F467670

General Info

Members Datasets Scaffolds Average Seq Length
597 306 1194 323

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10514900|Ga0163163_105149001
Length 364
Sequence MEKGTLMGFKPTRRAAALVAAGLVSTLPVTLSLVAYSTPQAAYEKIIAAFQKTDAGKNVKFTQSYGASGDQSRAVAAGLPADFVEFSLETDMTRLVDAKMVDPSWNTDEYKGMVTDSVVSLVTRKGNPKHIKSFEDLAKPGVEVITPNPFSSGAARWNIMGAYGSQTQTGKSEAEATAFLAKVMSNVAVQDDSGRAALQTFTGGKGDVLVSYENEAIFAQQNGQDVDYVVPDNTLLIENPAAVTSTSKHPKEAKAFLDFVRSDEAQKIFAENGYRPVSKTADTAGQDFPTPSGLFTIQDLGGWDAVATKFFDADKGIVTDIERKLGELGIELVGDTPEEFARYIRAEIPKWSRVIEDAGARVDR

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
151 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
152 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
180 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
184 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
185 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
186 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
187 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
188 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
189 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
190 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
191 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
199 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
249 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
250 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
255 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
271 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
272 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
273 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
274 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
275 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
279 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
280 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
281 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
291 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
292 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
295 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
299 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
300 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
302 2643221641 Nocardioides sp. Root122 Isolate Unclassified
303 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
304 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
305 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
306 2891562705 Microbispora tritici MT50 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 0.17
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.84
Nodule 0
Rhizoplane 14.74
Rhizosphere 79.56
Stem 0
Stem Tuber 0
Unclassified 1.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10514900 3300014325 Bacteria 1259
2 Ga0070683_100003225 3300005329 Bacteria 13167
3 Ga0070683_100015581 3300005329 Bacteria 6682
4 Ga0070683_100030455 3300005329 Bacteria 4899
5 Ga0070683_100039278 3300005329 Bacteria 4344
6 Ga0070666_10107850 3300005335 Bacteria 1924
7 Ga0070680_100002170 3300005336 Bacteria 14460
8 Ga0070680_100010521 3300005336 Bacteria 7135
9 Ga0070682_100049865 3300005337 Bacteria 2611
10 Ga0070682_100052056 3300005337 Bacteria 2561
11 Ga0070682_100072884 3300005337 Bacteria 2202
12 Ga0070682_100080812 3300005337 Bacteria 2103
13 Ga0068868_100023214 3300005338 Bacteria 4693
14 Ga0068868_100028653 3300005338 Bacteria 4259
15 Ga0068868_100069246 3300005338 Bacteria 2811
16 Ga0070660_100008777 3300005339 Bacteria 7079
17 Ga0070691_10007083 3300005341 Bacteria 5140
18 Ga0070687_100061509 3300005343 Bacteria 1985
19 Ga0070692_10005087 3300005345 Bacteria 5561
20 Ga0070668_100173074 3300005347 Bacteria 1759
21 Ga0070671_100046207 3300005355 Bacteria 3621
22 Ga0070671_100184943 3300005355 Bacteria 1765
23 Ga0070659_100019489 3300005366 Bacteria 5142
24 Ga0070659_100116133 3300005366 Bacteria 2163
25 Ga0070659_100241529 3300005366 Bacteria 1495
26 Ga0070667_100009366 3300005367 Bacteria 8119
27 Ga0070709_10175924 3300005434 Bacteria 1499
28 Ga0070714_100163275 3300005435 Unclassified 2017
29 Ga0070714_100211772 3300005435 Bacteria 1777
30 Ga0070713_100048274 3300005436 Bacteria 3504
31 Ga0070713_100070322 3300005436 Bacteria 2954
32 Ga0070713_100236245 3300005436 Bacteria 1663
33 Ga0070710_10028698 3300005437 Bacteria 2978
34 Ga0070710_10103619 3300005437 Bacteria 1698
35 Ga0070711_100019758 3300005439 Bacteria 4328
36 Ga0070705_100021168 3300005440 Bacteria 3455
37 Ga0070700_100005180 3300005441 Bacteria 6887
38 Ga0070700_100182381 3300005441 Unclassified 1462
39 Ga0070694_100030564 3300005444 Bacteria 3525
40 Ga0070663_100262326 3300005455 Bacteria 1371
41 Ga0070678_100014820 3300005456 Bacteria 4932
42 Ga0070678_100136784 3300005456 Bacteria 1955
43 Ga0070662_100015570 3300005457 Bacteria 5096
44 Ga0070681_10000389 3300005458 Bacteria 35630
45 Ga0070681_10036940 3300005458 Bacteria 4902
46 Ga0070681_10043873 3300005458 Bacteria 4476
47 Ga0068867_100015132 3300005459 Bacteria 5471
48 Ga0068867_100053246 3300005459 Bacteria 2989
49 Ga0070698_100015738 3300005471 Bacteria 7990
50 Ga0070679_100000432 3300005530 Bacteria 35542
51 Ga0070679_100001364 3300005530 Bacteria 21559
52 Ga0070679_100067321 3300005530 Bacteria 3571
53 Ga0070679_100073354 3300005530 Bacteria 3414
54 Ga0070679_100084818 3300005530 Bacteria 3155
55 Ga0070679_100186674 3300005530 Bacteria 2043
56 Ga0070679_100342170 3300005530 Bacteria 1444
57 Ga0070684_100014577 3300005535 Bacteria 6372
58 Ga0070684_100021769 3300005535 Bacteria 5340
59 Ga0070684_100034944 3300005535 Bacteria 4300
60 Ga0070684_100047128 3300005535 Bacteria 3735
61 Ga0070684_100109026 3300005535 Bacteria 2481
62 Ga0070684_100250706 3300005535 Bacteria 1618
63 Ga0068853_100065858 3300005539 Bacteria 3144
64 Ga0068853_100222962 3300005539 Bacteria 1723
65 Ga0070686_100045397 3300005544 Bacteria 2767
66 Ga0070686_100051309 3300005544 Bacteria 2625
67 Ga0070696_100011731 3300005546 Bacteria 5873
68 Ga0070696_100021145 3300005546 Bacteria 4411
69 Ga0070693_100004465 3300005547 Bacteria 6620
70 Ga0070693_100014558 3300005547 Bacteria 4033
71 Ga0070665_100149968 3300005548 Bacteria 2334
72 Ga0070665_100171449 3300005548 Bacteria 2171
73 Ga0070704_100063834 3300005549 Bacteria 2644
74 Ga0068855_100025453 3300005563 Bacteria 7080
75 Ga0068855_100056258 3300005563 Bacteria 4616
76 Ga0068855_100062246 3300005563 Bacteria 4356
77 Ga0068855_100187441 3300005563 Bacteria 2336
