F467659

General Info

Members Datasets Scaffolds Average Seq Length
597 235 1194 296

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10084890|Ga0105238_100848903
Length 341
Sequence MYMMDGGFSFRDIVCVNMAGQKPRGESMERKVASDYPQELLDLFHEYQHGDISRRTFLDRAAKFAVGGLTVTAIFESLRPNYAWAQQVPPDDKRIKVGYETVQSPEGNGSIKGYLARPAKSGKLPAVLVIHENRGLNPYIEDVARRLALANFIAFAPDGLTSVGGYPGSDEKGAEAFRKVDGKKMTEDFVAAAKWLKARSDSTRKLGAVGFCFGGGMVNQLAVRLGPDLNAGVAFYGRQAGAEDVPKISAPLLLQYAGNDQRINEGIPAYEAALKANKKVYQVYMYEGKQHGFHNDTTPRYDEESAKLAWSRTLEFFNKHLRYALPQKLDSALGSGQYRER

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
190 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
206 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
207 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
213 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
214 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
215 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
216 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
217 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
218 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
221 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
233 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
234 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
235 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0
Isolates 0.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 1.17
Rhizosphere 96.98
Stem 0
Stem Tuber 0
Unclassified 8.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10084890 3300009551 Bacteria 3155
2 MRS1b_contig_1059780 2162886011 Bacteria 1065
3 CNAas_1000215 3300000532 Bacteria 5422
4 JGI24751J29686_10000286 3300002459 Bacteria 19499
5 JGI25406J46586_10017924 3300003203 Bacteria 2917
6 rootL2_10204455 3300003322 Bacteria 2715
7 Ga0065704_10175103 3300005289 Bacteria 1240
8 Ga0065704_10185400 3300005289 Bacteria 1216
9 Ga0065712_10071847 3300005290 Bacteria 5031
10 Ga0065712_10082820 3300005290 Bacteria 2883
11 Ga0065715_10006714 3300005293 Bacteria 3064
12 Ga0065715_10019782 3300005293 Bacteria 1977
13 Ga0065715_10090856 3300005293 Bacteria 6374
14 Ga0065715_10170582 3300005293 Bacteria 1550
15 Ga0065715_10211639 3300005293 Bacteria 1311
16 Ga0065707_10086611 3300005295 Bacteria 5385
17 Ga0065707_10086676 3300005295 Bacteria 5356
18 Ga0070658_10186809 3300005327 Bacteria 1746
19 Ga0070690_100090203 3300005330 Unclassified 2018
20 Ga0070670_100000227 3300005331 Bacteria 51904
21 Ga0070670_100068847 3300005331 Bacteria 3038
22 Ga0070670_100083558 3300005331 Bacteria 2743
23 Ga0070670_100105551 3300005331 Bacteria 2427
24 Ga0070670_100179671 3300005331 Bacteria 1837
25 Ga0070670_100473621 3300005331 Bacteria 1111
26 Ga0070677_10012410 3300005333 Bacteria 2959
27 Ga0068869_100053461 3300005334 Bacteria 2937
28 Ga0068869_100187915 3300005334 Bacteria 1623
29 Ga0070666_10033778 3300005335 Bacteria 3388
30 Ga0070666_10287054 3300005335 Bacteria 1170
31 Ga0070680_100004191 3300005336 Bacteria 10811
32 Ga0070680_100120709 3300005336 Bacteria 2188
33 Ga0070680_100399769 3300005336 Bacteria 1171
34 Ga0070680_100495380 3300005336 Bacteria 1045
35 Ga0070682_100003984 3300005337 Bacteria 8204
36 Ga0070682_100004655 3300005337 Bacteria 7621
37 Ga0068868_100017398 3300005338 Bacteria 5356
38 Ga0068868_100313280 3300005338 Unclassified 1335
39 Ga0068868_100319530 3300005338 Unclassified 1322
40 Ga0070660_100007932 3300005339 Bacteria 7410
41 Ga0070689_100003150 3300005340 Bacteria 10914
42 Ga0070689_100017816 3300005340 Bacteria 5222
43 Ga0070689_100117263 3300005340 Unclassified 2123
44 Ga0070687_100021195 3300005343 Unclassified 3050
45 Ga0070687_100023539 3300005343 Unclassified 2928
46 Ga0070687_100129745 3300005343 Bacteria 1454
47 Ga0070661_100003944 3300005344 Bacteria 10203
48 Ga0070692_10012016 3300005345 Bacteria 3994
49 Ga0070692_10040418 3300005345 Bacteria 2386
50 Ga0070669_100075001 3300005353 Bacteria 2508
51 Ga0070669_100165707 3300005353 Bacteria 1720
52 Ga0070669_100182756 3300005353 Bacteria 1641
53 Ga0070669_100260208 3300005353 Unclassified 1384
54 Ga0070675_100025414 3300005354 Unclassified 4748
55 Ga0070675_100100207 3300005354 Bacteria 2439
56 Ga0070675_100169655 3300005354 Bacteria 1881
57 Ga0070671_100011546 3300005355 Bacteria 7103
58 Ga0070671_100011649 3300005355 Bacteria 7074
59 Ga0070671_100074095 3300005355 Bacteria 2844
60 Ga0070673_100138353 3300005364 Bacteria 2052
61 Ga0070673_100169552 3300005364 Bacteria 1862
62 Ga0070673_100469873 3300005364 Bacteria 1134
63 Ga0070688_100130911 3300005365 Bacteria 1692
64 Ga0070688_100202752 3300005365 Bacteria 1389
65 Ga0070688_100237282 3300005365 Unclassified 1292
66 Ga0070659_100000889 3300005366 Bacteria 21843
67 Ga0070659_100011988 3300005366 Bacteria 6419
68 Ga0070667_100006161 3300005367 Bacteria 9969
69 Ga0070667_100028857 3300005367 Bacteria 4620
70 Ga0070703_10000112 3300005406 Bacteria 42152
71 Ga0070701_10028533 3300005438 Bacteria 2744
72 Ga0070701_10137072 3300005438 Unclassified 1396
73 Ga0070705_100041998 3300005440 Bacteria 2611
74 Ga0070700_100000110 3300005441 Bacteria 52465
75 Ga0070700_100007453 3300005441 Bacteria 5911
76 Ga0070700_100012259 3300005441 Bacteria 4778
77 Ga0070700_100035893 3300005441 Bacteria 3003
78 Ga0070700_100060766 3300005441 Bacteria 2382
79 Ga0070700_100081107 3300005441 Bacteria 2095
80 Ga0070700_100098637 3300005441 Bacteria 1920
81 Ga0070694_100001105 3300005444 Bacteria 15437
82 Ga0070694_100001147 3300005444 Bacteria 15210
83 Ga0070694_100012567 3300005444 Bacteria 5267
84 Ga0070694_100031235 3300005444 Bacteria 3491
85 Ga0070694_100092595 3300005444 Bacteria 2124
86 Ga0070694_100150779 3300005444 Bacteria 1698
87 Ga0070694_100222368 3300005444 Bacteria 1417
88 Ga0070694_100222556 3300005444 Bacteria 1416
89 Ga0070708_100063942 3300005445 Bacteria 3295
90 Ga0070708_100124751 3300005445 Bacteria 2379
91 Ga0070663_100193418 3300005455 Bacteria 1584
92 Ga0070662_100470604 3300005457 Unclassified 1045
93 Ga0070681_10052339 3300005458 Bacteria 4071
94 Ga0068867_100139614 3300005459 Bacteria 1893
95 Ga0068867_100187422 3300005459 Unclassified 1649
96 Ga0070685_10008274 3300005466 Bacteria 5339
97 Ga0070685_10062791 3300005466 Bacteria 2179
98 Ga0070706_100002818 3300005467 Bacteria 17396
99 Ga0070706_100411108 3300005467 Bacteria 1260
100 Ga0070707_100021645 3300005468 Bacteria 6078
101 Ga0070698_100002760 3300005471 Bacteria 19303
