F467636

General Info

Members Datasets Scaffolds Average Seq Length
597 270 1194 278

Family's Representative Sequence

Representative Sequence 3300005340|Ga0070689_100022863|Ga0070689_1000228633
Length 303
Sequence MLTAVICFLAFQTAVHVASAFLPTVALAKVGRRKIVLAICALALAIPAASSAQSAADYVIGPQDVLTIQVFDQADLGGKYTVETDGTFSFPLIGRVTAGGLTLRNFEGELKKKLADGYFRNPQVTVAIEQYRSQRVFVMGEVRNPGPVPLTGGMTLIEALARAGSTLPSASGEVAIVRDAGGAVDPALLAGRKDGDILRASIRDLEGGSRKQNIELHDGDTIFVPRAESAYVFGQVKTPGAYAIQKDTTVLQALSLAGGVTENGAMNRIKVVRVVNGEKHELKMKLTDLVKAGDTIIVPEKYF

Samples

Sample ID Description Type Environment
1 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
174 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
175 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
197 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
198 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
199 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
200 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
201 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
231 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
232 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
240 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
241 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
242 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
243 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 3.85
Rhizosphere 92.46
Stem 0
Stem Tuber 0
Unclassified 34.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070689_100022863 3300005340 Bacteria 4674
2 MBSR1b_contig_11773844 2162886012 Unclassified 1037
3 JGI24746J21847_1004261 3300001977 Unclassified 2258
4 Ga0065704_10095196 3300005289 Bacteria 2501
5 Ga0065704_10097627 3300005289 Unclassified 2386
6 Ga0065712_10192533 3300005290 Unclassified 1142
7 Ga0065715_10003722 3300005293 Unclassified 4125
8 Ga0065715_10200009 3300005293 Bacteria 1367
9 Ga0065707_10014969 3300005295 Bacteria 2443
10 Ga0065707_10017029 3300005295 Unclassified 3595
11 Ga0065707_10081885 3300005295 Bacteria 31231
12 Ga0065707_10111836 3300005295 Unclassified 2381
13 Ga0065707_10190026 3300005295 Bacteria 1358
14 Ga0070676_10001169 3300005328 Bacteria 13134
15 Ga0070676_10403903 3300005328 Unclassified 951
16 Ga0070683_100000477 3300005329 Bacteria 28208
17 Ga0070683_100217361 3300005329 Unclassified 1816
18 Ga0070683_100371895 3300005329 Bacteria 1361
19 Ga0070690_100025007 3300005330 Unclassified 3676
20 Ga0070690_100290264 3300005330 Unclassified 1169
21 Ga0070670_100008689 3300005331 Bacteria 8669
22 Ga0070670_100067262 3300005331 Unclassified 3075
23 Ga0070670_100159090 3300005331 Unclassified 1957
24 Ga0070670_100468832 3300005331 Bacteria 1117
25 Ga0070677_10001135 3300005333 Bacteria 8573
26 Ga0068869_100025900 3300005334 Unclassified 4077
27 Ga0070666_10002556 3300005335 Bacteria 11006
28 Ga0070666_10339102 3300005335 Unclassified 1074
29 Ga0068868_100001481 3300005338 Bacteria 16199
30 Ga0068868_100085518 3300005338 Bacteria 2534
31 Ga0070660_100140962 3300005339 Unclassified 1934
32 Ga0070689_100063022 3300005340 Unclassified 2885
33 Ga0070687_100005898 3300005343 Unclassified 4981
34 Ga0070661_100023862 3300005344 Unclassified 4388
35 Ga0070661_100049584 3300005344 Unclassified 3074
36 Ga0070692_10191938 3300005345 Unclassified 1191
37 Ga0070668_100018734 3300005347 Bacteria 5199
38 Ga0070669_100005042 3300005353 Bacteria 9542
39 Ga0070669_100011075 3300005353 Bacteria 6401
40 Ga0070669_100185690 3300005353 Unclassified 1629
41 Ga0070675_100000057 3300005354 Bacteria 66900
42 Ga0070675_100016375 3300005354 Bacteria 5885
43 Ga0070675_100064413 3300005354 Unclassified 3030
44 Ga0070675_100438410 3300005354 Unclassified 1170
45 Ga0070671_100035606 3300005355 Bacteria 4124
46 Ga0070671_100154376 3300005355 Unclassified 1939
47 Ga0070674_100000066 3300005356 Bacteria 47605
48 Ga0070674_100097105 3300005356 Unclassified 2139
49 Ga0070674_100141714 3300005356 Unclassified 1804
50 Ga0070674_100256822 3300005356 Bacteria 1375
51 Ga0070673_100000770 3300005364 Bacteria 17805
52 Ga0070673_100002572 3300005364 Bacteria 11082
53 Ga0070673_100010695 3300005364 Bacteria 6223
54 Ga0070673_100144319 3300005364 Bacteria 2011
55 Ga0070673_100151983 3300005364 Unclassified 1961
56 Ga0070688_100006986 3300005365 Bacteria 6067
57 Ga0070688_100171777 3300005365 Unclassified 1497
58 Ga0070659_100084966 3300005366 Unclassified 2531
59 Ga0070659_100085762 3300005366 Unclassified 2519
60 Ga0070667_100004299 3300005367 Bacteria 12029
61 Ga0070667_100005547 3300005367 Bacteria 10529
62 Ga0070713_100022935 3300005436 Bacteria 4833
63 Ga0070711_100032735 3300005439 Unclassified 3459
64 Ga0070711_100102035 3300005439 Bacteria 2089
65 Ga0070705_100000264 3300005440 Bacteria 31473
66 Ga0070705_100012124 3300005440 Bacteria 4371
67 Ga0070700_100016790 3300005441 Unclassified 4174
68 Ga0070700_100069465 3300005441 Bacteria 2243
69 Ga0070700_100069477 3300005441 Bacteria 2243
70 Ga0070694_100000641 3300005444 Bacteria 19284
71 Ga0070678_100091628 3300005456 Unclassified 2333
72 Ga0070678_100306745 3300005456 Bacteria 1351
73 Ga0070662_100066806 3300005457 Unclassified 2639
74 Ga0070662_100118898 3300005457 Bacteria 2023
75 Ga0068867_100042449 3300005459 Bacteria 3327
76 Ga0068867_100062507 3300005459 Unclassified 2766
77 Ga0070685_10005280 3300005466 Bacteria 6546
78 Ga0070685_10187096 3300005466 Bacteria 1337
79 Ga0070706_100199082 3300005467 Bacteria 1871
80 Ga0070706_100304673 3300005467 Unclassified 1486
81 Ga0070707_100152768 3300005468 Bacteria 2248
82 Ga0070707_100434372 3300005468 Bacteria 1273
83 Ga0070698_100326153 3300005471 Unclassified 1466
84 Ga0070699_100002018 3300005518 Bacteria 18348
85 Ga0070699_100010537 3300005518 Bacteria 7999
86 Ga0070699_100042157 3300005518 Bacteria 3949
87 Ga0068853_100168932 3300005539 Bacteria 1978
88 Ga0070672_100030067 3300005543 Unclassified 4077
89 Ga0070672_100055923 3300005543 Bacteria 3093
90 Ga0070672_100228380 3300005543 Bacteria 1563
91 Ga0070672_100528944 3300005543 Bacteria 1022
92 Ga0070686_100003843 3300005544 Bacteria 8265
93 Ga0070686_100021489 3300005544 Unclassified 3837
94 Ga0070695_100000013 3300005545 Bacteria 69322
95 Ga0070695_100066229 3300005545 Bacteria 2354
96 Ga0070696_100000480 3300005546 Bacteria 25058
97 Ga0070696_100072820 3300005546 Bacteria 2420
98 Ga0070696_100093831 3300005546 Unclassified 2140
99 Ga0070665_100015313 3300005548 Bacteria 7700
100 Ga0070665_100022325 3300005548 Bacteria 6369
101 Ga0070704_100039212 3300005549 Bacteria 3251