78 Ga0068855_100312630 3300005563 Bacteria 1738
79 Ga0070664_100005588 3300005564 Bacteria 10104
80 Ga0070664_100037399 3300005564 Bacteria 4082
81 Ga0068857_100060610 3300005577 Bacteria 3361
82 Ga0068854_100028280 3300005578 Bacteria 3872
83 Ga0068856_100085745 3300005614 Bacteria 3129
84 Ga0068856_100243628 3300005614 Bacteria 1813
85 Ga0070702_100019322 3300005615 Bacteria 3551
86 Ga0068852_100018755 3300005616 Bacteria 5457
87 Ga0068852_100047997 3300005616 Bacteria 3646
88 Ga0068859_100119675 3300005617 Bacteria 2700
89 Ga0068864_100058454 3300005618 Bacteria 3333
90 Ga0068864_100082227 3300005618 Bacteria 2825
91 Ga0068864_100097262 3300005618 Bacteria 2606
92 Ga0068866_10002851 3300005718 Bacteria 7129
93 Ga0068866_10030984 3300005718 Bacteria 2572
94 Ga0068861_100041688 3300005719 Bacteria 3439
95 Ga0068861_100248361 3300005719 Bacteria 1517
96 Ga0068863_100098528 3300005841 Bacteria 2776
97 Ga0068858_100066785 3300005842 Bacteria 3330
98 Ga0068860_100197881 3300005843 Bacteria 1947
99 Ga0068860_100257417 3300005843 Bacteria 1701
100 Ga0068862_100000510 3300005844 Bacteria 41329
101 Ga0068862_100031590 3300005844 Bacteria 4472
102 Ga0081455_10010784 3300005937 Bacteria 9234
103 Ga0081455_10038446 3300005937 Bacteria 4238
104 Ga0081538_10016041 3300005981 Bacteria 5765
105 Ga0081540_1009141 3300005983 Bacteria 6839
106 Ga0081540_1014982 3300005983 Bacteria 4929
107 Ga0070717_10033367 3300006028 Bacteria 4153
108 Ga0070717_10060400 3300006028 Bacteria 3139
109 Ga0070717_10297670 3300006028 Bacteria 1434
110 Ga0075432_10014031 3300006058 Bacteria 2728
111 Ga0070715_10083554 3300006163 Bacteria 1454
112 Ga0070716_100103814 3300006173 Bacteria 1748
113 Ga0070716_100177489 3300006173 Bacteria 1395
114 Ga0070712_100017253 3300006175 Bacteria 4671
115 Ga0097621_100046456 3300006237 Bacteria 3513
116 Ga0068871_100040342 3300006358 Bacteria 3739
117 Ga0075428_100018030 3300006844 Bacteria 7801
118 Ga0075428_100114132 3300006844 Bacteria 2943
119 Ga0075428_100221146 3300006844 Bacteria 2045
120 Ga0075430_100002429 3300006846 Bacteria 15503
121 Ga0075430_100143414 3300006846 Bacteria 1989
122 Ga0075433_10082568 3300006852 Bacteria 2834
123 Ga0075433_10091074 3300006852 Bacteria 2695
124 Ga0075434_100005674 3300006871 Bacteria 11389
125 Ga0075429_100259703 3300006880 Bacteria 1521
126 Ga0068865_100077167 3300006881 Bacteria 2380
127 Ga0075436_100055638 3300006914 Bacteria 2732
128 Ga0075436_100114204 3300006914 Bacteria 1886
129 Ga0075436_100120628 3300006914 Bacteria 1834
130 Ga0097620_100119672 3300006931 Bacteria 2700
131 Ga0075435_100011150 3300007076 Bacteria 6594
132 Ga0075435_100019858 3300007076 Bacteria 5140
133 Ga0075435_100287453 3300007076 Bacteria 1404
134 Ga0105240_10012405 3300009093 Bacteria 11765
135 Ga0105240_10019995 3300009093 Bacteria 8939
136 Ga0105240_10113791 3300009093 Bacteria 3269
137 Ga0105240_10224947 3300009093 Bacteria 2184
138 Ga0105240_10418448 3300009093 Unclassified 1506
139 Ga0111539_10045842 3300009094 Bacteria 5232
140 Ga0111539_10111312 3300009094 Bacteria 3213
141 Ga0105245_10025810 3300009098 Bacteria 5167
142 Ga0105245_10036032 3300009098 Bacteria 4393
143 Ga0105245_10052738 3300009098 Bacteria 3648
144 Ga0105245_10109325 3300009098 Bacteria 2569
145 Ga0105245_10127540 3300009098 Bacteria 2383
146 Ga0105245_10136565 3300009098 Bacteria 2305
147 Ga0105245_10574636 3300009098 Bacteria 1151
148 Ga0114129_10094114 3300009147 Bacteria 4150
149 Ga0114129_10200400 3300009147 Bacteria 2704
150 Ga0105243_10008961 3300009148 Bacteria 7647
151 Ga0105243_10019768 3300009148 Bacteria 5106
152 Ga0105243_10039302 3300009148 Bacteria 3687
153 Ga0105243_10135297 3300009148 Bacteria 2096
154 Ga0105243_10252719 3300009148 Bacteria 1574
155 Ga0105241_10204309 3300009174 Bacteria 1652
156 Ga0105241_10241227 3300009174 Bacteria 1528
157 Ga0105242_10062841 3300009176 Bacteria 3057
158 Ga0105242_10222032 3300009176 Bacteria 1689
159 Ga0105248_10015966 3300009177 Bacteria 8268
160 Ga0105248_10059254 3300009177 Bacteria 4300
161 Ga0105248_10083536 3300009177 Bacteria 3592
162 Ga0105248_10095780 3300009177 Bacteria 3342
163 Ga0105248_10110073 3300009177 Bacteria 3106
164 Ga0105248_10134337 3300009177 Bacteria 2791
165 Ga0105237_10019493 3300009545 Bacteria 7005
166 Ga0105237_10349014 3300009545 Bacteria 1484
167 Ga0105237_10415289 3300009545 Bacteria 1351
168 Ga0105238_10078038 3300009551 Bacteria 3303
169 Ga0105238_10287409 3300009551 Bacteria 1626
170 Ga0105238_10387089 3300009551 Bacteria 1390
171 Ga0105249_10007467 3300009553 Bacteria 9538
172 Ga0105249_10060351 3300009553 Bacteria 3478
173 Ga0105249_10351355 3300009553 Bacteria 1494
174 Ga0105239_10063124 3300010375 Bacteria 4067
175 Ga0105239_10108285 3300010375 Bacteria 3079
176 Ga0105239_10113310 3300010375 Bacteria 3007
177 Ga0105246_10186550 3300011119 Bacteria 1602
178 Ga0157373_10107256 3300013100 Bacteria 1964
179 Ga0157373_10153164 3300013100 Bacteria 1622
180 Ga0157371_10045730 3300013102 Bacteria 3114
181 Ga0157370_10006514 3300013104 Bacteria 12857
182 Ga0157370_10507520 3300013104 Bacteria 1107
183 Ga0157369_10029323 3300013105 Bacteria 6081
184 Ga0157369_10150590 3300013105 Bacteria 2458
185 Ga0157369_10188938 3300013105 Bacteria 2165
186 Ga0157369_10345041 3300013105 Bacteria 1547
187 Ga0157374_10416544 3300013296 Bacteria 1342
188 Ga0157374_10437009 3300013296 Bacteria 1309
189 Ga0157378_10007242 3300013297 Bacteria 9688
190 Ga0157378_10028732 3300013297 Bacteria 4910
191 Ga0157378_10425071 3300013297 Bacteria 1314
192 Ga0163162_10363552 3300013306 Bacteria 1580
193 Ga0157372_10166394 3300013307 Bacteria 2550
194 Ga0157372_10384278 3300013307 Bacteria 1636
195 Ga0157372_10744608 3300013307 Bacteria 1140
196 Ga0157375_10007894 3300013308 Bacteria 9316
197 Ga0157375_10014719 3300013308 Bacteria 6989
198 Ga0157375_10103294 3300013308 Bacteria 2937
199 Ga0163163_10011817 3300014325 Bacteria 7938
200 Ga0163163_10048708 3300014325 Bacteria 4168
201 Ga0157380_10027943 3300014326 Bacteria 4296
202 Ga0157380_10225162 3300014326 Bacteria 1680
203 Ga0182008_10025657 3300014497 Bacteria 2993
204 Ga0157377_10019488 3300014745 Bacteria 3545
205 Ga0157377_10224521 3300014745 Unclassified 1204
206 Ga0157379_10027267 3300014968 Bacteria 5085
207 Ga0157379_10122190 3300014968 Bacteria 2343
208 Ga0157379_10150641 3300014968 Bacteria 2098
209 Ga0157379_10211601 3300014968 Bacteria 1755
210 Ga0157376_10005763 3300014969 Bacteria 8678
211 Ga0157376_10045765 3300014969 Bacteria 3605