102 Ga0070698_100031846 3300005471 Bacteria 5466
103 Ga0070698_100040791 3300005471 Bacteria 4769
104 Ga0070698_100111924 3300005471 Bacteria 2695
105 Ga0070699_100229194 3300005518 Bacteria 1656
106 Ga0070679_100006877 3300005530 Bacteria 10609
107 Ga0070679_100017739 3300005530 Bacteria 6891
108 Ga0070684_100103879 3300005535 Bacteria 2542
109 Ga0070697_100000157 3300005536 Bacteria 55346
110 Ga0070697_100001568 3300005536 Bacteria 17418
111 Ga0070697_100089889 3300005536 Bacteria 2537
112 Ga0068853_100022034 3300005539 Bacteria 5316
113 Ga0068853_100030132 3300005539 Bacteria 4581
114 Ga0068853_100070940 3300005539 Bacteria 3033
115 Ga0070672_100004284 3300005543 Bacteria 9326
116 Ga0070686_100004306 3300005544 Bacteria 7836
117 Ga0070686_100023302 3300005544 Bacteria 3699
118 Ga0070686_100061526 3300005544 Bacteria 2426
119 Ga0070695_100022863 3300005545 Bacteria 3837
120 Ga0070695_100087853 3300005545 Bacteria 2069
121 Ga0070695_100122358 3300005545 Unclassified 1782
122 Ga0070695_100329464 3300005545 Bacteria 1138
123 Ga0070693_100002834 3300005547 Bacteria 7982
124 Ga0070693_100222351 3300005547 Bacteria 1238
125 Ga0070665_100257330 3300005548 Unclassified 1747
126 Ga0070704_100046076 3300005549 Bacteria 3038
127 Ga0070704_100160823 3300005549 Bacteria 1776
128 Ga0070704_100177863 3300005549 Bacteria 1699
129 Ga0070704_100201027 3300005549 Bacteria 1608
130 Ga0070704_100412009 3300005549 Bacteria 1156
131 Ga0068855_100035888 3300005563 Bacteria 5904
132 Ga0068857_100001173 3300005577 Bacteria 20456
133 Ga0068857_100044466 3300005577 Bacteria 3939
134 Ga0068857_100080918 3300005577 Bacteria 2900
135 Ga0068857_100350282 3300005577 Bacteria 1367
136 Ga0068854_100101152 3300005578 Bacteria 2161
137 Ga0068854_100290577 3300005578 Unclassified 1319
138 Ga0070702_100062583 3300005615 Bacteria 2170
139 Ga0070702_100146923 3300005615 Bacteria 1509
140 Ga0070702_100157307 3300005615 Bacteria 1465
141 Ga0070702_100205302 3300005615 Bacteria 1307
142 Ga0068852_100102344 3300005616 Bacteria 2588
143 Ga0068859_100002623 3300005617 Bacteria 18299
144 Ga0068859_100017842 3300005617 Bacteria 7135
145 Ga0068859_100018758 3300005617 Bacteria 6951
146 Ga0068859_100018770 3300005617 Bacteria 6950
147 Ga0068859_100021100 3300005617 Bacteria 6536
148 Ga0068859_100021236 3300005617 Bacteria 6515
149 Ga0068859_100037992 3300005617 Bacteria 4832
150 Ga0068859_100113388 3300005617 Bacteria 2775
151 Ga0068859_100142556 3300005617 Bacteria 2470
152 Ga0068859_100178275 3300005617 Bacteria 2207
153 Ga0068859_100217597 3300005617 Bacteria 1998
154 Ga0068859_100239451 3300005617 Bacteria 1903
155 Ga0068859_100293620 3300005617 Unclassified 1718
156 Ga0068859_100328499 3300005617 Bacteria 1623
157 Ga0068859_100339862 3300005617 Bacteria 1595
158 Ga0068859_100462318 3300005617 Bacteria 1365
159 Ga0068864_100033648 3300005618 Bacteria 4358
160 Ga0068864_100042187 3300005618 Unclassified 3904
161 Ga0068864_100050076 3300005618 Bacteria 3594
162 Ga0068864_100106155 3300005618 Bacteria 2497
163 Ga0068864_100127427 3300005618 Bacteria 2283
164 Ga0068864_100127685 3300005618 Bacteria 2280
165 Ga0068864_100187152 3300005618 Bacteria 1896
166 Ga0068864_100315457 3300005618 Bacteria 1467
167 Ga0068866_10135857 3300005718 Bacteria 1405
168 Ga0068861_100003427 3300005719 Bacteria 10525
169 Ga0068861_100049468 3300005719 Unclassified 3183
170 Ga0068861_100080431 3300005719 Unclassified 2549
171 Ga0068861_100462154 3300005719 Bacteria 1139
172 Ga0068851_10002933 3300005834 Bacteria 7538
173 Ga0068870_10093920 3300005840 Unclassified 1683
174 Ga0068870_10182896 3300005840 Bacteria 1259
175 Ga0068863_100182831 3300005841 Bacteria 2012
176 Ga0068858_100025790 3300005842 Bacteria 5467
177 Ga0068858_100060351 3300005842 Bacteria 3505
178 Ga0068858_100149738 3300005842 Bacteria 2193
179 Ga0068858_100200584 3300005842 Unclassified 1886
180 Ga0068858_100223151 3300005842 Bacteria 1785
181 Ga0068858_100504905 3300005842 Bacteria 1168
182 Ga0068860_100009730 3300005843 Bacteria 9546
183 Ga0068860_100010319 3300005843 Bacteria 9236
184 Ga0068860_100043083 3300005843 Bacteria 4307
185 Ga0068860_100110611 3300005843 Bacteria 2626
186 Ga0068860_100148121 3300005843 Bacteria 2259
187 Ga0068860_100224169 3300005843 Bacteria 1826
188 Ga0068860_100326445 3300005843 Bacteria 1507
189 Ga0068860_100349300 3300005843 Bacteria 1455
190 Ga0068862_100026434 3300005844 Bacteria 4878
191 Ga0068862_100069694 3300005844 Bacteria 3035
192 Ga0068862_100141363 3300005844 Bacteria 2137
193 Ga0068862_100271639 3300005844 Bacteria 1551
194 Ga0068862_100282211 3300005844 Bacteria 1522
195 Ga0081455_10009448 3300005937 Bacteria 10030
196 Ga0081455_10044668 3300005937 Bacteria 3862
197 Ga0081539_10000701 3300005985 Bacteria 67220
198 Ga0081539_10001143 3300005985 Bacteria 48071
199 Ga0070712_100077815 3300006175 Bacteria 2392
200 Ga0097621_100007346 3300006237 Bacteria 7878
201 Ga0097621_100128626 3300006237 Bacteria 2153
202 Ga0097621_100363931 3300006237 Bacteria 1289
203 Ga0068871_100008773 3300006358 Bacteria 7280
204 Ga0068871_100011504 3300006358 Bacteria 6490
205 Ga0068871_100035238 3300006358 Bacteria 3975
206 Ga0068871_100114113 3300006358 Bacteria 2276
207 Ga0068871_100257821 3300006358 Bacteria 1520
208 Ga0075428_100041894 3300006844 Bacteria 5035
209 Ga0075428_100074178 3300006844 Bacteria 3716
210 Ga0075428_100211344 3300006844 Bacteria 2096
211 Ga0075428_100219368 3300006844 Bacteria 2054
212 Ga0075428_100317334 3300006844 Bacteria 1674
213 Ga0075428_100333417 3300006844 Bacteria 1629
214 Ga0075428_100454518 3300006844 Bacteria 1372
215 Ga0075428_100875441 3300006844 Bacteria 953
216 Ga0075430_100037018 3300006846 Bacteria 4136
217 Ga0075430_100072301 3300006846 Bacteria 2893
218 Ga0075430_100168116 3300006846 Bacteria 1824
219 Ga0075431_100033609 3300006847 Bacteria 5285
220 Ga0075431_100076691 3300006847 Bacteria 3450
221 Ga0075431_100127761 3300006847 Bacteria 2623
222 Ga0075431_100178533 3300006847 Bacteria 2179
223 Ga0075431_100204610 3300006847 Bacteria 2018
224 Ga0075431_100207563 3300006847 Bacteria 2002
225 Ga0075431_100327165 3300006847 Bacteria 1544
226 Ga0075433_10000013 3300006852 Bacteria 68708
227 Ga0075433_10042341 3300006852 Bacteria 3950
228 Ga0075433_10446271 3300006852 Bacteria 1140
229 Ga0075434_100004905 3300006871 Bacteria 12123
230 Ga0075434_100012353 3300006871 Bacteria 8091
231 Ga0075434_100070304 3300006871 Bacteria 3491