102 Ga0070704_100042755 3300005549 Unclassified 3136
103 Ga0070704_100203252 3300005549 Unclassified 1601
104 Ga0068855_100452826 3300005563 Bacteria 1400
105 Ga0070664_100025667 3300005564 Unclassified 4887
106 Ga0070664_100038123 3300005564 Unclassified 4044
107 Ga0070664_100039661 3300005564 Unclassified 3969
108 Ga0068857_100148017 3300005577 Unclassified 2125
109 Ga0068857_100446139 3300005577 Unclassified 1209
110 Ga0068854_100107246 3300005578 Unclassified 2102
111 Ga0068854_100169746 3300005578 Bacteria 1696
112 Ga0068856_100091422 3300005614 Unclassified 3028
113 Ga0068852_100046244 3300005616 Unclassified 3707
114 Ga0068859_100037314 3300005617 Unclassified 4877
115 Ga0068859_100060788 3300005617 Bacteria 3807
116 Ga0068859_100198406 3300005617 Unclassified 2091
117 Ga0068859_100325221 3300005617 Unclassified 1632
118 Ga0068864_100141264 3300005618 Unclassified 2172
119 Ga0068861_100015401 3300005719 Bacteria 5388
120 Ga0068861_100072806 3300005719 Bacteria 2667
121 Ga0068870_10004557 3300005840 Bacteria 5971
122 Ga0068870_10037785 3300005840 Bacteria 2490
123 Ga0068870_10048539 3300005840 Bacteria 2236
124 Ga0068863_100015243 3300005841 Bacteria 7387
125 Ga0068863_100029254 3300005841 Bacteria 5259
126 Ga0068863_100155529 3300005841 Unclassified 2189
127 Ga0068863_100486024 3300005841 Bacteria 1215
128 Ga0068858_100069986 3300005842 Unclassified 3252
129 Ga0068860_100007938 3300005843 Bacteria 10589
130 Ga0068860_100147851 3300005843 Unclassified 2261
131 Ga0068860_100464745 3300005843 Unclassified 1259
132 Ga0068862_100011628 3300005844 Bacteria 7263
133 Ga0068862_100035252 3300005844 Bacteria 4236
134 Ga0068862_100089949 3300005844 Unclassified 2672
135 Ga0081539_10013121 3300005985 Bacteria 6279
136 Ga0070717_10014786 3300006028 Bacteria 6005
137 Ga0075365_10000667 3300006038 Bacteria 13721
138 Ga0075365_10004618 3300006038 Bacteria 7327
139 Ga0075365_10045583 3300006038 Bacteria 2877
140 Ga0075368_10007345 3300006042 Unclassified 3885
141 Ga0075364_10001490 3300006051 Bacteria 12755
142 Ga0075364_10033620 3300006051 Bacteria 3303
143 Ga0075432_10043115 3300006058 Unclassified 1580
144 Ga0070716_100380879 3300006173 Unclassified 1008
145 Ga0075367_10051591 3300006178 Bacteria 2432
146 Ga0075366_10003399 3300006195 Bacteria 8384
147 Ga0075366_10036066 3300006195 Bacteria 2915
148 Ga0097621_100009132 3300006237 Bacteria 7184
149 Ga0097621_100022570 3300006237 Bacteria 4887
150 Ga0097621_100131486 3300006237 Bacteria 2131
151 Ga0097621_100261755 3300006237 Bacteria 1517
152 Ga0075370_10000516 3300006353 Bacteria 14743
153 Ga0068871_100020587 3300006358 Bacteria 5056
154 Ga0068871_100083477 3300006358 Unclassified 2650
155 Ga0075428_100000080 3300006844 Bacteria 80349
156 Ga0075428_100003599 3300006844 Bacteria 16980
157 Ga0075428_100004889 3300006844 Bacteria 14879
158 Ga0075428_100016762 3300006844 Bacteria 8090
159 Ga0075428_100031446 3300006844 Bacteria 5866
160 Ga0075428_100032052 3300006844 Bacteria 5806
161 Ga0075428_100040807 3300006844 Bacteria 5104
162 Ga0075428_100111051 3300006844 Bacteria 2987
163 Ga0075428_100189881 3300006844 Unclassified 2222
164 Ga0075428_100209399 3300006844 Unclassified 2107
165 Ga0075430_100000725 3300006846 Bacteria 25225
166 Ga0075430_100001296 3300006846 Bacteria 20155
167 Ga0075430_100005455 3300006846 Bacteria 10743
168 Ga0075431_100000200 3300006847 Bacteria 43935
169 Ga0075431_100014006 3300006847 Bacteria 8101
170 Ga0075431_100072957 3300006847 Bacteria 3541
171 Ga0075431_100130502 3300006847 Bacteria 2592
172 Ga0075431_100284649 3300006847 Bacteria 1673
173 Ga0075431_100342916 3300006847 Unclassified 1503
174 Ga0075431_100559933 3300006847 Bacteria 1130
175 Ga0075433_10005597 3300006852 Bacteria 9875
176 Ga0075433_10008682 3300006852 Bacteria 8107
177 Ga0075433_10023030 3300006852 Bacteria 5238
178 Ga0075433_10067077 3300006852 Unclassified 3149
179 Ga0075433_10071610 3300006852 Bacteria 3047
180 Ga0075433_10105682 3300006852 Bacteria 2494
181 Ga0075433_10127915 3300006852 Unclassified 2256
182 Ga0075433_10154288 3300006852 Bacteria 2043
183 Ga0075434_100001755 3300006871 Bacteria 18634
184 Ga0075434_100020360 3300006871 Bacteria 6434
185 Ga0075434_100023627 3300006871 Bacteria 5995
186 Ga0075434_100076733 3300006871 Bacteria 3336
187 Ga0075434_100250554 3300006871 Unclassified 1790
188 Ga0075434_100303391 3300006871 Unclassified 1617
189 Ga0075429_100000156 3300006880 Bacteria 42804
190 Ga0075429_100001098 3300006880 Bacteria 21794
191 Ga0075429_100010969 3300006880 Bacteria 7841
192 Ga0075429_100074090 3300006880 Unclassified 2965
193 Ga0075429_100079918 3300006880 Unclassified 2850
194 Ga0075429_100235770 3300006880 Unclassified 1603
195 Ga0068865_100060806 3300006881 Unclassified 2645
196 Ga0068865_100191633 3300006881 Bacteria 1581
197 Ga0068865_100218342 3300006881 Unclassified 1489
198 Ga0097620_100037314 3300006931 Unclassified 4877
199 Ga0097620_100060788 3300006931 Bacteria 3807
200 Ga0097620_100198395 3300006931 Unclassified 2091
201 Ga0097620_100325193 3300006931 Unclassified 1632
202 Ga0075435_100005436 3300007076 Bacteria 8894
203 Ga0075435_100029054 3300007076 Unclassified 4338
204 Ga0075435_100031334 3300007076 Bacteria 4187
205 Ga0075435_100040153 3300007076 Bacteria 3736
206 Ga0075435_100074790 3300007076 Unclassified 2772
207 Ga0075435_100468594 3300007076 Bacteria 1087
208 Ga0105240_10036091 3300009093 Bacteria 6364
209 Ga0111539_10000181 3300009094 Bacteria 73457
210 Ga0111539_10023644 3300009094 Bacteria 7551
211 Ga0111539_10037490 3300009094 Bacteria 5853
212 Ga0111539_10045725 3300009094 Bacteria 5240
213 Ga0111539_10096209 3300009094 Unclassified 3478
214 Ga0111539_10105460 3300009094 Unclassified 3306
215 Ga0111539_10126266 3300009094 Unclassified 2997
216 Ga0111539_10215409 3300009094 Unclassified 2237
217 Ga0111539_10571414 3300009094 Bacteria 1317
218 Ga0105245_10030613 3300009098 Bacteria 4760
219 Ga0105245_10076419 3300009098 Unclassified 3051
220 Ga0105245_10167748 3300009098 Unclassified 2088
221 Ga0114129_10000077 3300009147 Bacteria 90951
222 Ga0114129_10000514 3300009147 Bacteria 47437
223 Ga0114129_10002726 3300009147 Bacteria 24623
224 Ga0114129_10007735 3300009147 Bacteria 15293
225 Ga0114129_10013787 3300009147 Bacteria 11518
226 Ga0114129_10013905 3300009147 Bacteria 11466
227 Ga0114129_10015698 3300009147 Bacteria 10769
228 Ga0114129_10110743 3300009147 Bacteria 3789
229 Ga0114129_10158835 3300009147 Bacteria 3090
230 Ga0114129_10633059 3300009147 Bacteria 1382