212 Ga0157376_10266673 3300014969 Bacteria 1607
213 Ga0206356_11468302 3300020070 Bacteria 1857
214 Ga0207653_10018292 3300025885 Bacteria 2207
215 Ga0207692_10007180 3300025898 Bacteria 4552
216 Ga0207692_10087907 3300025898 Bacteria 1678
217 Ga0207710_10060327 3300025900 Bacteria 1719
218 Ga0207688_10184900 3300025901 Bacteria 1244
219 Ga0207680_10129001 3300025903 Bacteria 1664
220 Ga0207680_10164595 3300025903 Unclassified 1490
221 Ga0207645_10050880 3300025907 Bacteria 2646
222 Ga0207705_10166810 3300025909 Bacteria 1656
223 Ga0207707_10000109 3300025912 Bacteria 82750
224 Ga0207707_10111890 3300025912 Bacteria 2387
225 Ga0207707_10240268 3300025912 Bacteria 1575
226 Ga0207695_10013638 3300025913 Bacteria 9678
227 Ga0207695_10066307 3300025913 Bacteria 3708
228 Ga0207671_10027216 3300025914 Bacteria 4275
229 Ga0207671_10052836 3300025914 Bacteria 3011
230 Ga0207671_10176636 3300025914 Bacteria 1660
231 Ga0207693_10001725 3300025915 Bacteria 19220
232 Ga0207693_10309857 3300025915 Bacteria 1236
233 Ga0207663_10002887 3300025916 Bacteria 8302
234 Ga0207663_10060963 3300025916 Bacteria 2392
235 Ga0207663_10173341 3300025916 Bacteria 1534
236 Ga0207660_10001772 3300025917 Bacteria 14445
237 Ga0207660_10144556 3300025917 Bacteria 1821
238 Ga0207660_10321231 3300025917 Bacteria 1236
239 Ga0207662_10031709 3300025918 Bacteria 3071
240 Ga0207657_10013373 3300025919 Bacteria 8052
241 Ga0207657_10020652 3300025919 Bacteria 6218
242 Ga0207649_10152166 3300025920 Bacteria 1594
243 Ga0207652_10000248 3300025921 Bacteria 56095
244 Ga0207652_10000900 3300025921 Bacteria 28122
245 Ga0207652_10004169 3300025921 Bacteria 11790
246 Ga0207652_10010262 3300025921 Bacteria 7538
247 Ga0207652_10025461 3300025921 Bacteria 4920
248 Ga0207652_10063390 3300025921 Bacteria 3197
249 Ga0207687_10036898 3300025927 Bacteria 3332
250 Ga0207687_10188322 3300025927 Bacteria 1604
251 Ga0207687_10416058 3300025927 Bacteria 1108
252 Ga0207700_10229960 3300025928 Bacteria 1576
253 Ga0207664_10100558 3300025929 Bacteria 2388
254 Ga0207664_10207290 3300025929 Bacteria 1695
255 Ga0207644_10160417 3300025931 Bacteria 1747
256 Ga0207690_10009698 3300025932 Bacteria 5718
257 Ga0207690_10075595 3300025932 Bacteria 2336
258 Ga0207706_10006396 3300025933 Bacteria 10944
259 Ga0207686_10050979 3300025934 Bacteria 2576
260 Ga0207686_10107130 3300025934 Bacteria 1878
261 Ga0207686_10203788 3300025934 Bacteria 1418
262 Ga0207709_10031650 3300025935 Bacteria 3092
263 Ga0207670_10147339 3300025936 Bacteria 1742
264 Ga0207665_10003605 3300025939 Bacteria 10341
265 Ga0207691_10083617 3300025940 Bacteria 2866
266 Ga0207711_10053203 3300025941 Bacteria 3472
267 Ga0207711_10075258 3300025941 Bacteria 2938
268 Ga0207711_10098258 3300025941 Bacteria 2586
269 Ga0207661_10001916 3300025944 Bacteria 14287
270 Ga0207661_10096635 3300025944 Bacteria 2472
271 Ga0207679_10003163 3300025945 Bacteria 10164
272 Ga0207667_10033092 3300025949 Bacteria 5562
273 Ga0207667_10115465 3300025949 Bacteria 2767
274 Ga0207667_10116708 3300025949 Bacteria 2750
275 Ga0207667_10438239 3300025949 Unclassified 1328
276 Ga0207712_10104357 3300025961 Bacteria 2113
277 Ga0207712_10216493 3300025961 Bacteria 1529
278 Ga0207640_10061687 3300025981 Bacteria 2484
279 Ga0207640_10067280 3300025981 Bacteria 2396
280 Ga0207658_10024480 3300025986 Bacteria 4225
281 Ga0207658_10059699 3300025986 Bacteria 2842
282 Ga0207677_10030239 3300026023 Bacteria 3453
283 Ga0207677_10031180 3300026023 Bacteria 3412
284 Ga0207677_10163002 3300026023 Bacteria 1734
285 Ga0207703_10039091 3300026035 Bacteria 3790
286 Ga0207639_10133735 3300026041 Bacteria 2056
287 Ga0207678_10005158 3300026067 Bacteria 11710
288 Ga0207678_10045634 3300026067 Bacteria 3789
289 Ga0207702_10020480 3300026078 Bacteria 5475
290 Ga0207702_10126349 3300026078 Bacteria 2296
291 Ga0207702_10128485 3300026078 Bacteria 2278
292 Ga0207648_10027472 3300026089 Bacteria 5051
293 Ga0207648_10108218 3300026089 Bacteria 2440
294 Ga0207676_10223721 3300026095 Bacteria 1678
295 Ga0207674_10033681 3300026116 Bacteria 5362
296 Ga0207674_10076069 3300026116 Bacteria 3366
297 Ga0207674_10080449 3300026116 Bacteria 3262
298 Ga0207675_100017588 3300026118 Bacteria 6670
299 Ga0207675_100037798 3300026118 Bacteria 4503
300 Ga0207675_100083040 3300026118 Bacteria 3004
301 Ga0207683_10004132 3300026121 Bacteria 12556
302 Ga0207683_10056920 3300026121 Bacteria 3431
303 Ga0207683_10089503 3300026121 Bacteria 2740
304 Ga0207698_10038080 3300026142 Bacteria 3549
305 Ga0207698_10118278 3300026142 Bacteria 2237
306 Ga0209998_10011918 3300027717 Bacteria 1805
307 Ga0207428_10029242 3300027907 Bacteria 4570
308 Ga0207428_10064950 3300027907 Bacteria 2881
309 Ga0268266_10000406 3300028379 Bacteria 65477
310 Ga0268265_10009761 3300028380 Bacteria 6481
311 Ga0268264_10052743 3300028381 Bacteria 3391
312 Ga0265319_1014850 3300028563 Bacteria 3039
313 Ga0265319_1040462 3300028563 Bacteria 1576
314 Ga0265334_10002240 3300028573 Bacteria 9091
315 Ga0265318_10010527 3300028577 Bacteria 4022
316 Ga0265338_10026055 3300028800 Bacteria 5912
317 Ga0265338_10087525 3300028800 Bacteria 2588
318 Ga0265338_10152283 3300028800 Bacteria 1795
319 Ga0265332_10012597 3300031238 Bacteria 3750
320 Ga0265325_10006999 3300031241 Bacteria 6795
321 Ga0265325_10015611 3300031241 Bacteria 4266
322 Ga0265340_10004670 3300031247 Bacteria 7621
323 Ga0265339_10108802 3300031249 Bacteria 1436
324 Ga0265316_10021507 3300031344 Bacteria 5461
325 Ga0265314_10025523 3300031711 Bacteria 4455
326 Ga0307405_10285287 3300031731 Bacteria 1245
327 Ga0307416_100055068 3300032002 Bacteria 3201
328 Ga0307415_100190534 3300032126 Bacteria 1618
329 Ga0373928_0035301 3300035084 Bacteria 1126
330 Ga0373944_0048942 3300035089 Bacteria 1327
331 Ga0373951_0008911 3300035091 Bacteria 2262
332 Ga0373945_0009448 3300035116 Bacteria 3196
333 Ga0373943_0009954 3300035170 Bacteria 4261
334 Ga0373943_0207871 3300035170 Bacteria 1086
335 Ga0373946_0017246 3300035171 Bacteria 2761
336 Ga0373955_0166791 3300035172 Bacteria 1302
337 Ga0373961_0071088 3300035241 Bacteria 1076
338 Ga0373927_0085845 3300035695 Bacteria 2043
339 Ga0373947_0007670 3300035725 Bacteria 6237
340 Ga0373937_0625391 3300036401 Bacteria 1022
341 Ga0373925_0105351 3300037068 Bacteria 2173
342 Ga0395899_0000614 3300037312 Bacteria 37099
343 Ga0395898_0008093 3300037466 Bacteria 11131
344 Ga0395898_0308714 3300037466 Bacteria 1509
345 Ga0395905_0003094 3300037471 Bacteria 17973