232 Ga0075429_100225412 3300006880 Bacteria 1641
233 Ga0075429_100285264 3300006880 Bacteria 1446
234 Ga0075429_100337577 3300006880 Bacteria 1319
235 Ga0068865_100127126 3300006881 Bacteria 1904
236 Ga0068865_100290335 3300006881 Unclassified 1305
237 Ga0075436_100008229 3300006914 Bacteria 7136
238 Ga0075436_100017274 3300006914 Bacteria 4938
239 Ga0097620_100002623 3300006931 Bacteria 18299
240 Ga0097620_100017842 3300006931 Bacteria 7135
241 Ga0097620_100018758 3300006931 Bacteria 6951
242 Ga0097620_100018770 3300006931 Bacteria 6950
243 Ga0097620_100021100 3300006931 Bacteria 6536
244 Ga0097620_100021239 3300006931 Bacteria 6515
245 Ga0097620_100037992 3300006931 Bacteria 4832
246 Ga0097620_100113392 3300006931 Bacteria 2775
247 Ga0097620_100142550 3300006931 Bacteria 2470
248 Ga0097620_100178275 3300006931 Bacteria 2207
249 Ga0097620_100217581 3300006931 Bacteria 1998
250 Ga0097620_100239457 3300006931 Bacteria 1903
251 Ga0097620_100293644 3300006931 Unclassified 1718
252 Ga0097620_100328512 3300006931 Bacteria 1623
253 Ga0097620_100339866 3300006931 Bacteria 1595
254 Ga0097620_100462339 3300006931 Bacteria 1365
255 Ga0075435_100000182 3300007076 Bacteria 37384
256 Ga0075435_100208901 3300007076 Bacteria 1655
257 Ga0105240_10647493 3300009093 Bacteria 1159
258 Ga0111539_10000689 3300009094 Bacteria 43768
259 Ga0111539_10019847 3300009094 Bacteria 8282
260 Ga0111539_10021115 3300009094 Bacteria 8018
261 Ga0111539_10055085 3300009094 Bacteria 4728
262 Ga0111539_10116659 3300009094 Bacteria 3130
263 Ga0111539_10725967 3300009094 Bacteria 1157
264 Ga0105245_10108353 3300009098 Unclassified 2580
265 Ga0105247_10000291 3300009101 Bacteria 45576
266 Ga0105247_10017766 3300009101 Bacteria 4265
267 Ga0114129_10000255 3300009147 Bacteria 60251
268 Ga0114129_10015763 3300009147 Bacteria 10745
269 Ga0114129_10120315 3300009147 Bacteria 3616
270 Ga0114129_10132140 3300009147 Bacteria 3427
271 Ga0114129_10144988 3300009147 Bacteria 3253
272 Ga0114129_10158039 3300009147 Bacteria 3099
273 Ga0114129_10209140 3300009147 Bacteria 2638
274 Ga0114129_10216122 3300009147 Bacteria 2589
275 Ga0114129_10685775 3300009147 Bacteria 1318
276 Ga0105243_10003087 3300009148 Bacteria 13714
277 Ga0105243_10004411 3300009148 Bacteria 11129
278 Ga0105243_10007561 3300009148 Bacteria 8357
279 Ga0105243_10063854 3300009148 Bacteria 2952
280 Ga0105241_10009320 3300009174 Bacteria 7217
281 Ga0105241_10024454 3300009174 Bacteria 4485
282 Ga0105241_10064083 3300009174 Unclassified 2837
283 Ga0105241_10155846 3300009174 Bacteria 1873
284 Ga0105242_10002773 3300009176 Bacteria 13714
285 Ga0105242_10003318 3300009176 Bacteria 12518
286 Ga0105242_10007481 3300009176 Bacteria 8406
287 Ga0105242_10100282 3300009176 Unclassified 2452
288 Ga0105242_10170020 3300009176 Bacteria 1915
289 Ga0105242_10374564 3300009176 Bacteria 1322
290 Ga0105248_10001456 3300009177 Bacteria 26372
291 Ga0105248_10041267 3300009177 Bacteria 5173
292 Ga0105248_10049356 3300009177 Unclassified 4720
293 Ga0105248_10138028 3300009177 Bacteria 2751
294 Ga0105248_10149440 3300009177 Bacteria 2636
295 Ga0105248_10168957 3300009177 Bacteria 2465
296 Ga0105248_10222984 3300009177 Bacteria 2122
297 Ga0105237_10001943 3300009545 Bacteria 26329
298 Ga0105238_10001915 3300009551 Bacteria 20880
299 Ga0105238_10091080 3300009551 Bacteria 3037
300 Ga0105249_10004687 3300009553 Bacteria 11809
301 Ga0105249_10029965 3300009553 Bacteria 4916
302 Ga0105249_10080828 3300009553 Unclassified 3020
303 Ga0105249_10130898 3300009553 Bacteria 2395
304 Ga0105249_10370280 3300009553 Bacteria 1456
305 Ga0105249_10909081 3300009553 Bacteria 947
306 Ga0157373_10016316 3300013100 Bacteria 5419
307 Ga0157373_10080920 3300013100 Bacteria 2290
308 Ga0157374_10067653 3300013296 Bacteria 3359
309 Ga0157374_10465100 3300013296 Bacteria 1267
310 Ga0157378_10010093 3300013297 Bacteria 8233
311 Ga0157378_10101560 3300013297 Unclassified 2627
312 Ga0157378_10162216 3300013297 Bacteria 2091
313 Ga0157378_10290166 3300013297 Bacteria 1580
314 Ga0163162_10023143 3300013306 Bacteria 6129
315 Ga0163162_10027490 3300013306 Bacteria 5626
316 Ga0163162_10127270 3300013306 Bacteria 2654
317 Ga0163162_10135962 3300013306 Bacteria 2569
318 Ga0157372_10094149 3300013307 Bacteria 3410
319 Ga0157372_10104939 3300013307 Bacteria 3232
320 Ga0157372_10909315 3300013307 Bacteria 1021
321 Ga0157375_10083696 3300013308 Bacteria 3236
322 Ga0157375_10114745 3300013308 Bacteria 2796
323 Ga0163163_10000008 3300014325 Bacteria 286490
324 Ga0163163_10000277 3300014325 Bacteria 51205
325 Ga0163163_10038496 3300014325 Bacteria 4661
326 Ga0163163_10080633 3300014325 Bacteria 3254
327 Ga0163163_10097800 3300014325 Bacteria 2956
328 Ga0163163_10108521 3300014325 Bacteria 2803
329 Ga0157380_10033603 3300014326 Bacteria 3951
330 Ga0157380_10097881 3300014326 Bacteria 2436
331 Ga0157380_10363338 3300014326 Bacteria 1359
332 Ga0157377_10031439 3300014745 Unclassified 2885
333 Ga0157379_10001274 3300014968 Bacteria 20496
334 Ga0157379_10010635 3300014968 Bacteria 8020
335 Ga0157376_10143890 3300014969 Unclassified 2142
336 Ga0157376_10176354 3300014969 Bacteria 1950
337 Ga0157376_10223460 3300014969 Bacteria 1745
338 Ga0182007_10025895 3300015262 Bacteria 2039
339 Ga0163161_10104269 3300017792 Unclassified 2114
340 Ga0213876_10000087 3300021384 Bacteria 105285
341 Ga0213876_10000182 3300021384 Bacteria 65229
342 Ga0213876_10078372 3300021384 Bacteria 1746
343 Ga0207656_10016434 3300025321 Bacteria 2881
344 Ga0207653_10000027 3300025885 Bacteria 113830
345 Ga0207653_10016693 3300025885 Bacteria 2306
346 Ga0207682_10040511 3300025893 Bacteria 1898
347 Ga0207710_10000983 3300025900 Bacteria 14983
348 Ga0207710_10019477 3300025900 Bacteria 2896
349 Ga0207710_10025495 3300025900 Bacteria 2551
350 Ga0207647_10005687 3300025904 Bacteria 9102
351 Ga0207647_10074846 3300025904 Bacteria 2039
352 Ga0207647_10168764 3300025904 Bacteria 1275
353 Ga0207645_10188324 3300025907 Bacteria 1355
354 Ga0207643_10022379 3300025908 Bacteria 3479
355 Ga0207643_10029971 3300025908 Bacteria 3027
356 Ga0207705_10400536 3300025909 Bacteria 1061
357 Ga0207654_10070649 3300025911 Bacteria 2073
358 Ga0207707_10052451 3300025912 Bacteria 3551
359 Ga0207671_10003734 3300025914 Bacteria 15006
360 Ga0207693_10096813 3300025915 Bacteria 2314
361 Ga0207663_10105109 3300025916 Bacteria 1905
362 Ga0207660_10019204 3300025917 Bacteria 4565
363 Ga0207662_10064183 3300025918 Unclassified 2209