231 Ga0114129_10916354 3300009147 Bacteria 1109
232 Ga0114129_11154759 3300009147 Bacteria 967
233 Ga0105243_10047052 3300009148 Bacteria 3395
234 Ga0105243_10181709 3300009148 Bacteria 1830
235 Ga0105243_10693624 3300009148 Bacteria 992
236 Ga0105241_10054976 3300009174 Bacteria 3049
237 Ga0105242_10017181 3300009176 Bacteria 5633
238 Ga0105242_10034494 3300009176 Bacteria 4056
239 Ga0105242_10117827 3300009176 Unclassified 2274
240 Ga0105242_10130086 3300009176 Bacteria 2172
241 Ga0105242_10245214 3300009176 Unclassified 1612
242 Ga0105248_10012687 3300009177 Bacteria 9298
243 Ga0105248_10022665 3300009177 Bacteria 6970
244 Ga0105248_10035017 3300009177 Bacteria 5617
245 Ga0105248_10089803 3300009177 Bacteria 3459
246 Ga0105248_10118712 3300009177 Unclassified 2983
247 Ga0105248_10132287 3300009177 Bacteria 2815
248 Ga0105248_10181610 3300009177 Bacteria 2371
249 Ga0105248_10409319 3300009177 Bacteria 1527
250 Ga0105238_10285854 3300009551 Bacteria 1631
251 Ga0105249_10037025 3300009553 Bacteria 4427
252 Ga0105249_10071621 3300009553 Unclassified 3203
253 Ga0105239_10480312 3300010375 Bacteria 1412
254 Ga0105246_10086052 3300011119 Bacteria 2252
255 Ga0157371_10041635 3300013102 Unclassified 3277
256 Ga0157374_10022596 3300013296 Bacteria 5612
257 Ga0157374_10083162 3300013296 Bacteria 3041
258 Ga0157374_10338797 3300013296 Bacteria 1493
259 Ga0157378_10080257 3300013297 Unclassified 2947
260 Ga0157378_10242953 3300013297 Bacteria 1721
261 Ga0163162_10135032 3300013306 Unclassified 2578
262 Ga0163162_10174008 3300013306 Bacteria 2278
263 Ga0163162_10264839 3300013306 Unclassified 1850
264 Ga0163162_10313946 3300013306 Bacteria 1700
265 Ga0163162_10862566 3300013306 Unclassified 1020
266 Ga0157372_10122431 3300013307 Bacteria 2989
267 Ga0157375_10140863 3300013308 Unclassified 2539
268 Ga0157375_10327445 3300013308 Unclassified 1697
269 Ga0157375_10429093 3300013308 Bacteria 1488
270 Ga0163163_10003151 3300014325 Bacteria 13989
271 Ga0163163_10475084 3300014325 Bacteria 1311
272 Ga0157380_10001546 3300014326 Bacteria 15126
273 Ga0157380_10002267 3300014326 Bacteria 12931
274 Ga0157380_10071704 3300014326 Unclassified 2803
275 Ga0157380_10146656 3300014326 Unclassified 2034
276 Ga0157380_10419469 3300014326 Bacteria 1276
277 Ga0157379_10061366 3300014968 Bacteria 3362
278 Ga0157376_10141358 3300014969 Unclassified 2160
279 Ga0163161_10007022 3300017792 Bacteria 7790
280 Ga0163161_10012743 3300017792 Bacteria 5839
281 Ga0207673_1001705 3300025290 Unclassified 2431
282 Ga0207697_10001445 3300025315 Bacteria 12980
283 Ga0207697_10027783 3300025315 Bacteria 2313
284 Ga0207682_10001509 3300025893 Bacteria 10728
285 Ga0207642_10005566 3300025899 Bacteria 4120
286 Ga0207688_10000580 3300025901 Bacteria 17967
287 Ga0207680_10044263 3300025903 Unclassified 2616
288 Ga0207680_10143868 3300025903 Bacteria 1583
289 Ga0207647_10078496 3300025904 Unclassified 1983
290 Ga0207647_10187819 3300025904 Unclassified 1198
291 Ga0207645_10001432 3300025907 Bacteria 19537
292 Ga0207645_10014979 3300025907 Bacteria 5167
293 Ga0207645_10107001 3300025907 Bacteria 1808
294 Ga0207643_10000531 3300025908 Bacteria 24486
295 Ga0207643_10045083 3300025908 Bacteria 2490
296 Ga0207643_10047144 3300025908 Bacteria 2437
297 Ga0207695_10072901 3300025913 Bacteria 3501
298 Ga0207663_10027062 3300025916 Unclassified 3337
299 Ga0207662_10005308 3300025918 Bacteria 6850
300 Ga0207662_10009075 3300025918 Bacteria 5462
301 Ga0207649_10014801 3300025920 Unclassified 4375
302 Ga0207649_10035708 3300025920 Unclassified 2989
303 Ga0207681_10004177 3300025923 Bacteria 8941
304 Ga0207681_10035598 3300025923 Bacteria 3281
305 Ga0207650_10049875 3300025925 Unclassified 3093
306 Ga0207650_10066314 3300025925 Unclassified 2707
307 Ga0207650_10131640 3300025925 Unclassified 1958
308 Ga0207659_10000226 3300025926 Bacteria 34216
309 Ga0207659_10021849 3300025926 Unclassified 4254
310 Ga0207659_10047125 3300025926 Bacteria 3048
311 Ga0207659_10118111 3300025926 Unclassified 2028
312 Ga0207659_10223532 3300025926 Unclassified 1515
313 Ga0207687_10136893 3300025927 Unclassified 1853
314 Ga0207687_10283714 3300025927 Bacteria 1328
315 Ga0207687_10341992 3300025927 Unclassified 1217
316 Ga0207644_10009848 3300025931 Bacteria 6287
317 Ga0207644_10125697 3300025931 Unclassified 1957
318 Ga0207690_10042703 3300025932 Unclassified 2980
319 Ga0207706_10001425 3300025933 Bacteria 23916
320 Ga0207706_10026094 3300025933 Bacteria 5230
321 Ga0207706_10072465 3300025933 Bacteria 3030
322 Ga0207686_10009465 3300025934 Bacteria 5288
323 Ga0207709_10024741 3300025935 Bacteria 3432
324 Ga0207709_10093250 3300025935 Bacteria 1974
325 Ga0207670_10012807 3300025936 Unclassified 4921
326 Ga0207669_10000130 3300025937 Bacteria 37362
327 Ga0207669_10002011 3300025937 Bacteria 8627
328 Ga0207669_10106139 3300025937 Unclassified 1870
329 Ga0207669_10193067 3300025937 Bacteria 1471
330 Ga0207704_10137024 3300025938 Archaea 1706
331 Ga0207665_10510575 3300025939 Unclassified 930
332 Ga0207691_10002885 3300025940 Bacteria 16760
333 Ga0207691_10061022 3300025940 Bacteria 3425
334 Ga0207691_10229275 3300025940 Bacteria 1609
335 Ga0207691_10273283 3300025940 Unclassified 1455
336 Ga0207691_10382863 3300025940 Unclassified 1201
337 Ga0207711_10020588 3300025941 Bacteria 5504
338 Ga0207689_10001380 3300025942 Bacteria 23265
339 Ga0207689_10124657 3300025942 Unclassified 2119
340 Ga0207661_10000542 3300025944 Bacteria 24195
341 Ga0207661_10200460 3300025944 Unclassified 1754
342 Ga0207661_10499085 3300025944 Bacteria 1112
343 Ga0207679_10044113 3300025945 Unclassified 3216
344 Ga0207679_10077861 3300025945 Unclassified 2524
345 Ga0207679_10093549 3300025945 Bacteria 2332
346 Ga0207679_10108373 3300025945 Unclassified 2187
347 Ga0207651_10006455 3300025960 Bacteria 6141
348 Ga0207712_10044550 3300025961 Bacteria 3067
349 Ga0207712_10143252 3300025961 Bacteria 1837
350 Ga0207668_10008129 3300025972 Bacteria 6245
351 Ga0207640_10048197 3300025981 Unclassified 2753
352 Ga0207658_10103178 3300025986 Unclassified 2238
353 Ga0207677_10058819 3300026023 Unclassified 2649
354 Ga0207703_10118428 3300026035 Unclassified 2270
355 Ga0207703_10596677 3300026035 Unclassified 1044
356 Ga0207639_10207245 3300026041 Unclassified 1686
357 Ga0207708_10012568 3300026075 Bacteria 6313
358 Ga0207708_10013435 3300026075 Bacteria 6121
359 Ga0207708_10036111 3300026075 Unclassified 3762
360 Ga0207708_10149031 3300026075 Bacteria 1840
361 Ga0207702_10032465 3300026078 Unclassified 4356