346 Ga0395901_0001542 3300038443 Bacteria 23884
347 Ga0395901_0131053 3300038443 Bacteria 2635
348 Ga0395901_0216405 3300038443 Bacteria 2004
349 Ga0451795_1063198 3300041456 Bacteria 3361
350 Ga0451798_0138267 3300041458 Bacteria 1925
351 Ga0451800_0933833 3300041459 Bacteria 2591
352 Ga0451802_0241505 3300041460 Bacteria 3728
353 Ga0451804_0599873 3300041463 Bacteria 5172
354 Ga0451807_0826841 3300041486 Bacteria 2128
355 Ga0451839_1417283 3300041496 Bacteria 4083
356 Ga0451841_1173131 3300041498 Bacteria 2565
357 Ga0451845_0312446 3300041501 Bacteria 4159
358 Ga0451849_1446404 3300041505 Bacteria 3548
359 Ga0451851_0670690 3300041507 Bacteria 5107
360 Ga0451855_0466827 3300041511 Bacteria 2242
361 Ga0451853_1409041 3300041512 Bacteria 1579
362 Ga0451853_1985226 3300041512 Bacteria 1360
363 Ga0439448_0017142 3300042005 Bacteria 2210
364 Ga0439459_0022340 3300042438 Bacteria 1223
365 Ga0466965_0140011 3300044683 Bacteria 1259
366 Ga0466966_0005854 3300044684 Bacteria 8107
367 Ga0466961_0009629 3300044693 Bacteria 6151
368 Ga0466963_0002778 3300044694 Bacteria 9868
369 Ga0466963_0002920 3300044694 Bacteria 9654
370 Ga0466964_0001744 3300044706 Bacteria 7530
371 Ga0466971_0057252 3300044719 Bacteria 1758
372 Ga0466968_0034543 3300044735 Bacteria 2110
373 Ga0466970_0108799 3300044765 Bacteria 1513
374 Ga0466957_0117616 3300044842 Bacteria 1692
375 Ga0466960_0000003 3300044901 Bacteria 86010
376 Ga0466960_0066433 3300044901 Bacteria 1783
377 Ga0466960_0108778 3300044901 Bacteria 1437
378 Ga0466960_0127366 3300044901 Bacteria 1340
379 Ga0466959_0076933 3300045049 Bacteria 2409
380 Ga0466959_0143353 3300045049 Bacteria 1687
381 Ga0466958_0021497 3300045836 Bacteria 3772
382 Ga0466958_0123305 3300045836 Bacteria 1623
383 Ga0466967_0004040 3300045976 Bacteria 9787
384 Ga0466967_0024629 3300045976 Bacteria 4951
385 Ga0466967_0031792 3300045976 Bacteria 4449
386 Ga0466967_0032332 3300045976 Bacteria 4416
387 Ga0466967_0203090 3300045976 Bacteria 1877
388 Ga0495603_0000065 3300046455 Bacteria 46432
389 Ga0495641_0006525 3300046461 Bacteria 7538
390 Ga0495653_0160342 3300046463 Bacteria 1562
391 Ga0495650_0000053 3300046471 Bacteria 316684
392 Ga0495580_0032597 3300046472 Bacteria 3759
393 Ga0495582_0005435 3300046473 Bacteria 7110
394 Ga0495664_0000007 3300046477 Bacteria 386710
395 Ga0495664_0018844 3300046477 Bacteria 3961
396 Ga0495594_0005133 3300046499 Bacteria 6734
397 Ga0495594_0006993 3300046499 Bacteria 5799
398 Ga0495596_0109799 3300046500 Bacteria 1071
399 Ga0495608_0042395 3300046511 Bacteria 3044
400 Ga0495628_0000891 3300046516 Bacteria 27515
401 Ga0495652_0342603 3300046529 Bacteria 1073
402 Ga0495587_0021592 3300046536 Bacteria 3971
403 Ga0495645_0163728 3300046543 Bacteria 1536
404 Ga0495634_0058532 3300046642 Bacteria 2568
405 Ga0495657_0114175 3300046675 Bacteria 1708
406 Ga0495599_0028906 3300046678 Bacteria 3474
407 Ga0495646_0012695 3300046680 Bacteria 5353
408 Ga0495658_0029271 3300046683 Bacteria 2980
409 Ga0495674_0059682 3300047319 Bacteria 3331
410 Ga0495676_0000444 3300047321 Bacteria 33833
411 Ga0495676_0042791 3300047321 Bacteria 3714
412 Ga0495680_0229809 3300047322 Bacteria 1321
413 Ga0495684_0044420 3300047471 Bacteria 3402
414 Ga0495684_0089440 3300047471 Bacteria 2333
415 Ga0495686_0107931 3300047472 Unclassified 1673
416 Ga0495602_0000533 3300048088 Bacteria 35335
417 Ga0496100_0002209 3300048903 Bacteria 9825
418 Ga0496100_0019691 3300048903 Bacteria 4032
419 Ga0496100_0039134 3300048903 Bacteria 3010
420 Ga0496100_0111672 3300048903 Bacteria 1900
421 Ga0496100_0220841 3300048903 Bacteria 1390
422 Ga0496100_0326809 3300048903 Bacteria 1153
423 Ga0496101_0004150 3300048904 Bacteria 9075
424 Ga0496101_0059585 3300048904 Bacteria 2767
425 Ga0496101_0101867 3300048904 Bacteria 2150
426 Ga0496101_0106736 3300048904 Bacteria 2103
427 Ga0496102_0023310 3300048905 Bacteria 5495
428 Ga0496102_0047737 3300048905 Bacteria 3892
429 Ga0496102_0057030 3300048905 Bacteria 3564
430 Ga0496102_0125159 3300048905 Bacteria 2402
431 Ga0496102_0180760 3300048905 Bacteria 1987
432 Ga0496102_0306499 3300048905 Bacteria 1497
433 Ga0496102_0508472 3300048905 Bacteria 1127
434 Ga0496102_0524115 3300048905 Bacteria 1107
435 Ga0496103_0044000 3300048906 Bacteria 2750
436 Ga0496104_0000647 3300048907 Bacteria 29839
437 Ga0496104_0005379 3300048907 Bacteria 11209
438 Ga0496104_0014887 3300048907 Bacteria 7031
439 Ga0496104_0069697 3300048907 Bacteria 3342
440 Ga0496104_0072012 3300048907 Bacteria 3286
441 Ga0496104_0092404 3300048907 Bacteria 2893
442 Ga0496104_0113418 3300048907 Bacteria 2599
443 Ga0496105_0008415 3300048908 Bacteria 8019
444 Ga0496105_0014471 3300048908 Bacteria 6281
445 Ga0496105_0026893 3300048908 Bacteria 4695
446 Ga0496105_0043284 3300048908 Bacteria 3713
447 Ga0496105_0043926 3300048908 Bacteria 3685
448 Ga0496105_0049153 3300048908 Bacteria 3481
449 Ga0496105_0132175 3300048908 Bacteria 2057
450 Ga0496106_0006195 3300048909 Bacteria 8849
451 Ga0496106_0016306 3300048909 Bacteria 5497
452 Ga0496106_0093541 3300048909 Bacteria 2323
453 Ga0496106_0123354 3300048909 Bacteria 2027
454 Ga0496107_0025569 3300048910 Bacteria 4180
455 Ga0496107_0053818 3300048910 Bacteria 2903
456 Ga0496107_0077461 3300048910 Bacteria 2422
457 Ga0496107_0180676 3300048910 Bacteria 1566
458 Ga0496107_0373857 3300048910 Bacteria 1060
459 Ga0496108_0000632 3300048911 Bacteria 27472
460 Ga0496108_0009048 3300048911 Bacteria 8067
461 Ga0496108_0034929 3300048911 Bacteria 4177
462 Ga0496108_0065740 3300048911 Bacteria 3057
463 Ga0496108_0164281 3300048911 Bacteria 1919
464 Ga0496109_0003540 3300048912 Bacteria 13033
465 Ga0496109_0041443 3300048912 Bacteria 4170
466 Ga0496109_0174082 3300048912 Bacteria 2020
467 Ga0496109_0182112 3300048912 Bacteria 1973
468 Ga0496110_0009847 3300048913 Bacteria 7746
469 Ga0496110_0015250 3300048913 Bacteria 6390
470 Ga0496110_0050894 3300048913 Bacteria 3639
471 Ga0496110_0052536 3300048913 Bacteria 3581
472 Ga0496110_0135835 3300048913 Bacteria 2222
473 Ga0496110_0294870 3300048913 Bacteria 1477
474 Ga0496111_0000319 3300048914 Bacteria 23843
475 Ga0496111_0005473 3300048914 Bacteria 8144
476 Ga0496111_0006910 3300048914 Bacteria 7406
477 Ga0496111_0014498 3300048914 Bacteria 5386
478 Ga0496111_0025487 3300048914 Bacteria 4172
479 Ga0496111_0036669 3300048914 Bacteria 3507
480 Ga0496111_0038057 3300048914 Bacteria 3445
481 Ga0496112_0021172 3300048915 Bacteria 6179