364 Ga0207662_10304344 3300025918 Bacteria 1060
365 Ga0207657_10002452 3300025919 Bacteria 20036
366 Ga0207652_10035025 3300025921 Bacteria 4235
367 Ga0207652_10042882 3300025921 Bacteria 3852
368 Ga0207646_10113198 3300025922 Bacteria 2436
369 Ga0207646_10150340 3300025922 Bacteria 2099
370 Ga0207681_10041978 3300025923 Bacteria 3052
371 Ga0207681_10158881 3300025923 Bacteria 1701
372 Ga0207681_10182559 3300025923 Bacteria 1599
373 Ga0207681_10186031 3300025923 Bacteria 1586
374 Ga0207694_10026840 3300025924 Bacteria 4385
375 Ga0207694_10344063 3300025924 Bacteria 1233
376 Ga0207650_10000027 3300025925 Bacteria 257466
377 Ga0207650_10038887 3300025925 Bacteria 3476
378 Ga0207650_10074794 3300025925 Bacteria 2555
379 Ga0207659_10147952 3300025926 Bacteria 1831
380 Ga0207644_10005843 3300025931 Bacteria 8017
381 Ga0207644_10093876 3300025931 Bacteria 2241
382 Ga0207644_10377827 3300025931 Unclassified 1155
383 Ga0207690_10012922 3300025932 Bacteria 5003
384 Ga0207690_10019545 3300025932 Unclassified 4174
385 Ga0207706_10197875 3300025933 Bacteria 1762
386 Ga0207706_10409932 3300025933 Unclassified 1175
387 Ga0207706_10470220 3300025933 Bacteria 1087
388 Ga0207686_10000018 3300025934 Bacteria 189717
389 Ga0207686_10040825 3300025934 Bacteria 2824
390 Ga0207686_10320958 3300025934 Unclassified 1157
391 Ga0207709_10000025 3300025935 Bacteria 364795
392 Ga0207709_10006735 3300025935 Bacteria 6433
393 Ga0207709_10269690 3300025935 Unclassified 1252
394 Ga0207670_10000472 3300025936 Bacteria 22285
395 Ga0207670_10081706 3300025936 Bacteria 2262
396 Ga0207669_10249004 3300025937 Unclassified 1322
397 Ga0207669_10460906 3300025937 Bacteria 1009
398 Ga0207704_10142854 3300025938 Unclassified 1677
399 Ga0207691_10016882 3300025940 Bacteria 6926
400 Ga0207711_10017986 3300025941 Bacteria 5874
401 Ga0207711_10021297 3300025941 Bacteria 5415
402 Ga0207711_10025252 3300025941 Bacteria 4985
403 Ga0207711_10301349 3300025941 Unclassified 1478
404 Ga0207711_10303681 3300025941 Bacteria 1472
405 Ga0207711_10386176 3300025941 Bacteria 1300
406 Ga0207711_10561099 3300025941 Bacteria 1065
407 Ga0207689_10013757 3300025942 Bacteria 6895
408 Ga0207689_10022576 3300025942 Bacteria 5288
409 Ga0207689_10037999 3300025942 Bacteria 3989
410 Ga0207689_10286238 3300025942 Bacteria 1365
411 Ga0207689_10288241 3300025942 Bacteria 1360
412 Ga0207661_10331998 3300025944 Bacteria 1369
413 Ga0207679_10121598 3300025945 Bacteria 2080
414 Ga0207679_10149008 3300025945 Bacteria 1902
415 Ga0207651_10076358 3300025960 Bacteria 2395
416 Ga0207651_10116906 3300025960 Bacteria 2014
417 Ga0207651_10144145 3300025960 Bacteria 1844
418 Ga0207651_10473334 3300025960 Bacteria 1078
419 Ga0207712_10001843 3300025961 Bacteria 13980
420 Ga0207640_10339939 3300025981 Unclassified 1202
421 Ga0207658_10016606 3300025986 Bacteria 5066
422 Ga0207658_10190946 3300025986 Bacteria 1702
423 Ga0207677_10058459 3300026023 Unclassified 2655
424 Ga0207677_10128168 3300026023 Bacteria 1921
425 Ga0207703_10000521 3300026035 Bacteria 39492
426 Ga0207703_10022631 3300026035 Bacteria 4933
427 Ga0207703_10073104 3300026035 Bacteria 2835
428 Ga0207703_10137019 3300026035 Bacteria 2120
429 Ga0207639_10030134 3300026041 Bacteria 3977
430 Ga0207639_10069006 3300026041 Bacteria 2757
431 Ga0207639_10199212 3300026041 Unclassified 1716
432 Ga0207639_10275972 3300026041 Bacteria 1476
433 Ga0207639_10416283 3300026041 Bacteria 1214
434 Ga0207708_10000028 3300026075 Bacteria 164263
435 Ga0207708_10014279 3300026075 Bacteria 5941
436 Ga0207708_10022577 3300026075 Bacteria 4752
437 Ga0207708_10076111 3300026075 Unclassified 2574
438 Ga0207708_10112944 3300026075 Bacteria 2110
439 Ga0207708_10124466 3300026075 Bacteria 2011
440 Ga0207708_10136259 3300026075 Bacteria 1923
441 Ga0207702_10375708 3300026078 Bacteria 1366
442 Ga0207641_10015472 3300026088 Bacteria 6250
443 Ga0207641_10085552 3300026088 Bacteria 2748
444 Ga0207641_10160843 3300026088 Bacteria 2042
445 Ga0207648_10076428 3300026089 Bacteria 2919
446 Ga0207648_10167319 3300026089 Bacteria 1943
447 Ga0207648_10231120 3300026089 Unclassified 1645
448 Ga0207648_10391998 3300026089 Bacteria 1257
449 Ga0207648_10534647 3300026089 Bacteria 1075
450 Ga0207676_10006844 3300026095 Bacteria 8074
451 Ga0207676_10049613 3300026095 Bacteria 3267
452 Ga0207676_10061748 3300026095 Bacteria 2969
453 Ga0207676_10089820 3300026095 Bacteria 2519
454 Ga0207676_10099082 3300026095 Bacteria 2411
455 Ga0207676_10212049 3300026095 Bacteria 1719
456 Ga0207674_10000606 3300026116 Bacteria 47000
457 Ga0207674_10050727 3300026116 Bacteria 4238
458 Ga0207674_10121597 3300026116 Bacteria 2578
459 Ga0207674_10151037 3300026116 Bacteria 2280
460 Ga0207674_10342907 3300026116 Bacteria 1444
461 Ga0207674_10391636 3300026116 Bacteria 1343
462 Ga0207674_10533483 3300026116 Bacteria 1134
463 Ga0207675_100013659 3300026118 Bacteria 7578
464 Ga0207675_100028240 3300026118 Bacteria 5224
465 Ga0207675_100047192 3300026118 Bacteria 4022
466 Ga0207675_100142150 3300026118 Bacteria 2280
467 Ga0207675_100235054 3300026118 Bacteria 1769
468 Ga0207675_100517651 3300026118 Unclassified 1189
469 Ga0207698_10037082 3300026142 Bacteria 3587
470 Ga0207698_10129317 3300026142 Bacteria 2155
471 Ga0207698_10513304 3300026142 Unclassified 1168
472 Ga0207428_10004448 3300027907 Bacteria 13314
473 Ga0207428_10006703 3300027907 Bacteria 10576
474 Ga0207428_10048065 3300027907 Bacteria 3425
475 Ga0207428_10134461 3300027907 Bacteria 1891
476 Ga0207428_10441186 3300027907 Bacteria 950
477 Ga0268266_10264187 3300028379 Bacteria 1596
478 Ga0268265_10034993 3300028380 Bacteria 3665
479 Ga0268265_10191353 3300028380 Bacteria 1767
480 Ga0268265_10200906 3300028380 Bacteria 1729
481 Ga0268265_10288341 3300028380 Bacteria 1472
482 Ga0268264_10025916 3300028381 Bacteria 4786
483 Ga0268264_10058725 3300028381 Bacteria 3222
484 Ga0268264_10084491 3300028381 Bacteria 2722
485 Ga0268264_10086886 3300028381 Bacteria 2688
486 Ga0307513_10071145 3300031456 Bacteria 3632
487 Ga0307408_100201926 3300031548 Bacteria 1610
488 Ga0316579_10018076 3300031691 Bacteria 3099
489 Ga0316578_10075809 3300031728 Bacteria 1996
490 Ga0307405_10056681 3300031731 Bacteria 2459
491 Ga0307405_10222133 3300031731 Bacteria 1387
492 Ga0316577_10003003 3300031733 Bacteria 8449
493 Ga0307413_10033827 3300031824 Bacteria 2915
494 Ga0307413_10532243 3300031824 Bacteria 950