362 Ga0207641_10053699 3300026088 Unclassified 3416
363 Ga0207641_10203375 3300026088 Bacteria 1827
364 Ga0207641_10762167 3300026088 Unclassified 956
365 Ga0207648_10015983 3300026089 Bacteria 6877
366 Ga0207648_10023901 3300026089 Bacteria 5464
367 Ga0207648_10058985 3300026089 Bacteria 3347
368 Ga0207676_10197189 3300026095 Bacteria 1776
369 Ga0207674_10075211 3300026116 Unclassified 3388
370 Ga0207674_10405480 3300026116 Unclassified 1317
371 Ga0207675_100004503 3300026118 Bacteria 13463
372 Ga0207675_100117413 3300026118 Bacteria 2515
373 Ga0207675_100767998 3300026118 Unclassified 976
374 Ga0207683_10031094 3300026121 Bacteria 4632
375 Ga0207683_10088167 3300026121 Bacteria 2760
376 Ga0207683_10103832 3300026121 Bacteria 2539
377 Ga0207683_10119372 3300026121 Unclassified 2366
378 Ga0207698_10138776 3300026142 Bacteria 2090
379 Ga0207698_10792739 3300026142 Unclassified 949
380 Ga0209998_10023282 3300027717 Unclassified 1339
381 Ga0209998_10033877 3300027717 Bacteria 1140
382 Ga0209813_10004458 3300027866 Unclassified 3346
383 Ga0209974_10061423 3300027876 Bacteria 1272
384 Ga0207428_10000558 3300027907 Bacteria 44040
385 Ga0207428_10033664 3300027907 Bacteria 4206
386 Ga0268266_10018279 3300028379 Bacteria 5977
387 Ga0268266_10089247 3300028379 Unclassified 2699
388 Ga0268266_10187869 3300028379 Unclassified 1885
389 Ga0268266_10720247 3300028379 Bacteria 962
390 Ga0268265_10014693 3300028380 Bacteria 5340
391 Ga0268265_10137334 3300028380 Bacteria 2041
392 Ga0268265_10244063 3300028380 Bacteria 1587
393 Ga0268264_10141716 3300028381 Unclassified 2144
394 Ga0268264_10572068 3300028381 Unclassified 1111
395 Ga0307408_100057756 3300031548 Bacteria 2818
396 Ga0307408_100384986 3300031548 Unclassified 1200
397 Ga0307408_100478094 3300031548 Bacteria 1086
398 Ga0307408_100565620 3300031548 Bacteria 1005
399 Ga0307408_100612279 3300031548 Unclassified 969
400 Ga0307405_10049117 3300031731 Unclassified 2606
401 Ga0307405_10412310 3300031731 Unclassified 1061
402 Ga0307413_10038887 3300031824 Bacteria 2761
403 Ga0307410_10219140 3300031852 Unclassified 1463
404 Ga0307410_10274445 3300031852 Bacteria 1320
405 Ga0307406_10076220 3300031901 Bacteria 2215
406 Ga0307406_10445386 3300031901 Bacteria 1038
407 Ga0307412_10198459 3300031911 Bacteria 1522
408 Ga0307409_100090197 3300031995 Unclassified 2508
409 Ga0307409_100136834 3300031995 Unclassified 2104
410 Ga0307409_100501608 3300031995 Bacteria 1182
411 Ga0307416_100014602 3300032002 Bacteria 5391
412 Ga0307416_100027682 3300032002 Bacteria 4202
413 Ga0307416_100202221 3300032002 Bacteria 1886
414 Ga0307416_100399095 3300032002 Bacteria 1412
415 Ga0307414_10085097 3300032004 Bacteria 2328
416 Ga0307414_10305855 3300032004 Bacteria 1347
417 Ga0307414_10669302 3300032004 Bacteria 937
418 Ga0307411_10232640 3300032005 Bacteria 1437
419 Ga0307411_10305633 3300032005 Bacteria 1277
420 Ga0307411_10457906 3300032005 Bacteria 1069
421 Ga0307411_10477995 3300032005 Bacteria 1048
422 Ga0307415_100034260 3300032126 Bacteria 3304
423 Ga0307415_100614454 3300032126 Unclassified 969
424 Ga0373930_0001820 3300034816 Unclassified 3245
425 Ga0373948_0041856 3300034817 Bacteria 961
426 Ga0373938_0051510 3300034957 Bacteria 942
427 Ga0373928_0008118 3300035084 Unclassified 2033
428 Ga0373929_0002233 3300035085 Unclassified 3581
429 Ga0373940_0007192 3300035088 Unclassified 2501
430 Ga0373949_0025296 3300035090 Unclassified 1384
431 Ga0373951_0039979 3300035091 Bacteria 1128
432 Ga0373952_0052968 3300035092 Bacteria 972
433 Ga0373932_0063253 3300035112 Unclassified 1130
434 Ga0373939_0008402 3300035114 Unclassified 2530
435 Ga0373941_0002172 3300035115 Bacteria 4282
436 Ga0373941_0052555 3300035115 Bacteria 1300
437 Ga0373960_0041498 3300035121 Bacteria 1332
438 Ga0373943_0003999 3300035170 Bacteria 6709
439 Ga0373955_0032490 3300035172 Unclassified 2740
440 Ga0373961_0002989 3300035241 Unclassified 4265
441 Ga0373961_0069340 3300035241 Unclassified 1087
442 Ga0373962_0007099 3300035242 Unclassified 2738
443 Ga0373924_0006834 3300035410 Bacteria 4099
444 Ga0373931_0051267 3300035691 Bacteria 2197
445 Ga0373927_0073429 3300035695 Unclassified 2215
446 Ga0373937_0333832 3300036401 Bacteria 1435
447 Ga0373925_0010864 3300037068 Bacteria 6602
448 Ga0373925_0370025 3300037068 Bacteria 1166
449 Ga0395901_0363964 3300038443 Unclassified 1491
450 Ga0439439_0017911 3300041406 Bacteria 1747
451 Ga0450923_041213 3300042125 Unclassified 971
452 Ga0450896_002083 3300042133 Unclassified 2549
453 Ga0439435_0009711 3300042436 Bacteria 2264
454 Ga0439464_0000199 3300042439 Bacteria 10536
455 Ga0451577_0076803 3300042876 Unclassified 2978
456 Ga0451576_0059149 3300045051 Unclassified 4001
457 Ga0495592_0076214 3300046454 Bacteria 2434
458 Ga0495653_0220088 3300046463 Bacteria 1277
459 Ga0495582_0199145 3300046473 Unclassified 1143
460 Ga0495608_0003942 3300046511 Bacteria 10667
461 Ga0495628_0011801 3300046516 Bacteria 7374
462 Ga0495652_0106731 3300046529 Bacteria 2261
463 Ga0495587_0095658 3300046536 Bacteria 1714
464 Ga0495621_0004898 3300046539 Bacteria 3803
465 Ga0495645_0095637 3300046543 Bacteria 2117
466 Ga0495667_0103951 3300046559 Unclassified 1837
467 Ga0495658_0026020 3300046683 Bacteria 3132
468 Ga0495658_0104464 3300046683 Bacteria 1695
469 Ga0495613_0001676 3300046689 Bacteria 16870
470 Ga0495600_0125838 3300046809 Bacteria 1667
471 Ga0495674_0028693 3300047319 Bacteria 5069
472 Ga0495684_0002679 3300047471 Bacteria 14108
473 Ga0495684_0251702 3300047471 Unclassified 1285
474 Ga0496101_0043394 3300048904 Bacteria 3215
475 Ga0496101_0590763 3300048904 Bacteria 878
476 Ga0496102_0240069 3300048905 Unclassified 1709
477 Ga0496104_0000479 3300048907 Bacteria 34454
478 Ga0496104_0054277 3300048907 Bacteria 3787
479 Ga0496104_0123915 3300048907 Unclassified 2481
480 Ga0496105_0069653 3300048908 Bacteria 2907
481 Ga0496105_0095809 3300048908 Bacteria 2451
482 Ga0496106_0045142 3300048909 Bacteria 3310
483 Ga0496106_0351256 3300048909 Bacteria 1184
484 Ga0496108_0023345 3300048911 Bacteria 5088
485 Ga0496109_0002104 3300048912 Bacteria 16550
486 Ga0496109_0022995 3300048912 Bacteria 5528
487 Ga0496110_0000892 3300048913 Bacteria 21043
488 Ga0496110_0034190 3300048913 Bacteria 4402
489 Ga0496111_0107504 3300048914 Bacteria 2054
490 Ga0496112_0049228 3300048915 Unclassified 4131
491 Ga0496113_0085020 3300048916 Bacteria 2430
492 Ga0496113_0520574 3300048916 Bacteria 955
493 Ga0496113_0624678 3300048916 Bacteria 862
494 Ga0496114_0008853 3300048917 Bacteria 7978