482 Ga0496112_0021993 3300048915 Bacteria 6070
483 Ga0496112_0022291 3300048915 Bacteria 6034
484 Ga0496112_0042483 3300048915 Bacteria 4447
485 Ga0496112_0049387 3300048915 Bacteria 4124
486 Ga0496112_0400164 3300048915 Bacteria 1313
487 Ga0496112_0408811 3300048915 Bacteria 1296
488 Ga0496113_0001938 3300048916 Bacteria 11845
489 Ga0496114_0014110 3300048917 Bacteria 6405
490 Ga0496114_0031553 3300048917 Bacteria 4359
491 Ga0496114_0037283 3300048917 Bacteria 4020
492 Ga0496114_0039612 3300048917 Bacteria 3900
493 Ga0496114_0101409 3300048917 Bacteria 2458
494 Ga0496114_0112164 3300048917 Bacteria 2337
495 Ga0496115_0001134 3300048918 Bacteria 19237
496 Ga0496115_0140350 3300048918 Bacteria 1994
497 Ga0496115_0208708 3300048918 Bacteria 1613
498 Ga0496115_0360806 3300048918 Bacteria 1184
499 Ga0496116_0000441 3300048919 Bacteria 58149
500 Ga0496117_0025669 3300048920 Bacteria 4627
501 Ga0496118_0005040 3300048921 Bacteria 15236
502 Ga0496118_0075915 3300048921 Bacteria 2393
503 Ga0496118_0084957 3300048921 Bacteria 2206
504 Ga0496119_0001484 3300048922 Bacteria 28124
505 Ga0496119_0021019 3300048922 Bacteria 4733
506 Ga0496119_0031659 3300048922 Bacteria 3540
507 Ga0496120_0001894 3300048923 Bacteria 23214
508 Ga0496121_0032823 3300048924 Bacteria 4710
509 Ga0496121_0052296 3300048924 Bacteria 3432
510 Ga0496124_0063748 3300048927 Bacteria 3078
511 Ga0496125_0060265 3300048928 Bacteria 3052
512 Ga0496125_0269580 3300048928 Bacteria 1062
513 Ga0496126_0020971 3300048929 Bacteria 6395
514 Ga0496126_0230653 3300048929 Bacteria 1551
515 Ga0501031_0000058 3300049568 Bacteria 59109
516 Ga0501032_0002722 3300049569 Bacteria 13772
517 Ga0501033_0015135 3300049570 Bacteria 5853
518 Ga0501034_0017696 3300049571 Bacteria 7308
519 Ga0501034_0042047 3300049571 Bacteria 4625
520 Ga0501034_0269645 3300049571 Bacteria 1643
521 Ga0501036_0143599 3300049572 Bacteria 2013
522 Ga0501037_0002322 3300049573 Bacteria 13746
523 Ga0501038_0000485 3300049574 Bacteria 34975
524 Ga0501039_0091953 3300049575 Bacteria 2365
525 Ga0501039_0255958 3300049575 Bacteria 1376
526 Ga0501042_0050607 3300049578 Bacteria 2963
527 Ga0501042_0096561 3300049578 Bacteria 2123
528 Ga0501043_0002786 3300049579 Bacteria 14607
529 Ga0501043_0065129 3300049579 Bacteria 2862
530 Ga0501046_0003436 3300049580 Bacteria 14532
531 Ga0501047_0000647 3300049581 Bacteria 36587
532 Ga0501047_0050484 3300049581 Bacteria 4017
533 Ga0501047_0226448 3300049581 Bacteria 1724
534 Ga0501047_0268533 3300049581 Bacteria 1552
535 Ga0501048_0002614 3300049582 Bacteria 13786
536 Ga0501048_0031782 3300049582 Bacteria 3818
537 Ga0501067_0000031 3300049583 Bacteria 87732
538 Ga0501067_0017294 3300049583 Bacteria 3984
539 Ga0501067_0259559 3300049583 Bacteria 967
540 Ga0501068_0000010 3300049584 Bacteria 66003
541 Ga0501068_0099840 3300049584 Bacteria 1798
542 Ga0501069_0000032 3300049585 Bacteria 96425
543 Ga0501069_0013992 3300049585 Bacteria 4286
544 Ga0501069_0018008 3300049585 Bacteria 3809
545 Ga0501069_0168996 3300049585 Unclassified 1261
546 Ga0501070_0000309 3300049586 Bacteria 44629
547 Ga0501070_0039396 3300049586 Bacteria 3942
548 Ga0501071_0032605 3300049587 Bacteria 3700
549 Ga0501072_0194301 3300049588 Bacteria 1618
550 Ga0501073_0109804 3300049589 Bacteria 1913
551 Ga0501074_0077931 3300049590 Bacteria 2378
552 Ga0501079_0034967 3300049741 Bacteria 3866
553 Ga0501079_0044196 3300049741 Bacteria 3438
554 Ga0501079_0253760 3300049741 Bacteria 1375
555 Ga0501080_0228964 3300049742 Bacteria 1699
556 Ga0501081_0050372 3300049743 Bacteria 2869
557 Ga0501035_0020800 3300049822 Bacteria 6028
558 Ga0501044_0001651 3300049823 Bacteria 26204
559 Ga0501044_0097969 3300049823 Bacteria 2952
560 nmdc:mga05p37_319075_c1 3300050507 Bacteria 1839
561 nmdc:mga09592_63716_c1 3300050508 Bacteria 3120
562 nmdc:mga08y16_495077_c1 3300050511 Bacteria 1243
563 nmdc:mga0n895_131020_c1 3300050512 Bacteria 2533
564 nmdc:mga0n895_247783_c1 3300050512 Bacteria 1808
565 nmdc:mga0n895_88486_c1 3300050512 Bacteria 3097
566 nmdc:mga0rr50_300509_c1 3300050513 Bacteria 1343
567 nmdc:mga0rr50_46336_c1 3300050513 Bacteria 3201
568 nmdc:mga08x19_100039_c1 3300050514 Bacteria 1923
569 nmdc:mga08x19_5861_c1 3300050514 Bacteria 7270
570 nmdc:mga08x19_62918_c1 3300050514 Bacteria 2407
571 nmdc:mga0a205_80362_c1 3300050515 Bacteria 3151
572 nmdc:mga0a205_86634_c1 3300050515 Bacteria 3025
573 Ga0495601_0004984 3300053077 Bacteria 7709
574 Ga0495601_0079238 3300053077 Bacteria 2106
575 Ga0495601_0082129 3300053077 Bacteria 2068
576 Ga0495601_0219218 3300053077 Bacteria 1243
577 Ga0495595_0001606 3300053084 Bacteria 8818
578 Ga0495595_0088039 3300053084 Bacteria 1487
579 Ga0495619_0009718 3300053085 Bacteria 6064
580 Ga0495619_0193450 3300053085 Bacteria 1408
581 Ga0500566_0054748 3300053094 Bacteria 2274
582 Ga0500572_030666 3300053111 Bacteria 1497
583 Ga0500658_0066416 3300053134 Bacteria 1513
584 Ga0500568_0044074 3300053139 Bacteria 1781
585 Ga0500616_0029955 3300053153 Bacteria 2991
586 Ga0501084_0029513 3300054114 Bacteria 4587
587 Ga0501082_0013634 3300060353 Bacteria 6986
588 Ga0466962_0032772 3300061719 Bacteria 2486
589 Ga0466962_0091691 3300061719 Bacteria 1456
590 Ga0530510_0010459 3300061734 Bacteria 6506
591 Ga0530510_0063714 3300061734 Bacteria 2669
592 Ga0530510_0165667 3300061734 Bacteria 1636
593 2644229713 2643221641 Bacteria 4490190
594 2856742721 2856741275 Bacteria 8096094
595 2891404220 2891395885 Bacteria 9251614
596 2891562045 2891554331 Bacteria 8812224
597 2891565002 2891562705 Bacteria 8039471
598 Ga0163163_10514900
599 Ga0070683_100003225
600 Ga0070683_100015581
601 Ga0070683_100030455
602 Ga0070683_100039278
603 Ga0070666_10107850
604 Ga0070680_100002170
605 Ga0070680_100010521
606 Ga0070682_100049865
607 Ga0070682_100052056
608 Ga0070682_100072884
609 Ga0070682_100080812
610 Ga0068868_100023214
611 Ga0068868_100028653
612 Ga0068868_100069246
613 Ga0070660_100008777
614 Ga0070691_10007083
615 Ga0070687_100061509
616 Ga0070692_10005087
617 Ga0070668_100173074
618 Ga0070671_100046207
619 Ga0070671_100184943
620 Ga0070659_100019489
621 Ga0070659_100116133
622 Ga0070659_100241529
623 Ga0070667_100009366
624 Ga0070709_10175924
625 Ga0070714_100163275
626 Ga0070714_100211772
627 Ga0070713_100048274
628 Ga0070713_100070322
629 Ga0070713_100236245
630 Ga0070710_10028698
631 Ga0070710_10103619
632 Ga0070711_100019758
633 Ga0070705_100021168
634 Ga0070700_100005180
635 Ga0070700_100182381
636 Ga0070694_100030564