495 Ga0307410_10314614 3300031852 Bacteria 1240
496 Ga0307406_10078182 3300031901 Bacteria 2191
497 Ga0307407_10037423 3300031903 Bacteria 2681
498 Ga0307407_10069949 3300031903 Bacteria 2085
499 Ga0307416_100010794 3300032002 Bacteria 6052
500 Ga0307416_100255449 3300032002 Bacteria 1709
501 Ga0307416_100457569 3300032002 Bacteria 1330
502 Ga0307414_10001138 3300032004 Bacteria 13610
503 Ga0307414_10018407 3300032004 Bacteria 4300
504 Ga0307414_10021343 3300032004 Bacteria 4061
505 Ga0307414_10198946 3300032004 Bacteria 1628
506 Ga0307411_10141622 3300032005 Bacteria 1774
507 Ga0307411_10173410 3300032005 Bacteria 1629
508 Ga0307415_100039367 3300032126 Bacteria 3124
509 Ga0373949_0012524 3300035090 Bacteria 1877
510 Ga0373939_0037551 3300035114 Bacteria 1439
511 Ga0373953_0092409 3300035117 Bacteria 1267
512 Ga0373942_0043280 3300035207 Bacteria 1237
513 Ga0373961_0002748 3300035241 Bacteria 4491
514 Ga0373937_0074133 3300036401 Bacteria 3140
515 Ga0316582_0038637 3300036647 Bacteria 2967
516 Ga0316584_0001274 3300036712 Bacteria 14901
517 Ga0316584_0012309 3300036712 Bacteria 6031
518 Ga0395905_0203559 3300037471 Bacteria 1855
519 Ga0400483_022922 3300039062 Bacteria 1342
520 Ga0400487_11594 3300039110 Bacteria 2514
521 Ga0436365_0828593 3300039437 Bacteria 103131
522 Ga0436365_1511194 3300039437 Bacteria 71530
523 Ga0436365_1653927 3300039437 Bacteria 2527
524 Ga0436360_0900920 3300039438 Bacteria 8592
525 Ga0439448_0014611 3300042005 Bacteria 2371
526 Ga0451576_0008962 3300045051 Bacteria 11663
527 Ga0451576_0476651 3300045051 Bacteria 1311
528 Ga0495592_0226569 3300046454 Bacteria 1247
529 Ga0495629_0101313 3300046459 Bacteria 2010
530 Ga0495632_0144428 3300046519 Bacteria 1102
531 Ga0495598_0000481 3300046537 Bacteria 7315
532 Ga0495636_0070604 3300047318 Bacteria 1490
533 Ga0496101_0186123 3300048904 Bacteria 1601
534 Ga0496102_0275781 3300048905 Bacteria 1585
535 Ga0496109_0000069 3300048912 Bacteria 109077
536 Ga0496109_0055393 3300048912 Unclassified 3618
537 Ga0496112_0047829 3300048915 Bacteria 4196
538 Ga0496112_0154751 3300048915 Unclassified 2260
539 Ga0496114_0108330 3300048917 Bacteria 2378
540 Ga0501298_009457 3300049521 Bacteria 1659
541 Ga0501298_010400 3300049521 Bacteria 1602
542 Ga0501299_011872 3300049522 Bacteria 1478
543 Ga0501031_0276894 3300049568 Bacteria 1089
544 Ga0501034_0039986 3300049571 Bacteria 4749
545 Ga0501036_0134811 3300049572 Bacteria 2084
546 Ga0501042_0029231 3300049578 Bacteria 3887
547 Ga0501073_0081204 3300049589 Bacteria 2255
548 Ga0501077_0107587 3300049593 Bacteria 1767
549 Ga0501202_021858 3300049652 Bacteria 1282
550 Ga0501217_004610 3300049661 Bacteria 2840
551 Ga0501223_016394 3300049663 Bacteria 1464
552 Ga0501223_016749 3300049663 Bacteria 1448
553 Ga0501227_002591 3300049665 Bacteria 3968
554 Ga0501235_002603 3300049669 Bacteria 3883
555 Ga0501235_014249 3300049669 Bacteria 1753
556 Ga0501225_0001803 3300049705 Bacteria 6704
557 Ga0501081_0094751 3300049743 Bacteria 2104
558 Ga0501263_009926 3300049760 Bacteria 1161
559 Ga0501283_015760 3300049779 Bacteria 1166
560 nmdc:mga05p37_107515_c1 3300050507 Bacteria 3432
561 nmdc:mga05p37_220909_c1 3300050507 Bacteria 2286
562 nmdc:mga05p37_363133_c1 3300050507 Bacteria 1702
563 nmdc:mga05p37_572_c1 3300050507 Bacteria 28636
564 nmdc:mga09592_148979_c1 3300050508 Bacteria 2018
565 nmdc:mga06r32_109153_c1 3300050510 Bacteria 2721
566 nmdc:mga06r32_190142_c1 3300050510 Bacteria 2041
567 nmdc:mga06r32_28936_c1 3300050510 Bacteria 5187
568 nmdc:mga06r32_328555_c1 3300050510 Bacteria 1514
569 nmdc:mga06r32_359716_c1 3300050510 Bacteria 1439
570 nmdc:mga06r32_46582_c1 3300050510 Bacteria 4138
571 nmdc:mga08y16_10529_c1 3300050511 Bacteria 9705
572 nmdc:mga08y16_14154_c1 3300050511 Bacteria 8397
573 nmdc:mga08y16_148278_c1 3300050511 Bacteria 2438
574 nmdc:mga08y16_15400_c1 3300050511 Bacteria 8042
575 nmdc:mga08y16_303101_c1 3300050511 Bacteria 1647
576 nmdc:mga08y16_573906_c1 3300050511 Bacteria 1139
577 nmdc:mga08y16_65773_c1 3300050511 Bacteria 3784
578 nmdc:mga08y16_71832_c1 3300050511 Unclassified 3606
579 nmdc:mga0n895_115_c1 3300050512 Bacteria 47271
580 nmdc:mga0n895_160765_c1 3300050512 Bacteria 2278
581 nmdc:mga0n895_214886_c1 3300050512 Bacteria 1953
582 nmdc:mga0n895_369780_c1 3300050512 Bacteria 1451
583 nmdc:mga0n895_470560_c1 3300050512 Bacteria 1268
584 nmdc:mga0rr50_52565_c2 3300050513 Bacteria 1444
585 nmdc:mga0rr50_774_c1 3300050513 Bacteria 17198
586 nmdc:mga08x19_2497_c2 3300050514 Bacteria 5307
587 nmdc:mga0a205_145800_c1 3300050515 Bacteria 2267
588 nmdc:mga0a205_28_c1 3300050515 Bacteria 82237
589 nmdc:mga0a205_46524_c1 3300050515 Unclassified 4185
590 nmdc:mga0a205_59967_c1 3300050515 Bacteria 3675
591 Ga0495595_0249446 3300053084 Bacteria 889
592 Ga0500616_0003133 3300053153 Bacteria 12931
593 Ga0501084_0204364 3300054114 Bacteria 1667
594 Ga0501084_0283497 3300054114 Unclassified 1399
595 Ga0501082_0201010 3300060353 Bacteria 1734
596 2833640652 2833640130 Bacteria 4858325
597 2894416914 2894414249 Bacteria 4405451
598 Ga0105238_10084890
599 MRS1b_contig_1059780
600 CNAas_1000215
601 JGI24751J29686_10000286
602 JGI25406J46586_10017924
603 rootL2_10204455
604 Ga0065704_10175103
605 Ga0065704_10185400
606 Ga0065712_10071847
607 Ga0065712_10082820
608 Ga0065715_10006714
609 Ga0065715_10019782
610 Ga0065715_10090856
611 Ga0065715_10170582
612 Ga0065715_10211639
613 Ga0065707_10086611
614 Ga0065707_10086676
615 Ga0070658_10186809
616 Ga0070690_100090203
617 Ga0070670_100000227
618 Ga0070670_100068847
619 Ga0070670_100083558
620 Ga0070670_100105551
621 Ga0070670_100179671
622 Ga0070670_100473621
623 Ga0070677_10012410
624 Ga0068869_100053461
625 Ga0068869_100187915
626 Ga0070666_10033778
627 Ga0070666_10287054
628 Ga0070680_100004191
629 Ga0070680_100120709
630 Ga0070680_100399769
631 Ga0070680_100495380
632 Ga0070682_100003984
633 Ga0070682_100004655
634 Ga0068868_100017398
635 Ga0068868_100313280
636 Ga0068868_100319530
637 Ga0070660_100007932
638 Ga0070689_100003150
639 Ga0070689_100017816
640 Ga0070689_100117263
641 Ga0070687_100021195
642 Ga0070687_100023539
643 Ga0070687_100129745
644 Ga0070661_100003944
645 Ga0070692_10012016
646 Ga0070692_10040418
647 Ga0070669_100075001
648 Ga0070669_100165707
649 Ga0070669_100182756
650 Ga0070669_100260208
651 Ga0070675_100025414
652 Ga0070675_100100207
653 Ga0070675_100169655
654 Ga0070671_100011546
655 Ga0070671_100011649
656 Ga0070671_100074095