495 Ga0496114_0023028 3300048917 Bacteria 5077
496 Ga0496115_0041502 3300048918 Unclassified 3662
497 Ga0501291_016715 3300049514 Bacteria 1123
498 Ga0501292_013875 3300049515 Unclassified 1244
499 Ga0501036_0040580 3300049572 Bacteria 3937
500 Ga0501036_0152017 3300049572 Bacteria 1952
501 Ga0501039_0265419 3300049575 Bacteria 1349
502 Ga0501039_0345527 3300049575 Bacteria 1169
503 Ga0501040_0019291 3300049576 Unclassified 4536
504 Ga0501046_0165651 3300049580 Bacteria 1661
505 Ga0501046_0183536 3300049580 Bacteria 1563
506 Ga0501048_0021819 3300049582 Unclassified 4687
507 Ga0501071_0230910 3300049587 Bacteria 1394
508 Ga0501074_0059099 3300049590 Unclassified 2763
509 Ga0501075_0065029 3300049591 Bacteria 2751
510 Ga0501075_0098653 3300049591 Bacteria 2218
511 Ga0501075_0192880 3300049591 Bacteria 1554
512 Ga0501076_0055421 3300049592 Unclassified 3144
513 Ga0501076_0233127 3300049592 Archaea 1505
514 Ga0501077_0140305 3300049593 Bacteria 1533
515 Ga0501077_0248500 3300049593 Bacteria 1131
516 Ga0501217_008527 3300049661 Bacteria 2217
517 Ga0501079_0161763 3300049741 Bacteria 1746
518 Ga0501080_0519967 3300049742 Unclassified 1062
519 Ga0501081_0041004 3300049743 Bacteria 3169
520 Ga0501083_0103130 3300049744 Unclassified 1880
521 Ga0501045_0092862 3300049824 Bacteria 2232
522 nmdc:mga03683_17314_c1 3300050489 Bacteria 2727
523 nmdc:mga00v17_31906_c1 3300050491 Bacteria 3110
524 nmdc:mga00v17_5419_c1 3300050491 Bacteria 6720
525 nmdc:mga0yw44_10162_c1 3300050492 Unclassified 4795
526 nmdc:mga0yw44_3800_c1 3300050492 Bacteria 4379
527 nmdc:mga0yw44_45982_c1 3300050492 Bacteria 2619
528 nmdc:mga0k408_3616_c1 3300050493 Unclassified 1866
529 nmdc:mga0k408_39031_c1 3300050493 Unclassified 2727
530 nmdc:mga06z11_10343_c1 3300050494 Bacteria 3972
531 nmdc:mga06z11_99157_c1 3300050494 Bacteria 1595
532 nmdc:mga04h51_4057_c1 3300050495 Unclassified 3608
533 nmdc:mga05p37_1584_c1 3300050507 Bacteria 26427
534 nmdc:mga05p37_18753_c1 3300050507 Bacteria 8361
535 nmdc:mga05p37_21303_c1 3300050507 Bacteria 7848
536 nmdc:mga05p37_240392_c1 3300050507 Bacteria 2177
537 nmdc:mga05p37_2612_c1 3300050507 Bacteria 20973
538 nmdc:mga05p37_29789_c1 3300050507 Bacteria 6660
539 nmdc:mga05p37_44685_c1 3300050507 Bacteria 5450
540 nmdc:mga05p37_55193_c1 3300050507 Bacteria 4888
541 nmdc:mga05p37_781243_c1 3300050507 Bacteria 1048
542 nmdc:mga05p37_9726_c1 3300050507 Bacteria 11401
543 nmdc:mga09592_177058_c1 3300050508 Bacteria 1845
544 nmdc:mga09592_17768_c1 3300050508 Bacteria 5829
545 nmdc:mga09592_244675_c1 3300050508 Unclassified 1554
546 nmdc:mga09592_5651_c1 3300050508 Bacteria 10201
547 nmdc:mga09592_5795_c1 3300050508 Bacteria 10075
548 nmdc:mga09592_84225_c1 3300050508 Bacteria 2711
549 nmdc:mga0qj67_23061_c1 3300050509 Bacteria 4784
550 nmdc:mga0qj67_265_c1 3300050509 Bacteria 35965
551 nmdc:mga0qj67_3300_c1 3300050509 Bacteria 11625
552 nmdc:mga06r32_121594_c1 3300050510 Bacteria 2576
553 nmdc:mga06r32_373665_c1 3300050510 Bacteria 1409
554 nmdc:mga06r32_409_c1 3300050510 Bacteria 36121
555 nmdc:mga06r32_538209_c1 3300050510 Unclassified 1143
556 nmdc:mga06r32_540438_c1 3300050510 Bacteria 1140
557 nmdc:mga06r32_68759_c1 3300050510 Bacteria 3422
558 nmdc:mga08y16_101918_c1 3300050511 Unclassified 2988
559 nmdc:mga08y16_172772_c1 3300050511 Unclassified 2244
560 nmdc:mga08y16_277296_c1 3300050511 Bacteria 1730
561 nmdc:mga08y16_28775_c1 3300050511 Bacteria 5856
562 nmdc:mga08y16_403_c1 3300050511 Bacteria 39740
563 nmdc:mga08y16_4837_c1 3300050511 Bacteria 14055
564 nmdc:mga08y16_49183_c1 3300050511 Unclassified 4413
565 nmdc:mga08y16_65715_c1 3300050511 Bacteria 3786
566 nmdc:mga0n895_12558_c1 3300050512 Bacteria 7600
567 nmdc:mga0n895_146607_c1 3300050512 Unclassified 2390
568 nmdc:mga0n895_192756_c1 3300050512 Unclassified 2069
569 nmdc:mga0n895_242386_c1 3300050512 Unclassified 1830
570 nmdc:mga0n895_362443_c1 3300050512 Bacteria 1468
571 nmdc:mga0n895_453559_c1 3300050512 Bacteria 1294
572 nmdc:mga0n895_6881_c1 3300050512 Bacteria 9712
573 nmdc:mga0n895_79572_c1 3300050512 Bacteria 3264
574 nmdc:mga0rr50_20358_c1 3300050513 Unclassified 4503
575 nmdc:mga0rr50_5097_c1 3300050513 Bacteria 7794
576 nmdc:mga0rr50_53606_c1 3300050513 Bacteria 3001
577 nmdc:mga0rr50_8035_c1 3300050513 Bacteria 6543
578 nmdc:mga0a205_11144_c1 3300050515 Bacteria 8274
579 nmdc:mga0a205_12868_c1 3300050515 Bacteria 7763
580 nmdc:mga0a205_207767_c1 3300050515 Unclassified 1847
581 nmdc:mga0a205_22807_c2 3300050515 Unclassified 3960
582 nmdc:mga0a205_3305_c1 3300050515 Bacteria 14349
583 nmdc:mga0a205_428086_c1 3300050515 Bacteria 1185
584 nmdc:mga0a205_85435_c1 3300050515 Bacteria 3047
585 Ga0495601_0003730 3300053077 Bacteria 8770
586 Ga0495601_0017957 3300053077 Unclassified 4301
587 Ga0495619_0005595 3300053085 Bacteria 7972
588 Ga0495619_0091778 3300053085 Bacteria 2056
589 Ga0501084_0429114 3300054114 Unclassified 1117
590 Ga0501084_0652666 3300054114 Bacteria 888
591 Ga0590071_001971 3300059421 Bacteria 5249
592 Ga0590075_002418 3300059424 Bacteria 4475
593 Ga0590077_003427 3300059426 Bacteria 3282
594 Ga0501082_0075741 3300060353 Unclassified 2899
595 Ga0501082_0166921 3300060353 Bacteria 1913
596 Ga0501082_0247749 3300060353 Bacteria 1551
597 Ga0530510_0028439 3300061734 Unclassified 4009
598 Ga0070689_100022863
599 MBSR1b_contig_11773844
600 JGI24746J21847_1004261
601 Ga0065704_10095196
602 Ga0065704_10097627
603 Ga0065712_10192533
604 Ga0065715_10003722
605 Ga0065715_10200009
606 Ga0065707_10014969
607 Ga0065707_10017029
608 Ga0065707_10081885
609 Ga0065707_10111836
610 Ga0065707_10190026
611 Ga0070676_10001169
612 Ga0070676_10403903
613 Ga0070683_100000477
614 Ga0070683_100217361
615 Ga0070683_100371895
616 Ga0070690_100025007
617 Ga0070690_100290264
618 Ga0070670_100008689
619 Ga0070670_100067262
620 Ga0070670_100159090
621 Ga0070670_100468832
622 Ga0070677_10001135
623 Ga0068869_100025900
624 Ga0070666_10002556
625 Ga0070666_10339102
626 Ga0068868_100001481
627 Ga0068868_100085518
628 Ga0070660_100140962
629 Ga0070689_100063022
630 Ga0070687_100005898
631 Ga0070661_100023862
632 Ga0070661_100049584
633 Ga0070692_10191938
634 Ga0070668_100018734
635 Ga0070669_100005042
636 Ga0070669_100011075
637 Ga0070669_100185690
638 Ga0070675_100000057
639 Ga0070675_100016375
640 Ga0070675_100064413
641 Ga0070675_100438410
642 Ga0070671_100035606
643 Ga0070671_100154376
644 Ga0070674_100000066
645 Ga0070674_100097105
646 Ga0070674_100141714
647 Ga0070674_100256822
648 Ga0070673_100000770
649 Ga0070673_100002572
650 Ga0070673_100010695
