490 3300049580 Ga0501046_0320880 Ga0501046_0320880_199_588 125
491 3300049580 Ga0501046_0820828 Ga0501046_0820828_190_597 125
492 3300049581 Ga0501047_0968679 Ga0501047_0968679_243_650 125
493 3300049581 Ga0501047_1116506 Ga0501047_1116506_158_535 125
494 3300049582 Ga0501048_0001409 Ga0501048_0001409_9353_9760 125
495 3300049582 Ga0501048_0012758 Ga0501048_0012758_1802_2185 125
496 3300049582 Ga0501048_0075515 Ga0501048_0075515_852_1235 125
497 3300049582 Ga0501048_0107314 Ga0501048_0107314_193_630 125
498 3300049582 Ga0501048_0191710 Ga0501048_0191710_1024_1401 125
499 3300049582 Ga0501048_0242220 Ga0501048_0242220_692_1144 125
500 3300049584 Ga0501068_0001255 Ga0501068_0001255_1232_1639 125
501 3300049584 Ga0501068_0244803 Ga0501068_0244803_658_1041 125
502 3300049585 Ga0501069_0237927 Ga0501069_0237927_162_569 125
503 3300049586 Ga0501070_0050478 Ga0501070_0050478_1137_1544 125
504 3300049586 Ga0501070_1057055 Ga0501070_1057055_136_519 125
505 3300049586 Ga0501070_1122520 Ga0501070_1122520_39_422 125
506 3300049587 Ga0501071_0004018 Ga0501071_0004018_6011_6448 125
507 3300049587 Ga0501071_0042588 Ga0501071_0042588_1777_2160 125
508 3300049587 Ga0501071_0171196 Ga0501071_0171196_876_1259 125
509 3300049587 Ga0501071_0235177 Ga0501071_0235177_153_536 125
510 3300049587 Ga0501071_0373149 Ga0501071_0373149_320_703 125
511 3300049587 Ga0501071_0536636 Ga0501071_0536636_290_742 125
512 3300049588 Ga0501072_0003349 Ga0501072_0003349_8801_9208 125
513 3300049588 Ga0501072_0007259 Ga0501072_0007259_3068_3451 125
514 3300049588 Ga0501072_0077568 Ga0501072_0077568_572_955 125
515 3300049588 Ga0501072_0295779 Ga0501072_0295779_53_460 125
516 3300049588 Ga0501072_0382906 Ga0501072_0382906_552_1004 125
517 3300049588 Ga0501072_0463748 Ga0501072_0463748_210_587 125
518 3300049588 Ga0501072_0567784 Ga0501072_0567784_196_633 125
519 3300049589 Ga0501073_0292830 Ga0501073_0292830_355_762 125
520 3300049590 Ga0501074_0185062 Ga0501074_0185062_95_502 125
521 3300049590 Ga0501074_0596145 Ga0501074_0596145_278_661 125
522 3300049591 Ga0501075_0000751 Ga0501075_0000751_11788_12195 125
523 3300049591 Ga0501075_0001243 Ga0501075_0001243_7022_7405 125
524 3300049591 Ga0501075_0004209 Ga0501075_0004209_5273_5710 125
525 3300049591 Ga0501075_0006255 Ga0501075_0006255_127_579 125
526 3300049591 Ga0501075_0318341 Ga0501075_0318341_47_430 125
527 3300049591 Ga0501075_0370922 Ga0501075_0370922_549_932 125
528 3300049592 Ga0501076_0000290 Ga0501076_0000290_5491_5874 125
529 3300049592 Ga0501076_0004123 Ga0501076_0004123_4447_4884 125
530 3300049592 Ga0501076_0006671 Ga0501076_0006671_2043_2450 125
531 3300049592 Ga0501076_0049968 Ga0501076_0049968_2452_2835 125
532 3300049592 Ga0501076_0422233 Ga0501076_0422233_596_1006 125
533 3300049592 Ga0501076_0446732 Ga0501076_0446732_491_943 125
534 3300049593 Ga0501077_0013249 Ga0501077_0013249_1403_1810 125
535 3300049593 Ga0501077_0075065 Ga0501077_0075065_1622_2005 125
536 3300049593 Ga0501077_0130649 Ga0501077_0130649_529_969 125
537 3300049593 Ga0501077_0194241 Ga0501077_0194241_772_1155 125
538 3300049593 Ga0501077_0214809 Ga0501077_0214809_493_930 125
539 3300049593 Ga0501077_0387852 Ga0501077_0387852_158_610 125
540 3300049661 Ga0501217_268940 Ga0501217_268940_152_532 125
541 3300049741 Ga0501079_0000061 Ga0501079_0000061_39579_39986 125
542 3300049741 Ga0501079_0007164 Ga0501079_0007164_2740_3123 125
543 3300049741 Ga0501079_0008802 Ga0501079_0008802_3628_4065 125
544 3300049741 Ga0501079_0263103 Ga0501079_0263103_627_1034 125
545 3300049742 Ga0501080_0023332 Ga0501080_0023332_2584_2991 125