637 Ga0070663_100262326
638 Ga0070678_100014820
639 Ga0070678_100136784
640 Ga0070662_100015570
641 Ga0070681_10000389
642 Ga0070681_10036940
643 Ga0070681_10043873
644 Ga0068867_100015132
645 Ga0068867_100053246
646 Ga0070698_100015738
647 Ga0070679_100000432
648 Ga0070679_100001364
649 Ga0070679_100067321
650 Ga0070679_100073354
651 Ga0070679_100084818
652 Ga0070679_100186674
653 Ga0070679_100342170
654 Ga0070684_100014577
655 Ga0070684_100021769
656 Ga0070684_100034944
657 Ga0070684_100047128
658 Ga0070684_100109026
659 Ga0070684_100250706
660 Ga0068853_100065858
661 Ga0068853_100222962
662 Ga0070686_100045397
663 Ga0070686_100051309
664 Ga0070696_100011731
665 Ga0070696_100021145
666 Ga0070693_100004465
667 Ga0070693_100014558
668 Ga0070665_100149968
669 Ga0070665_100171449
670 Ga0070704_100063834
671 Ga0068855_100025453
672 Ga0068855_100056258
673 Ga0068855_100062246
674 Ga0068855_100187441
675 Ga0068855_100312630
676 Ga0070664_100005588
677 Ga0070664_100037399
678 Ga0068857_100060610
679 Ga0068854_100028280
680 Ga0068856_100085745
681 Ga0068856_100243628
682 Ga0070702_100019322
683 Ga0068852_100018755
684 Ga0068852_100047997
685 Ga0068859_100119675
686 Ga0068864_100058454
687 Ga0068864_100082227
688 Ga0068864_100097262
689 Ga0068866_10002851
690 Ga0068866_10030984
691 Ga0068861_100041688
692 Ga0068861_100248361
693 Ga0068863_100098528
694 Ga0068858_100066785
695 Ga0068860_100197881
696 Ga0068860_100257417
697 Ga0068862_100000510
698 Ga0068862_100031590
699 Ga0081455_10010784
700 Ga0081455_10038446
701 Ga0081538_10016041
702 Ga0081540_1009141
703 Ga0081540_1014982
704 Ga0070717_10033367
705 Ga0070717_10060400
706 Ga0070717_10297670
707 Ga0075432_10014031
708 Ga0070715_10083554
709 Ga0070716_100103814
710 Ga0070716_100177489
711 Ga0070712_100017253
712 Ga0097621_100046456
713 Ga0068871_100040342
714 Ga0075428_100018030
715 Ga0075428_100114132
716 Ga0075428_100221146
717 Ga0075430_100002429
718 Ga0075430_100143414
719 Ga0075433_10082568
720 Ga0075433_10091074
721 Ga0075434_100005674
722 Ga0075429_100259703
723 Ga0068865_100077167
724 Ga0075436_100055638
725 Ga0075436_100114204
726 Ga0075436_100120628
727 Ga0097620_100119672
728 Ga0075435_100011150
729 Ga0075435_100019858
730 Ga0075435_100287453
731 Ga0105240_10012405
732 Ga0105240_10019995
733 Ga0105240_10113791
734 Ga0105240_10224947
735 Ga0105240_10418448
736 Ga0111539_10045842
737 Ga0111539_10111312
738 Ga0105245_10025810
739 Ga0105245_10036032
740 Ga0105245_10052738
741 Ga0105245_10109325
742 Ga0105245_10127540
743 Ga0105245_10136565
744 Ga0105245_10574636
745 Ga0114129_10094114
746 Ga0114129_10200400
747 Ga0105243_10008961
748 Ga0105243_10019768
749 Ga0105243_10039302
750 Ga0105243_10135297
751 Ga0105243_10252719
752 Ga0105241_10204309
753 Ga0105241_10241227
754 Ga0105242_10062841
755 Ga0105242_10222032
756 Ga0105248_10015966
757 Ga0105248_10059254
758 Ga0105248_10083536
759 Ga0105248_10095780
760 Ga0105248_10110073
761 Ga0105248_10134337
762 Ga0105237_10019493
763 Ga0105237_10349014
764 Ga0105237_10415289
765 Ga0105238_10078038
766 Ga0105238_10287409
767 Ga0105238_10387089
768 Ga0105249_10007467
769 Ga0105249_10060351
770 Ga0105249_10351355
771 Ga0105239_10063124
772 Ga0105239_10108285
773 Ga0105239_10113310
774 Ga0105246_10186550
775 Ga0157373_10107256
776 Ga0157373_10153164
777 Ga0157371_10045730
778 Ga0157370_10006514
779 Ga0157370_10507520
780 Ga0157369_10029323
781 Ga0157369_10150590
782 Ga0157369_10188938
783 Ga0157369_10345041
784 Ga0157374_10416544
785 Ga0157374_10437009
786 Ga0157378_10007242
787 Ga0157378_10028732
788 Ga0157378_10425071
789 Ga0163162_10363552
790 Ga0157372_10166394
791 Ga0157372_10384278
792 Ga0157372_10744608
793 Ga0157375_10007894
794 Ga0157375_10014719
795 Ga0157375_10103294
796 Ga0163163_10011817
797 Ga0163163_10048708
798 Ga0157380_10027943
799 Ga0157380_10225162
800 Ga0182008_10025657
801 Ga0157377_10019488
802 Ga0157377_10224521
803 Ga0157379_10027267
804 Ga0157379_10122190
805 Ga0157379_10150641
806 Ga0157379_10211601
807 Ga0157376_10005763
808 Ga0157376_10045765
809 Ga0157376_10266673
810 Ga0206356_11468302
811 Ga0207653_10018292
812 Ga0207692_10007180
813 Ga0207692_10087907
814 Ga0207710_10060327
815 Ga0207688_10184900
816 Ga0207680_10129001
817 Ga0207680_10164595
818 Ga0207645_10050880
819 Ga0207705_10166810
820 Ga0207707_10000109
821 Ga0207707_10111890
822 Ga0207707_10240268
823 Ga0207695_10013638
824 Ga0207695_10066307
825 Ga0207671_10027216
826 Ga0207671_10052836
827 Ga0207671_10176636
828 Ga0207693_10001725
829 Ga0207693_10309857
830 Ga0207663_10002887
831 Ga0207663_10060963
832 Ga0207663_10173341
833 Ga0207660_10001772
834 Ga0207660_10144556
835 Ga0207660_10321231
836 Ga0207662_10031709
837 Ga0207657_10013373
838 Ga0207657_10020652
839 Ga0207649_10152166
840 Ga0207652_10000248
841 Ga0207652_10000900
842 Ga0207652_10004169
843 Ga0207652_10010262
844 Ga0207652_10025461
845 Ga0207652_10063390
846 Ga0207687_10036898
847 Ga0207687_10188322
848 Ga0207687_10416058
849 Ga0207700_10229960
850 Ga0207664_10100558
851 Ga0207664_10207290
852 Ga0207644_10160417
853 Ga0207690_10009698
854 Ga0207690_10075595
855 Ga0207706_10006396
856 Ga0207686_10050979
857 Ga0207686_10107130
858 Ga0207686_10203788
859 Ga0207709_10031650
860 Ga0207670_10147339
861 Ga0207665_10003605
862 Ga0207691_10083617
863 Ga0207711_10053203
864 Ga0207711_10075258
865 Ga0207711_10098258
866 Ga0207661_10001916
867 Ga0207661_10096635
868 Ga0207679_10003163
869 Ga0207667_10033092
870 Ga0207667_10115465
871 Ga0207667_10116708
872 Ga0207667_10438239
873 Ga0207712_10104357
874 Ga0207712_10216493
875 Ga0207640_10061687
876 Ga0207640_10067280
877 Ga0207658_10024480
878 Ga0207658_10059699
879 Ga0207677_10030239
880 Ga0207677_10031180
881 Ga0207677_10163002
882 Ga0207703_10039091
883 Ga0207639_10133735
884 Ga0207678_10005158
885 Ga0207678_10045634
886 Ga0207702_10020480
887 Ga0207702_10126349
888 Ga0207702_10128485
889 Ga0207648_10027472
890 Ga0207648_10108218
891 Ga0207676_10223721
892 Ga0207674_10033681
893 Ga0207674_10076069
894 Ga0207674_10080449
895 Ga0207675_100017588
896 Ga0207675_100037798
897 Ga0207675_100083040
898 Ga0207683_10004132
899 Ga0207683_10056920
900 Ga0207683_10089503
901 Ga0207698_10038080
902 Ga0207698_10118278
903 Ga0209998_10011918
904 Ga0207428_10029242
905 Ga0207428_10064950
906 Ga0268266_10000406
907 Ga0268265_10009761
908 Ga0268264_10052743
909 Ga0265319_1014850
910 Ga0265319_1040462
911 Ga0265334_10002240
912 Ga0265318_10010527