651 Ga0070673_100144319
652 Ga0070673_100151983
653 Ga0070688_100006986
654 Ga0070688_100171777
655 Ga0070659_100084966
656 Ga0070659_100085762
657 Ga0070667_100004299
658 Ga0070667_100005547
659 Ga0070713_100022935
660 Ga0070711_100032735
661 Ga0070711_100102035
662 Ga0070705_100000264
663 Ga0070705_100012124
664 Ga0070700_100016790
665 Ga0070700_100069465
666 Ga0070700_100069477
667 Ga0070694_100000641
668 Ga0070678_100091628
669 Ga0070678_100306745
670 Ga0070662_100066806
671 Ga0070662_100118898
672 Ga0068867_100042449
673 Ga0068867_100062507
674 Ga0070685_10005280
675 Ga0070685_10187096
676 Ga0070706_100199082
677 Ga0070706_100304673
678 Ga0070707_100152768
679 Ga0070707_100434372
680 Ga0070698_100326153
681 Ga0070699_100002018
682 Ga0070699_100010537
683 Ga0070699_100042157
684 Ga0068853_100168932
685 Ga0070672_100030067
686 Ga0070672_100055923
687 Ga0070672_100228380
688 Ga0070672_100528944
689 Ga0070686_100003843
690 Ga0070686_100021489
691 Ga0070695_100000013
692 Ga0070695_100066229
693 Ga0070696_100000480
694 Ga0070696_100072820
695 Ga0070696_100093831
696 Ga0070665_100015313
697 Ga0070665_100022325
698 Ga0070704_100039212
699 Ga0070704_100042755
700 Ga0070704_100203252
701 Ga0068855_100452826
702 Ga0070664_100025667
703 Ga0070664_100038123
704 Ga0070664_100039661
705 Ga0068857_100148017
706 Ga0068857_100446139
707 Ga0068854_100107246
708 Ga0068854_100169746
709 Ga0068856_100091422
710 Ga0068852_100046244
711 Ga0068859_100037314
712 Ga0068859_100060788
713 Ga0068859_100198406
714 Ga0068859_100325221
715 Ga0068864_100141264
716 Ga0068861_100015401
717 Ga0068861_100072806
718 Ga0068870_10004557
719 Ga0068870_10037785
720 Ga0068870_10048539
721 Ga0068863_100015243
722 Ga0068863_100029254
723 Ga0068863_100155529
724 Ga0068863_100486024
725 Ga0068858_100069986
726 Ga0068860_100007938
727 Ga0068860_100147851
728 Ga0068860_100464745
729 Ga0068862_100011628
730 Ga0068862_100035252
731 Ga0068862_100089949
732 Ga0081539_10013121
733 Ga0070717_10014786
734 Ga0075365_10000667
735 Ga0075365_10004618
736 Ga0075365_10045583
737 Ga0075368_10007345
738 Ga0075364_10001490
739 Ga0075364_10033620
740 Ga0075432_10043115
741 Ga0070716_100380879
742 Ga0075367_10051591
743 Ga0075366_10003399
744 Ga0075366_10036066
745 Ga0097621_100009132
746 Ga0097621_100022570
747 Ga0097621_100131486
748 Ga0097621_100261755
749 Ga0075370_10000516
750 Ga0068871_100020587
751 Ga0068871_100083477
752 Ga0075428_100000080
753 Ga0075428_100003599
754 Ga0075428_100004889
755 Ga0075428_100016762
756 Ga0075428_100031446
757 Ga0075428_100032052
758 Ga0075428_100040807
759 Ga0075428_100111051
760 Ga0075428_100189881
761 Ga0075428_100209399
762 Ga0075430_100000725
763 Ga0075430_100001296
764 Ga0075430_100005455
765 Ga0075431_100000200
766 Ga0075431_100014006
767 Ga0075431_100072957
768 Ga0075431_100130502
769 Ga0075431_100284649
770 Ga0075431_100342916
771 Ga0075431_100559933
772 Ga0075433_10005597
773 Ga0075433_10008682
774 Ga0075433_10023030
775 Ga0075433_10067077
776 Ga0075433_10071610
777 Ga0075433_10105682
778 Ga0075433_10127915
779 Ga0075433_10154288
780 Ga0075434_100001755
781 Ga0075434_100020360
782 Ga0075434_100023627
783 Ga0075434_100076733
784 Ga0075434_100250554
785 Ga0075434_100303391
786 Ga0075429_100000156
787 Ga0075429_100001098
788 Ga0075429_100010969
789 Ga0075429_100074090
790 Ga0075429_100079918
791 Ga0075429_100235770
792 Ga0068865_100060806
793 Ga0068865_100191633
794 Ga0068865_100218342
795 Ga0097620_100037314
796 Ga0097620_100060788
797 Ga0097620_100198395
798 Ga0097620_100325193
799 Ga0075435_100005436
800 Ga0075435_100029054
801 Ga0075435_100031334
802 Ga0075435_100040153
803 Ga0075435_100074790
804 Ga0075435_100468594
805 Ga0105240_10036091
806 Ga0111539_10000181
807 Ga0111539_10023644
808 Ga0111539_10037490
809 Ga0111539_10045725
810 Ga0111539_10096209
811 Ga0111539_10105460
812 Ga0111539_10126266
813 Ga0111539_10215409
814 Ga0111539_10571414
815 Ga0105245_10030613
816 Ga0105245_10076419
817 Ga0105245_10167748
818 Ga0114129_10000077
819 Ga0114129_10000514
820 Ga0114129_10002726
821 Ga0114129_10007735
822 Ga0114129_10013787
823 Ga0114129_10013905
824 Ga0114129_10015698
825 Ga0114129_10110743
826 Ga0114129_10158835
827 Ga0114129_10633059
828 Ga0114129_10916354
829 Ga0114129_11154759
830 Ga0105243_10047052
831 Ga0105243_10181709
832 Ga0105243_10693624
833 Ga0105241_10054976
834 Ga0105242_10017181
835 Ga0105242_10034494
836 Ga0105242_10117827
837 Ga0105242_10130086
838 Ga0105242_10245214
839 Ga0105248_10012687
840 Ga0105248_10022665
841 Ga0105248_10035017
842 Ga0105248_10089803
843 Ga0105248_10118712
844 Ga0105248_10132287
845 Ga0105248_10181610
846 Ga0105248_10409319
847 Ga0105238_10285854
848 Ga0105249_10037025
849 Ga0105249_10071621
850 Ga0105239_10480312
851 Ga0105246_10086052
852 Ga0157371_10041635
853 Ga0157374_10022596
854 Ga0157374_10083162
855 Ga0157374_10338797
856 Ga0157378_10080257
857 Ga0157378_10242953
858 Ga0163162_10135032
859 Ga0163162_10174008
860 Ga0163162_10264839
861 Ga0163162_10313946
862 Ga0163162_10862566
863 Ga0157372_10122431
864 Ga0157375_10140863
865 Ga0157375_10327445
866 Ga0157375_10429093
867 Ga0163163_10003151
868 Ga0163163_10475084
869 Ga0157380_10001546
870 Ga0157380_10002267
871 Ga0157380_10071704
872 Ga0157380_10146656
873 Ga0157380_10419469
874 Ga0157379_10061366
875 Ga0157376_10141358
876 Ga0163161_10007022
877 Ga0163161_10012743
878 Ga0207673_1001705
879 Ga0207697_10001445
880 Ga0207697_10027783
881 Ga0207682_10001509
882 Ga0207642_10005566
883 Ga0207688_10000580
884 Ga0207680_10044263
885 Ga0207680_10143868
886 Ga0207647_10078496
887 Ga0207647_10187819
888 Ga0207645_10001432
889 Ga0207645_10014979
890 Ga0207645_10107001
891 Ga0207643_10000531
892 Ga0207643_10045083
893 Ga0207643_10047144
894 Ga0207695_10072901
895 Ga0207663_10027062
896 Ga0207662_10005308
897 Ga0207662_10009075
898 Ga0207649_10014801
899 Ga0207649_10035708
900 Ga0207681_10004177
901 Ga0207681_10035598
902 Ga0207650_10049875
903 Ga0207650_10066314
904 Ga0207650_10131640
905 Ga0207659_10000226
906 Ga0207659_10021849
907 Ga0207659_10047125
908 Ga0207659_10118111
909 Ga0207659_10223532
910 Ga0207687_10136893
911 Ga0207687_10283714
912 Ga0207687_10341992
913 Ga0207644_10009848
914 Ga0207644_10125697
915 Ga0207690_10042703
916 Ga0207706_10001425
917 Ga0207706_10026094
918 Ga0207706_10072465
919 Ga0207686_10009465
920 Ga0207709_10024741
921 Ga0207709_10093250
922 Ga0207670_10012807
923 Ga0207669_10000130
924 Ga0207669_10002011
925 Ga0207669_10106139
926 Ga0207669_10193067