657 Ga0070673_100138353
658 Ga0070673_100169552
659 Ga0070673_100469873
660 Ga0070688_100130911
661 Ga0070688_100202752
662 Ga0070688_100237282
663 Ga0070659_100000889
664 Ga0070659_100011988
665 Ga0070667_100006161
666 Ga0070667_100028857
667 Ga0070703_10000112
668 Ga0070701_10028533
669 Ga0070701_10137072
670 Ga0070705_100041998
671 Ga0070700_100000110
672 Ga0070700_100007453
673 Ga0070700_100012259
674 Ga0070700_100035893
675 Ga0070700_100060766
676 Ga0070700_100081107
677 Ga0070700_100098637
678 Ga0070694_100001105
679 Ga0070694_100001147
680 Ga0070694_100012567
681 Ga0070694_100031235
682 Ga0070694_100092595
683 Ga0070694_100150779
684 Ga0070694_100222368
685 Ga0070694_100222556
686 Ga0070708_100063942
687 Ga0070708_100124751
688 Ga0070663_100193418
689 Ga0070662_100470604
690 Ga0070681_10052339
691 Ga0068867_100139614
692 Ga0068867_100187422
693 Ga0070685_10008274
694 Ga0070685_10062791
695 Ga0070706_100002818
696 Ga0070706_100411108
697 Ga0070707_100021645
698 Ga0070698_100002760
699 Ga0070698_100031846
700 Ga0070698_100040791
701 Ga0070698_100111924
702 Ga0070699_100229194
703 Ga0070679_100006877
704 Ga0070679_100017739
705 Ga0070684_100103879
706 Ga0070697_100000157
707 Ga0070697_100001568
708 Ga0070697_100089889
709 Ga0068853_100022034
710 Ga0068853_100030132
711 Ga0068853_100070940
712 Ga0070672_100004284
713 Ga0070686_100004306
714 Ga0070686_100023302
715 Ga0070686_100061526
716 Ga0070695_100022863
717 Ga0070695_100087853
718 Ga0070695_100122358
719 Ga0070695_100329464
720 Ga0070693_100002834
721 Ga0070693_100222351
722 Ga0070665_100257330
723 Ga0070704_100046076
724 Ga0070704_100160823
725 Ga0070704_100177863
726 Ga0070704_100201027
727 Ga0070704_100412009
728 Ga0068855_100035888
729 Ga0068857_100001173
730 Ga0068857_100044466
731 Ga0068857_100080918
732 Ga0068857_100350282
733 Ga0068854_100101152
734 Ga0068854_100290577
735 Ga0070702_100062583
736 Ga0070702_100146923
737 Ga0070702_100157307
738 Ga0070702_100205302
739 Ga0068852_100102344
740 Ga0068859_100002623
741 Ga0068859_100017842
742 Ga0068859_100018758
743 Ga0068859_100018770
744 Ga0068859_100021100
745 Ga0068859_100021236
746 Ga0068859_100037992
747 Ga0068859_100113388
748 Ga0068859_100142556
749 Ga0068859_100178275
750 Ga0068859_100217597
751 Ga0068859_100239451
752 Ga0068859_100293620
753 Ga0068859_100328499
754 Ga0068859_100339862
755 Ga0068859_100462318
756 Ga0068864_100033648
757 Ga0068864_100042187
758 Ga0068864_100050076
759 Ga0068864_100106155
760 Ga0068864_100127427
761 Ga0068864_100127685
762 Ga0068864_100187152
763 Ga0068864_100315457
764 Ga0068866_10135857
765 Ga0068861_100003427
766 Ga0068861_100049468
767 Ga0068861_100080431
768 Ga0068861_100462154
769 Ga0068851_10002933
770 Ga0068870_10093920
771 Ga0068870_10182896
772 Ga0068863_100182831
773 Ga0068858_100025790
774 Ga0068858_100060351
775 Ga0068858_100149738
776 Ga0068858_100200584
777 Ga0068858_100223151
778 Ga0068858_100504905
779 Ga0068860_100009730
780 Ga0068860_100010319
781 Ga0068860_100043083
782 Ga0068860_100110611
783 Ga0068860_100148121
784 Ga0068860_100224169
785 Ga0068860_100326445
786 Ga0068860_100349300
787 Ga0068862_100026434
788 Ga0068862_100069694
789 Ga0068862_100141363
790 Ga0068862_100271639
791 Ga0068862_100282211
792 Ga0081455_10009448
793 Ga0081455_10044668
794 Ga0081539_10000701
795 Ga0081539_10001143
796 Ga0070712_100077815
797 Ga0097621_100007346
798 Ga0097621_100128626
799 Ga0097621_100363931
800 Ga0068871_100008773
801 Ga0068871_100011504
802 Ga0068871_100035238
803 Ga0068871_100114113
804 Ga0068871_100257821
805 Ga0075428_100041894
806 Ga0075428_100074178
807 Ga0075428_100211344
808 Ga0075428_100219368
809 Ga0075428_100317334
810 Ga0075428_100333417
811 Ga0075428_100454518
812 Ga0075428_100875441
813 Ga0075430_100037018
814 Ga0075430_100072301
815 Ga0075430_100168116
816 Ga0075431_100033609
817 Ga0075431_100076691
818 Ga0075431_100127761
819 Ga0075431_100178533
820 Ga0075431_100204610
821 Ga0075431_100207563
822 Ga0075431_100327165
823 Ga0075433_10000013
824 Ga0075433_10042341
825 Ga0075433_10446271
826 Ga0075434_100004905
827 Ga0075434_100012353
828 Ga0075434_100070304
829 Ga0075429_100225412
830 Ga0075429_100285264
831 Ga0075429_100337577
832 Ga0068865_100127126
833 Ga0068865_100290335
834 Ga0075436_100008229
835 Ga0075436_100017274
836 Ga0097620_100002623
837 Ga0097620_100017842
838 Ga0097620_100018758
839 Ga0097620_100018770
840 Ga0097620_100021100
841 Ga0097620_100021239
842 Ga0097620_100037992
843 Ga0097620_100113392
844 Ga0097620_100142550
845 Ga0097620_100178275
846 Ga0097620_100217581
847 Ga0097620_100239457
848 Ga0097620_100293644
849 Ga0097620_100328512
850 Ga0097620_100339866
851 Ga0097620_100462339
852 Ga0075435_100000182
853 Ga0075435_100208901
854 Ga0105240_10647493
855 Ga0111539_10000689
856 Ga0111539_10019847
857 Ga0111539_10021115
858 Ga0111539_10055085
859 Ga0111539_10116659
860 Ga0111539_10725967
861 Ga0105245_10108353
862 Ga0105247_10000291
863 Ga0105247_10017766
864 Ga0114129_10000255
865 Ga0114129_10015763
866 Ga0114129_10120315
867 Ga0114129_10132140
868 Ga0114129_10144988
869 Ga0114129_10158039
870 Ga0114129_10209140
871 Ga0114129_10216122
872 Ga0114129_10685775
873 Ga0105243_10003087
874 Ga0105243_10004411
875 Ga0105243_10007561
876 Ga0105243_10063854
877 Ga0105241_10009320
878 Ga0105241_10024454
879 Ga0105241_10064083
880 Ga0105241_10155846
881 Ga0105242_10002773
882 Ga0105242_10003318
883 Ga0105242_10007481
884 Ga0105242_10100282
885 Ga0105242_10170020
886 Ga0105242_10374564
887 Ga0105248_10001456
888 Ga0105248_10041267
889 Ga0105248_10049356
890 Ga0105248_10138028
891 Ga0105248_10149440
892 Ga0105248_10168957
893 Ga0105248_10222984
894 Ga0105237_10001943
895 Ga0105238_10001915
896 Ga0105238_10091080
897 Ga0105249_10004687
898 Ga0105249_10029965
899 Ga0105249_10080828
900 Ga0105249_10130898
901 Ga0105249_10370280
902 Ga0105249_10909081
903 Ga0157373_10016316
904 Ga0157373_10080920
905 Ga0157374_10067653
906 Ga0157374_10465100
907 Ga0157378_10010093
908 Ga0157378_10101560
909 Ga0157378_10162216
910 Ga0157378_10290166
911 Ga0163162_10023143
912 Ga0163162_10027490
913 Ga0163162_10127270
914 Ga0163162_10135962
915 Ga0157372_10094149
916 Ga0157372_10104939
917 Ga0157372_10909315
918 Ga0157375_10083696
919 Ga0157375_10114745
920 Ga0163163_10000008
921 Ga0163163_10000277
922 Ga0163163_10038496
923 Ga0163163_10080633
924 Ga0163163_10097800
925 Ga0163163_10108521
926 Ga0157380_10033603
927 Ga0157380_10097881