913 Ga0265338_10026055
914 Ga0265338_10087525
915 Ga0265338_10152283
916 Ga0265332_10012597
917 Ga0265325_10006999
918 Ga0265325_10015611
919 Ga0265340_10004670
920 Ga0265339_10108802
921 Ga0265316_10021507
922 Ga0265314_10025523
923 Ga0307405_10285287
924 Ga0307416_100055068
925 Ga0307415_100190534
926 Ga0373928_0035301
927 Ga0373944_0048942
928 Ga0373951_0008911
929 Ga0373945_0009448
930 Ga0373943_0009954
931 Ga0373943_0207871
932 Ga0373946_0017246
933 Ga0373955_0166791
934 Ga0373961_0071088
935 Ga0373927_0085845
936 Ga0373947_0007670
937 Ga0373937_0625391
938 Ga0373925_0105351
939 Ga0395899_0000614
940 Ga0395898_0008093
941 Ga0395898_0308714
942 Ga0395905_0003094
943 Ga0395901_0001542
944 Ga0395901_0131053
945 Ga0395901_0216405
946 Ga0451795_1063198
947 Ga0451798_0138267
948 Ga0451800_0933833
949 Ga0451802_0241505
950 Ga0451804_0599873
951 Ga0451807_0826841
952 Ga0451839_1417283
953 Ga0451841_1173131
954 Ga0451845_0312446
955 Ga0451849_1446404
956 Ga0451851_0670690
957 Ga0451855_0466827
958 Ga0451853_1409041
959 Ga0451853_1985226
960 Ga0439448_0017142
961 Ga0439459_0022340
962 Ga0466965_0140011
963 Ga0466966_0005854
964 Ga0466961_0009629
965 Ga0466963_0002778
966 Ga0466963_0002920
967 Ga0466964_0001744
968 Ga0466971_0057252
969 Ga0466968_0034543
970 Ga0466970_0108799
971 Ga0466957_0117616
972 Ga0466960_0000003
973 Ga0466960_0066433
974 Ga0466960_0108778
975 Ga0466960_0127366
976 Ga0466959_0076933
977 Ga0466959_0143353
978 Ga0466958_0021497
979 Ga0466958_0123305
980 Ga0466967_0004040
981 Ga0466967_0024629
982 Ga0466967_0031792
983 Ga0466967_0032332
984 Ga0466967_0203090
985 Ga0495603_0000065
986 Ga0495641_0006525
987 Ga0495653_0160342
988 Ga0495650_0000053
989 Ga0495580_0032597
990 Ga0495582_0005435
991 Ga0495664_0000007
992 Ga0495664_0018844
993 Ga0495594_0005133
994 Ga0495594_0006993
995 Ga0495596_0109799
996 Ga0495608_0042395
997 Ga0495628_0000891
998 Ga0495652_0342603
999 Ga0495587_0021592
1000 Ga0495645_0163728
1001 Ga0495634_0058532
1002 Ga0495657_0114175
1003 Ga0495599_0028906
1004 Ga0495646_0012695
1005 Ga0495658_0029271
1006 Ga0495674_0059682
1007 Ga0495676_0000444
1008 Ga0495676_0042791
1009 Ga0495680_0229809
1010 Ga0495684_0044420
1011 Ga0495684_0089440
1012 Ga0495686_0107931
1013 Ga0495602_0000533
1014 Ga0496100_0002209
1015 Ga0496100_0019691
1016 Ga0496100_0039134
1017 Ga0496100_0111672
1018 Ga0496100_0220841
1019 Ga0496100_0326809
1020 Ga0496101_0004150
1021 Ga0496101_0059585
1022 Ga0496101_0101867
1023 Ga0496101_0106736
1024 Ga0496102_0023310
1025 Ga0496102_0047737
1026 Ga0496102_0057030
1027 Ga0496102_0125159
1028 Ga0496102_0180760
1029 Ga0496102_0306499
1030 Ga0496102_0508472
1031 Ga0496102_0524115
1032 Ga0496103_0044000
1033 Ga0496104_0000647
1034 Ga0496104_0005379
1035 Ga0496104_0014887
1036 Ga0496104_0069697
1037 Ga0496104_0072012
1038 Ga0496104_0092404
1039 Ga0496104_0113418
1040 Ga0496105_0008415
1041 Ga0496105_0014471
1042 Ga0496105_0026893
1043 Ga0496105_0043284
1044 Ga0496105_0043926
1045 Ga0496105_0049153
1046 Ga0496105_0132175
1047 Ga0496106_0006195
1048 Ga0496106_0016306
1049 Ga0496106_0093541
1050 Ga0496106_0123354
1051 Ga0496107_0025569
1052 Ga0496107_0053818
1053 Ga0496107_0077461
1054 Ga0496107_0180676
1055 Ga0496107_0373857
1056 Ga0496108_0000632
1057 Ga0496108_0009048
1058 Ga0496108_0034929
1059 Ga0496108_0065740
1060 Ga0496108_0164281
1061 Ga0496109_0003540
1062 Ga0496109_0041443
1063 Ga0496109_0174082
1064 Ga0496109_0182112
1065 Ga0496110_0009847
1066 Ga0496110_0015250
1067 Ga0496110_0050894
1068 Ga0496110_0052536
1069 Ga0496110_0135835
1070 Ga0496110_0294870
1071 Ga0496111_0000319
1072 Ga0496111_0005473
1073 Ga0496111_0006910
1074 Ga0496111_0014498
1075 Ga0496111_0025487
1076 Ga0496111_0036669
1077 Ga0496111_0038057
1078 Ga0496112_0021172
1079 Ga0496112_0021993
1080 Ga0496112_0022291
1081 Ga0496112_0042483
1082 Ga0496112_0049387
1083 Ga0496112_0400164
1084 Ga0496112_0408811
1085 Ga0496113_0001938
1086 Ga0496114_0014110
1087 Ga0496114_0031553
1088 Ga0496114_0037283
1089 Ga0496114_0039612
1090 Ga0496114_0101409
1091 Ga0496114_0112164
1092 Ga0496115_0001134
1093 Ga0496115_0140350
1094 Ga0496115_0208708
1095 Ga0496115_0360806
1096 Ga0496116_0000441
1097 Ga0496117_0025669
1098 Ga0496118_0005040
1099 Ga0496118_0075915
1100 Ga0496118_0084957
1101 Ga0496119_0001484
1102 Ga0496119_0021019
1103 Ga0496119_0031659
1104 Ga0496120_0001894
1105 Ga0496121_0032823
1106 Ga0496121_0052296
1107 Ga0496124_0063748
1108 Ga0496125_0060265
1109 Ga0496125_0269580
1110 Ga0496126_0020971
1111 Ga0496126_0230653
1112 Ga0501031_0000058
1113 Ga0501032_0002722
1114 Ga0501033_0015135
1115 Ga0501034_0017696
1116 Ga0501034_0042047
1117 Ga0501034_0269645
1118 Ga0501036_0143599
1119 Ga0501037_0002322
1120 Ga0501038_0000485
1121 Ga0501039_0091953
1122 Ga0501039_0255958
1123 Ga0501042_0050607
1124 Ga0501042_0096561
1125 Ga0501043_0002786
1126 Ga0501043_0065129
1127 Ga0501046_0003436
1128 Ga0501047_0000647
1129 Ga0501047_0050484
1130 Ga0501047_0226448
1131 Ga0501047_0268533
1132 Ga0501048_0002614
1133 Ga0501048_0031782
1134 Ga0501067_0000031
1135 Ga0501067_0017294
1136 Ga0501067_0259559
1137 Ga0501068_0000010
1138 Ga0501068_0099840
1139 Ga0501069_0000032
1140 Ga0501069_0013992
1141 Ga0501069_0018008
1142 Ga0501069_0168996
1143 Ga0501070_0000309
1144 Ga0501070_0039396
1145 Ga0501071_0032605
1146 Ga0501072_0194301
1147 Ga0501073_0109804
1148 Ga0501074_0077931
1149 Ga0501079_0034967
1150 Ga0501079_0044196
1151 Ga0501079_0253760
1152 Ga0501080_0228964
1153 Ga0501081_0050372
1154 Ga0501035_0020800
1155 Ga0501044_0001651
1156 Ga0501044_0097969
1157 nmdc:mga05p37_319075_c1
1158 nmdc:mga09592_63716_c1
1159 nmdc:mga08y16_495077_c1
1160 nmdc:mga0n895_131020_c1
1161 nmdc:mga0n895_247783_c1
1162 nmdc:mga0n895_88486_c1
1163 nmdc:mga0rr50_300509_c1
1164 nmdc:mga0rr50_46336_c1
1165 nmdc:mga08x19_100039_c1
1166 nmdc:mga08x19_5861_c1
1167 nmdc:mga08x19_62918_c1
1168 nmdc:mga0a205_80362_c1
1169 nmdc:mga0a205_86634_c1
1170 Ga0495601_0004984
1171 Ga0495601_0079238
1172 Ga0495601_0082129
1173 Ga0495601_0219218
1174 Ga0495595_0001606
1175 Ga0495595_0088039
1176 Ga0495619_0009718
1177 Ga0495619_0193450
1178 Ga0500566_0054748
1179 Ga0500572_030666
1180 Ga0500658_0066416
1181 Ga0500568_0044074
1182 Ga0500616_0029955
1183 Ga0501084_0029513
1184 Ga0501082_0013634
1185 Ga0466962_0032772
1186 Ga0466962_0091691
1187 Ga0530510_0010459
1188 Ga0530510_0063714
1189 Ga0530510_0165667
1190 2644229713
1191 2856742721
1192 2891404220
1193 2891562045
1194 2891565002