546 3300049742 Ga0501080_0072729 Ga0501080_0072729_1313_1696 125
547 3300049742 Ga0501080_0093367 Ga0501080_0093367_2016_2453 125
548 3300049742 Ga0501080_0189211 Ga0501080_0189211_194_577 125
549 3300049742 Ga0501080_0718718 Ga0501080_0718718_131_583 125
550 3300049743 Ga0501081_0000110 Ga0501081_0000110_9412_9819 125
551 3300049743 Ga0501081_0017440 Ga0501081_0017440_4232_4669 125
552 3300049743 Ga0501081_0019693 Ga0501081_0019693_596_979 125
553 3300049743 Ga0501081_0138525 Ga0501081_0138525_1260_1712 125
554 3300049743 Ga0501081_0180246 Ga0501081_0180246_291_737 125
555 3300049744 Ga0501083_0062766 Ga0501083_0062766_1692_2129 125
556 3300049744 Ga0501083_0288170 Ga0501083_0288170_380_787 125
557 3300049822 Ga0501035_0025479 Ga0501035_0025479_53_490 125
558 3300049822 Ga0501035_0064885 Ga0501035_0064885_213_620 125
559 3300049824 Ga0501045_0002891 Ga0501045_0002891_1044_1451 125
560 3300049824 Ga0501045_0003109 Ga0501045_0003109_3835_4272 125
561 3300049824 Ga0501045_0046875 Ga0501045_0046875_644_1027 125
562 3300049824 Ga0501045_0421884 Ga0501045_0421884_61_444 125
563 3300049824 Ga0501045_0584635 Ga0501045_0584635_336_719 125
564 3300049824 Ga0501045_0876077 Ga0501045_0876077_78_461 125
565 3300049824 Ga0501045_1180477 Ga0501045_1180477_30_413 125
566 3300050507 nmdc:mga05p37_158605_c1 nmdc:mga05p37_158605_c1_2302_2706 125
567 3300050508 nmdc:mga09592_1286525_c1 nmdc:mga09592_1286525_c1_120_497 125
568 3300050508 nmdc:mga09592_308869_c1 nmdc:mga09592_308869_c1_210_587 125
569 3300050508 nmdc:mga09592_840078_c1 nmdc:mga09592_840078_c1_59_442 125
570 3300050509 nmdc:mga0qj67_38378_c1 nmdc:mga0qj67_38378_c1_557_940 125
571 3300050509 nmdc:mga0qj67_606262_c1 nmdc:mga0qj67_606262_c1_116_493 125
572 3300050509 nmdc:mga0qj67_869443_c1 nmdc:mga0qj67_869443_c1_103_486 125
573 3300050510 nmdc:mga06r32_306953_c1 nmdc:mga06r32_306953_c1_260_664 125
574 3300050510 nmdc:mga06r32_417511_c1 nmdc:mga06r32_417511_c1_414_872 125
575 3300050511 nmdc:mga08y16_122930_c1 nmdc:mga08y16_122930_c1_211_615 125
576 3300050511 nmdc:mga08y16_165342_c1 nmdc:mga08y16_165342_c1_1005_1382 125
577 3300050511 nmdc:mga08y16_508132_c1 nmdc:mga08y16_508132_c1_76_453 125
578 3300050511 nmdc:mga08y16_58516_c1 nmdc:mga08y16_58516_c1_2648_3031 125
579 3300050512 nmdc:mga0n895_12822_c1 nmdc:mga0n895_12822_c1_1057_1440 125
580 3300050512 nmdc:mga0n895_332827_c1 nmdc:mga0n895_332827_c1_593_997 125
581 3300050513 nmdc:mga0rr50_23642_c1 nmdc:mga0rr50_23642_c1_3244_3627 125
582 3300050514 nmdc:mga08x19_5960_c1 nmdc:mga08x19_5960_c1_466_849 125
583 3300050515 nmdc:mga0a205_1704_c1 nmdc:mga0a205_1704_c1_16639_17022 125
584 3300050515 nmdc:mga0a205_376390_c1 nmdc:mga0a205_376390_c1_398_802 125
585 3300054114 Ga0501084_0001172 Ga0501084_0001172_8344_8751 125
586 3300054114 Ga0501084_0077254 Ga0501084_0077254_2204_2641 125
587 3300054114 Ga0501084_0568026 Ga0501084_0568026_26_409 125
588 3300054114 Ga0501084_0786754 Ga0501084_0786754_188_571 125
589 3300059421 Ga0590071_012766 Ga0590071_012766_1460_1843 125
590 3300060353 Ga0501082_0000430 Ga0501082_0000430_284_691 125
591 3300060353 Ga0501082_0006714 Ga0501082_0006714_4172_4609 125
592 3300060353 Ga0501082_0065190 Ga0501082_0065190_2663_3046 125
593 3300060353 Ga0501082_0525503 Ga0501082_0525503_358_810 125
594 3300060353 Ga0501082_1081139 Ga0501082_1081139_27_410 125
595 3300061734 Ga0530510_0000048 Ga0530510_0000048_8218_8601 125
596 3300061734 Ga0530510_0000186 Ga0530510_0000186_29505_29912 125
597 3300061734 Ga0530510_0078101 Ga0530510_0078101_1592_1975 125