928 Ga0157380_10363338
929 Ga0157377_10031439
930 Ga0157379_10001274
931 Ga0157379_10010635
932 Ga0157376_10143890
933 Ga0157376_10176354
934 Ga0157376_10223460
935 Ga0182007_10025895
936 Ga0163161_10104269
937 Ga0213876_10000087
938 Ga0213876_10000182
939 Ga0213876_10078372
940 Ga0207656_10016434
941 Ga0207653_10000027
942 Ga0207653_10016693
943 Ga0207682_10040511
944 Ga0207710_10000983
945 Ga0207710_10019477
946 Ga0207710_10025495
947 Ga0207647_10005687
948 Ga0207647_10074846
949 Ga0207647_10168764
950 Ga0207645_10188324
951 Ga0207643_10022379
952 Ga0207643_10029971
953 Ga0207705_10400536
954 Ga0207654_10070649
955 Ga0207707_10052451
956 Ga0207671_10003734
957 Ga0207693_10096813
958 Ga0207663_10105109
959 Ga0207660_10019204
960 Ga0207662_10064183
961 Ga0207662_10304344
962 Ga0207657_10002452
963 Ga0207652_10035025
964 Ga0207652_10042882
965 Ga0207646_10113198
966 Ga0207646_10150340
967 Ga0207681_10041978
968 Ga0207681_10158881
969 Ga0207681_10182559
970 Ga0207681_10186031
971 Ga0207694_10026840
972 Ga0207694_10344063
973 Ga0207650_10000027
974 Ga0207650_10038887
975 Ga0207650_10074794
976 Ga0207659_10147952
977 Ga0207644_10005843
978 Ga0207644_10093876
979 Ga0207644_10377827
980 Ga0207690_10012922
981 Ga0207690_10019545
982 Ga0207706_10197875
983 Ga0207706_10409932
984 Ga0207706_10470220
985 Ga0207686_10000018
986 Ga0207686_10040825
987 Ga0207686_10320958
988 Ga0207709_10000025
989 Ga0207709_10006735
990 Ga0207709_10269690
991 Ga0207670_10000472
992 Ga0207670_10081706
993 Ga0207669_10249004
994 Ga0207669_10460906
995 Ga0207704_10142854
996 Ga0207691_10016882
997 Ga0207711_10017986
998 Ga0207711_10021297
999 Ga0207711_10025252
1000 Ga0207711_10301349
1001 Ga0207711_10303681
1002 Ga0207711_10386176
1003 Ga0207711_10561099
1004 Ga0207689_10013757
1005 Ga0207689_10022576
1006 Ga0207689_10037999
1007 Ga0207689_10286238
1008 Ga0207689_10288241
1009 Ga0207661_10331998
1010 Ga0207679_10121598
1011 Ga0207679_10149008
1012 Ga0207651_10076358
1013 Ga0207651_10116906
1014 Ga0207651_10144145
1015 Ga0207651_10473334
1016 Ga0207712_10001843
1017 Ga0207640_10339939
1018 Ga0207658_10016606
1019 Ga0207658_10190946
1020 Ga0207677_10058459
1021 Ga0207677_10128168
1022 Ga0207703_10000521
1023 Ga0207703_10022631
1024 Ga0207703_10073104
1025 Ga0207703_10137019
1026 Ga0207639_10030134
1027 Ga0207639_10069006
1028 Ga0207639_10199212
1029 Ga0207639_10275972
1030 Ga0207639_10416283
1031 Ga0207708_10000028
1032 Ga0207708_10014279
1033 Ga0207708_10022577
1034 Ga0207708_10076111
1035 Ga0207708_10112944
1036 Ga0207708_10124466
1037 Ga0207708_10136259
1038 Ga0207702_10375708
1039 Ga0207641_10015472
1040 Ga0207641_10085552
1041 Ga0207641_10160843
1042 Ga0207648_10076428
1043 Ga0207648_10167319
1044 Ga0207648_10231120
1045 Ga0207648_10391998
1046 Ga0207648_10534647
1047 Ga0207676_10006844
1048 Ga0207676_10049613
1049 Ga0207676_10061748
1050 Ga0207676_10089820
1051 Ga0207676_10099082
1052 Ga0207676_10212049
1053 Ga0207674_10000606
1054 Ga0207674_10050727
1055 Ga0207674_10121597
1056 Ga0207674_10151037
1057 Ga0207674_10342907
1058 Ga0207674_10391636
1059 Ga0207674_10533483
1060 Ga0207675_100013659
1061 Ga0207675_100028240
1062 Ga0207675_100047192
1063 Ga0207675_100142150
1064 Ga0207675_100235054
1065 Ga0207675_100517651
1066 Ga0207698_10037082
1067 Ga0207698_10129317
1068 Ga0207698_10513304
1069 Ga0207428_10004448
1070 Ga0207428_10006703
1071 Ga0207428_10048065
1072 Ga0207428_10134461
1073 Ga0207428_10441186
1074 Ga0268266_10264187
1075 Ga0268265_10034993
1076 Ga0268265_10191353
1077 Ga0268265_10200906
1078 Ga0268265_10288341
1079 Ga0268264_10025916
1080 Ga0268264_10058725
1081 Ga0268264_10084491
1082 Ga0268264_10086886
1083 Ga0307513_10071145
1084 Ga0307408_100201926
1085 Ga0316579_10018076
1086 Ga0316578_10075809
1087 Ga0307405_10056681
1088 Ga0307405_10222133
1089 Ga0316577_10003003
1090 Ga0307413_10033827
1091 Ga0307413_10532243
1092 Ga0307410_10314614
1093 Ga0307406_10078182
1094 Ga0307407_10037423
1095 Ga0307407_10069949
1096 Ga0307416_100010794
1097 Ga0307416_100255449
1098 Ga0307416_100457569
1099 Ga0307414_10001138
1100 Ga0307414_10018407
1101 Ga0307414_10021343
1102 Ga0307414_10198946
1103 Ga0307411_10141622
1104 Ga0307411_10173410
1105 Ga0307415_100039367
1106 Ga0373949_0012524
1107 Ga0373939_0037551
1108 Ga0373953_0092409
1109 Ga0373942_0043280
1110 Ga0373961_0002748
1111 Ga0373937_0074133
1112 Ga0316582_0038637
1113 Ga0316584_0001274
1114 Ga0316584_0012309
1115 Ga0395905_0203559
1116 Ga0400483_022922
1117 Ga0400487_11594
1118 Ga0436365_0828593
1119 Ga0436365_1511194
1120 Ga0436365_1653927
1121 Ga0436360_0900920
1122 Ga0439448_0014611
1123 Ga0451576_0008962
1124 Ga0451576_0476651
1125 Ga0495592_0226569
1126 Ga0495629_0101313
1127 Ga0495632_0144428
1128 Ga0495598_0000481
1129 Ga0495636_0070604
1130 Ga0496101_0186123
1131 Ga0496102_0275781
1132 Ga0496109_0000069
1133 Ga0496109_0055393
1134 Ga0496112_0047829
1135 Ga0496112_0154751
1136 Ga0496114_0108330
1137 Ga0501298_009457
1138 Ga0501298_010400
1139 Ga0501299_011872
1140 Ga0501031_0276894
1141 Ga0501034_0039986
1142 Ga0501036_0134811
1143 Ga0501042_0029231
1144 Ga0501073_0081204
1145 Ga0501077_0107587
1146 Ga0501202_021858
1147 Ga0501217_004610
1148 Ga0501223_016394
1149 Ga0501223_016749
1150 Ga0501227_002591
1151 Ga0501235_002603
1152 Ga0501235_014249
1153 Ga0501225_0001803
1154 Ga0501081_0094751
1155 Ga0501263_009926
1156 Ga0501283_015760
1157 nmdc:mga05p37_107515_c1
1158 nmdc:mga05p37_220909_c1
1159 nmdc:mga05p37_363133_c1
1160 nmdc:mga05p37_572_c1
1161 nmdc:mga09592_148979_c1
1162 nmdc:mga06r32_109153_c1
1163 nmdc:mga06r32_190142_c1
1164 nmdc:mga06r32_28936_c1
1165 nmdc:mga06r32_328555_c1
1166 nmdc:mga06r32_359716_c1
1167 nmdc:mga06r32_46582_c1
1168 nmdc:mga08y16_10529_c1
1169 nmdc:mga08y16_14154_c1
1170 nmdc:mga08y16_148278_c1
1171 nmdc:mga08y16_15400_c1
1172 nmdc:mga08y16_303101_c1
1173 nmdc:mga08y16_573906_c1
1174 nmdc:mga08y16_65773_c1
1175 nmdc:mga08y16_71832_c1
1176 nmdc:mga0n895_115_c1
1177 nmdc:mga0n895_160765_c1
1178 nmdc:mga0n895_214886_c1
1179 nmdc:mga0n895_369780_c1
1180 nmdc:mga0n895_470560_c1
1181 nmdc:mga0rr50_52565_c2
1182 nmdc:mga0rr50_774_c1
1183 nmdc:mga08x19_2497_c2
1184 nmdc:mga0a205_145800_c1
1185 nmdc:mga0a205_28_c1
1186 nmdc:mga0a205_46524_c1
1187 nmdc:mga0a205_59967_c1
1188 Ga0495595_0249446
1189 Ga0500616_0003133
1190 Ga0501084_0204364
1191 Ga0501084_0283497
1192 Ga0501082_0201010
1193 2833640652
1194 2894416914