927 Ga0207704_10137024
928 Ga0207665_10510575
929 Ga0207691_10002885
930 Ga0207691_10061022
931 Ga0207691_10229275
932 Ga0207691_10273283
933 Ga0207691_10382863
934 Ga0207711_10020588
935 Ga0207689_10001380
936 Ga0207689_10124657
937 Ga0207661_10000542
938 Ga0207661_10200460
939 Ga0207661_10499085
940 Ga0207679_10044113
941 Ga0207679_10077861
942 Ga0207679_10093549
943 Ga0207679_10108373
944 Ga0207651_10006455
945 Ga0207712_10044550
946 Ga0207712_10143252
947 Ga0207668_10008129
948 Ga0207640_10048197
949 Ga0207658_10103178
950 Ga0207677_10058819
951 Ga0207703_10118428
952 Ga0207703_10596677
953 Ga0207639_10207245
954 Ga0207708_10012568
955 Ga0207708_10013435
956 Ga0207708_10036111
957 Ga0207708_10149031
958 Ga0207702_10032465
959 Ga0207641_10053699
960 Ga0207641_10203375
961 Ga0207641_10762167
962 Ga0207648_10015983
963 Ga0207648_10023901
964 Ga0207648_10058985
965 Ga0207676_10197189
966 Ga0207674_10075211
967 Ga0207674_10405480
968 Ga0207675_100004503
969 Ga0207675_100117413
970 Ga0207675_100767998
971 Ga0207683_10031094
972 Ga0207683_10088167
973 Ga0207683_10103832
974 Ga0207683_10119372
975 Ga0207698_10138776
976 Ga0207698_10792739
977 Ga0209998_10023282
978 Ga0209998_10033877
979 Ga0209813_10004458
980 Ga0209974_10061423
981 Ga0207428_10000558
982 Ga0207428_10033664
983 Ga0268266_10018279
984 Ga0268266_10089247
985 Ga0268266_10187869
986 Ga0268266_10720247
987 Ga0268265_10014693
988 Ga0268265_10137334
989 Ga0268265_10244063
990 Ga0268264_10141716
991 Ga0268264_10572068
992 Ga0307408_100057756
993 Ga0307408_100384986
994 Ga0307408_100478094
995 Ga0307408_100565620
996 Ga0307408_100612279
997 Ga0307405_10049117
998 Ga0307405_10412310
999 Ga0307413_10038887
1000 Ga0307410_10219140
1001 Ga0307410_10274445
1002 Ga0307406_10076220
1003 Ga0307406_10445386
1004 Ga0307412_10198459
1005 Ga0307409_100090197
1006 Ga0307409_100136834
1007 Ga0307409_100501608
1008 Ga0307416_100014602
1009 Ga0307416_100027682
1010 Ga0307416_100202221
1011 Ga0307416_100399095
1012 Ga0307414_10085097
1013 Ga0307414_10305855
1014 Ga0307414_10669302
1015 Ga0307411_10232640
1016 Ga0307411_10305633
1017 Ga0307411_10457906
1018 Ga0307411_10477995
1019 Ga0307415_100034260
1020 Ga0307415_100614454
1021 Ga0373930_0001820
1022 Ga0373948_0041856
1023 Ga0373938_0051510
1024 Ga0373928_0008118
1025 Ga0373929_0002233
1026 Ga0373940_0007192
1027 Ga0373949_0025296
1028 Ga0373951_0039979
1029 Ga0373952_0052968
1030 Ga0373932_0063253
1031 Ga0373939_0008402
1032 Ga0373941_0002172
1033 Ga0373941_0052555
1034 Ga0373960_0041498
1035 Ga0373943_0003999
1036 Ga0373955_0032490
1037 Ga0373961_0002989
1038 Ga0373961_0069340
1039 Ga0373962_0007099
1040 Ga0373924_0006834
1041 Ga0373931_0051267
1042 Ga0373927_0073429
1043 Ga0373937_0333832
1044 Ga0373925_0010864
1045 Ga0373925_0370025
1046 Ga0395901_0363964
1047 Ga0439439_0017911
1048 Ga0450923_041213
1049 Ga0450896_002083
1050 Ga0439435_0009711
1051 Ga0439464_0000199
1052 Ga0451577_0076803
1053 Ga0451576_0059149
1054 Ga0495592_0076214
1055 Ga0495653_0220088
1056 Ga0495582_0199145
1057 Ga0495608_0003942
1058 Ga0495628_0011801
1059 Ga0495652_0106731
1060 Ga0495587_0095658
1061 Ga0495621_0004898
1062 Ga0495645_0095637
1063 Ga0495667_0103951
1064 Ga0495658_0026020
1065 Ga0495658_0104464
1066 Ga0495613_0001676
1067 Ga0495600_0125838
1068 Ga0495674_0028693
1069 Ga0495684_0002679
1070 Ga0495684_0251702
1071 Ga0496101_0043394
1072 Ga0496101_0590763
1073 Ga0496102_0240069
1074 Ga0496104_0000479
1075 Ga0496104_0054277
1076 Ga0496104_0123915
1077 Ga0496105_0069653
1078 Ga0496105_0095809
1079 Ga0496106_0045142
1080 Ga0496106_0351256
1081 Ga0496108_0023345
1082 Ga0496109_0002104
1083 Ga0496109_0022995
1084 Ga0496110_0000892
1085 Ga0496110_0034190
1086 Ga0496111_0107504
1087 Ga0496112_0049228
1088 Ga0496113_0085020
1089 Ga0496113_0520574
1090 Ga0496113_0624678
1091 Ga0496114_0008853
1092 Ga0496114_0023028
1093 Ga0496115_0041502
1094 Ga0501291_016715
1095 Ga0501292_013875
1096 Ga0501036_0040580
1097 Ga0501036_0152017
1098 Ga0501039_0265419
1099 Ga0501039_0345527
1100 Ga0501040_0019291
1101 Ga0501046_0165651
1102 Ga0501046_0183536
1103 Ga0501048_0021819
1104 Ga0501071_0230910
1105 Ga0501074_0059099
1106 Ga0501075_0065029
1107 Ga0501075_0098653
1108 Ga0501075_0192880
1109 Ga0501076_0055421
1110 Ga0501076_0233127
1111 Ga0501077_0140305
1112 Ga0501077_0248500
1113 Ga0501217_008527
1114 Ga0501079_0161763
1115 Ga0501080_0519967
1116 Ga0501081_0041004
1117 Ga0501083_0103130
1118 Ga0501045_0092862
1119 nmdc:mga03683_17314_c1
1120 nmdc:mga00v17_31906_c1
1121 nmdc:mga00v17_5419_c1
1122 nmdc:mga0yw44_10162_c1
1123 nmdc:mga0yw44_3800_c1
1124 nmdc:mga0yw44_45982_c1
1125 nmdc:mga0k408_3616_c1
1126 nmdc:mga0k408_39031_c1
1127 nmdc:mga06z11_10343_c1
1128 nmdc:mga06z11_99157_c1
1129 nmdc:mga04h51_4057_c1
1130 nmdc:mga05p37_1584_c1
1131 nmdc:mga05p37_18753_c1
1132 nmdc:mga05p37_21303_c1
1133 nmdc:mga05p37_240392_c1
1134 nmdc:mga05p37_2612_c1
1135 nmdc:mga05p37_29789_c1
1136 nmdc:mga05p37_44685_c1
1137 nmdc:mga05p37_55193_c1
1138 nmdc:mga05p37_781243_c1
1139 nmdc:mga05p37_9726_c1
1140 nmdc:mga09592_177058_c1
1141 nmdc:mga09592_17768_c1
1142 nmdc:mga09592_244675_c1
1143 nmdc:mga09592_5651_c1
1144 nmdc:mga09592_5795_c1
1145 nmdc:mga09592_84225_c1
1146 nmdc:mga0qj67_23061_c1
1147 nmdc:mga0qj67_265_c1
1148 nmdc:mga0qj67_3300_c1
1149 nmdc:mga06r32_121594_c1
1150 nmdc:mga06r32_373665_c1
1151 nmdc:mga06r32_409_c1
1152 nmdc:mga06r32_538209_c1
1153 nmdc:mga06r32_540438_c1
1154 nmdc:mga06r32_68759_c1
1155 nmdc:mga08y16_101918_c1
1156 nmdc:mga08y16_172772_c1
1157 nmdc:mga08y16_277296_c1
1158 nmdc:mga08y16_28775_c1
1159 nmdc:mga08y16_403_c1
1160 nmdc:mga08y16_4837_c1
1161 nmdc:mga08y16_49183_c1
1162 nmdc:mga08y16_65715_c1
1163 nmdc:mga0n895_12558_c1
1164 nmdc:mga0n895_146607_c1
1165 nmdc:mga0n895_192756_c1
1166 nmdc:mga0n895_242386_c1
1167 nmdc:mga0n895_362443_c1
1168 nmdc:mga0n895_453559_c1
1169 nmdc:mga0n895_6881_c1
1170 nmdc:mga0n895_79572_c1
1171 nmdc:mga0rr50_20358_c1
1172 nmdc:mga0rr50_5097_c1
1173 nmdc:mga0rr50_53606_c1
1174 nmdc:mga0rr50_8035_c1
1175 nmdc:mga0a205_11144_c1
1176 nmdc:mga0a205_12868_c1
1177 nmdc:mga0a205_207767_c1
1178 nmdc:mga0a205_22807_c2
1179 nmdc:mga0a205_3305_c1
1180 nmdc:mga0a205_428086_c1
1181 nmdc:mga0a205_85435_c1
1182 Ga0495601_0003730
1183 Ga0495601_0017957
1184 Ga0495619_0005595
1185 Ga0495619_0091778
1186 Ga0501084_0429114
1187 Ga0501084_0652666
1188 Ga0590071_001971
1189 Ga0590075_002418
1190 Ga0590077_003427
1191 Ga0501082_0075741
1192 Ga0501082_0166921
1193 Ga0501082_0247749
1194 Ga0530510_0028439