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

31

275

0.91

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

34

296

0.81

PF13343

SBP_bac_6

Bacterial extracellular solute-binding protein

102

297

0.79

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

35

267

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.9685 35 316
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.9496 35 326
6ddn-assembly2.cif.gz_B the sulfate-binding protein subi from mycobacterium tuberculosis h37rv 0.9486 35 316
5um2-assembly1.cif.gz_A functional and structural characterization of a sulfate-binding protein (sbp) from xanthomonas citri 0.9412 35 327
1sbp-assembly1.cif.gz_A 1.7 angstroms refined structure of sulfate-binding protein involved in active transport and novel mode of sulfate binding 0.8959 35 326
ID Description Score Start End Superfamily
af_P71744_144_341_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9657 123 316 3.40.190.10
6ddnB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9558 123 316 3.40.190.10
6ddnB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9494 123 316 3.40.190.10
af_P71744_144_341_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9417 123 316 3.40.190.10
af_Q2FVX4_42_108_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9414 37 103 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5C4J6M7-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9968 35 335 GO:0042597
GO:1902358
AF-A0A4R4XS67-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9901 28 335 GO:0042597
GO:1902358
AF-A0A5C4J6M7-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9869 35 335 GO:0042597
GO:1902358
AF-A0A4R4XS67-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9837 28 335 GO:0042597
GO:1902358
AF-K6W9W5-F1-model_v4 Sulfate ABC transporter substrate-binding protein 0.9777 33 114 GO:0016020
GO:0042597
GO:1902358

Map