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19825

DUF6306

Domain of unknown function (DUF6306)

9

138

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gv9-assembly2.cif.gz_B crystal structure of the herpes simplex virus type 1 dna polymerase 0.9237 73 121
2ib0-assembly1.cif.gz_B crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.8825 2 121
2ib0-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.8765 2 125
3hiu-assembly1.cif.gz_A the crystal structure of protein (xcc3681) from xanthomonas campestris pv. campestris str. atcc 33913 0.8538 2 124
4kvr-assembly1.cif.gz_A crystal structure of prochlorococcus marinus aldehyde-deformylating oxygenase (mutant v41y) 0.8521 2 121
ID Description Score Start End Superfamily
2gv9B05 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.9397 75 121 1.10.287.690
af_O45806_8_315_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.9081 74 116 1.20.1070.10
2ib0B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8825 2 121 1.20.1260.10
af_A0A0P0XEB1_1_59_1.20.58.80 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphotransferase system, lactose/cellobiose-type IIA subunit 0.8802 75 121 1.20.58.80
2ib0A01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8765 2 125 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A1F3YET9-F1-model_v4 DUF6306 domain-containing protein 0.986 1 125
AF-A0A3N5NAJ6-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9818 2 122 GO:0005524
GO:0009396
GO:0030272
GO:0035999
AF-A0A1F3YET9-F1-model_v4 DUF6306 domain-containing protein 0.9783 1 125
AF-A0A2I6S6W0-F1-model_v4 DUF6306 domain-containing protein 0.9742 2 125
AF-W7X0T4-F1-model_v4 DUF6306 domain-containing protein 0.9626 2 120

Feature Viewer

pLDDT pTM Quality
90.69 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map