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02563

Poly_export

Polysaccharide biosynthesis/export protein

52

129

0.95

PF22461

SLBB_2

SLBB domain

134

224

0.93

PF10531

SLBB

SLBB domain

229

291

0.92

PF10531

SLBB

SLBB domain

135

188

0.8

PF22461

SLBB_2

SLBB domain

228

298

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dss-assembly1.cif.gz_B x-ray crystal structure of geobacillus stearothermophilus comea 0.9461 201 274
8dfk-assembly2.cif.gz_C x-ray crystal structure of bacillus subtilis comea 0.9385 201 275
8dss-assembly1.cif.gz_A x-ray crystal structure of geobacillus stearothermophilus comea 0.927 201 275
8dss-assembly1.cif.gz_A x-ray crystal structure of geobacillus stearothermophilus comea 0.8718 201 275
8dfk-assembly2.cif.gz_C x-ray crystal structure of bacillus subtilis comea 0.8697 201 275
ID Description Score Start End Superfamily
af_P71728_139_194_3.10.560.10 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.9611 204 272 3.10.560.10
2w8hA03 Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain 0.9496 33 104 3.30.1950.10
af_P71728_139_194_3.10.560.10 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.9122 204 272 3.10.560.10
2w8hA03 Alpha Beta;2-Layer Sandwich;wza like fold;wza like domain 0.827 33 104 3.30.1950.10
2j58A02 Alpha Beta;Roll;Outer membrane lipoprotein wza fold like;Outer membrane lipoprotein wza domain like 0.8005 110 200 3.10.560.10
ID Description Score Start End GO Terms
AF-K1WGD2-F1-model_v4 deleted 0.9699 28 104
AF-A0A2V7TPC8-F1-model_v4 Polysaccharide export protein N-terminal domain-containing protein 0.9627 28 105 GO:0015159
AF-A0A2W0A1E5-F1-model_v4 Polysaccharide export protein N-terminal domain-containing protein 0.962 30 100 GO:0015159
AF-A0A7Y6XX37-F1-model_v4 deleted 0.9418 201 277
AF-A0A538TZE1-F1-model_v4 Polysaccharide export protein N-terminal domain-containing protein 0.9344 27 102 GO:0015159

Map