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF23678

28

63

0.98

PF01738

DLH

Dienelactone hydrolase family

111

321

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9847 61 294
4zv9-assembly6.cif.gz_F 2.00 angstrom resolution crystal structure of an uncharacterized protein from escherichia coli o157:h7 str. sakai 0.9643 61 294
1zi8-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant(e36d, c123s, a134s, s208g, a229v, k234r)- 1.4 a 0.873 74 295
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.8669 74 295
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.8664 74 295
ID Description Score Start End Superfamily
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9879 61 294 3.40.50.1820
4zv9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9671 61 294 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8919 71 290 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8575 68 293 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8544 69 294 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A838RYB0-F1-model_v4 Dienelactone hydrolase family protein 1.003 202 295 GO:0016787
AF-A0A3N5H463-F1-model_v4 Dienelactone hydrolase family protein 0.9934 189 295 GO:0016787
AF-A0A0A6ZXW4-F1-model_v4 Carboxymethylenebutenolidase (EC 3.1.1.45) 0.9926 101 295 GO:0008806
AF-A0A7X2PNW7-F1-model_v4 Dienelactone hydrolase family protein 0.9913 1 295 GO:0016787
AF-A0A3N5PMY7-F1-model_v4 Dienelactone hydrolase family protein 0.9909 129 295 GO:0016787

Map