F467631

General Info

Members Datasets Scaffolds Average Seq Length
597 249 1194 123

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101439733|Ga0070683_1014397332
Length 142
Sequence VTSPRKSVTALRFTVTDDDTAVAVGSGSLPVLGTPRLLAWCEAATCSEIEAALGEGETSVGTRVQLEHLAASPVGAEVEVTATTAYVDGRLRRFSVAARHTADGKVVASGEVTRVVVDGERFLSRISEPRTGLARTEKQRGD

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
130 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
131 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
134 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
135 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
136 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
137 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
138 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
139 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
140 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
141 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
142 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
143 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
144 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
150 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
161 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
215 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
228 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
231 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
232 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
233 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
236 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
237 2643221576 Nocardioides sp. Root614 Isolate Unclassified
238 2643221590 Nocardioides sp. Root682 Isolate Unclassified
239 2643221604 Nocardioides sp. Root190 Isolate Unclassified
240 2643221615 Nocardioides sp. Root224 Isolate Unclassified
241 2643221617 Nocardioides sp. Root79 Isolate Unclassified
242 2643221620 Nocardioides sp. Root240 Isolate Unclassified
243 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
244 2738541305 Nocardioides sp. CF167 Isolate Unclassified
245 2739367898 Nocardioides sp. CF479 Isolate Unclassified
246 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
247 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
248 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
249 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 0.34
Isolates 2.18

Biome Distribution

Category Percentage (%)
Aerial Root 0.34
Bulb 0
Endosphere 15.41
Nodule 0
Rhizoplane 12.06
Rhizosphere 66.67
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101439733 3300005329 Bacteria 662
2 Ga0070658_10027602 3300005327 Bacteria 4554
3 Ga0070658_10191059 3300005327 Bacteria 1726
4 Ga0070676_10433073 3300005328 Bacteria 921
5 Ga0070683_100019224 3300005329 Bacteria 6067
6 Ga0070683_100050301 3300005329 Bacteria 3858
7 Ga0070683_100051373 3300005329 Bacteria 3817
8 Ga0070683_102287501 3300005329 Bacteria 518
9 Ga0070670_100303976 3300005331 Bacteria 1396
10 Ga0070670_101982698 3300005331 Bacteria 536
11 Ga0068869_101571030 3300005334 Bacteria 585
12 Ga0070682_100076042 3300005337 Bacteria 2161
13 Ga0068868_100142321 3300005338 Bacteria 1970
14 Ga0070691_10109708 3300005341 Bacteria 1379
15 Ga0070687_100032940 3300005343 Bacteria 2554
16 Ga0070661_101811281 3300005344 Bacteria 518
17 Ga0070692_10048184 3300005345 Bacteria 2207
18 Ga0070692_10081983 3300005345 Bacteria 1739
19 Ga0070668_101218039 3300005347 Bacteria 682
20 Ga0070668_102048730 3300005347 Bacteria 528
21 Ga0070675_100135728 3300005354 Bacteria 2100
22 Ga0070659_100192009 3300005366 Bacteria 1679
23 Ga0070667_100356975 3300005367 Bacteria 1324
24 Ga0070700_100107067 3300005441 Bacteria 1852
25 Ga0070700_100282958 3300005441 Bacteria 1203
26 Ga0070700_100819267 3300005441 Bacteria 751
27 Ga0070663_100280232 3300005455 Bacteria 1328
28 Ga0070678_100070045 3300005456 Bacteria 2620
29 Ga0070662_101021569 3300005457 Bacteria 708
30 Ga0070681_10140826 3300005458 Bacteria 2342
31 Ga0070685_10174406 3300005466 Bacteria 1380
32 Ga0070685_10261464 3300005466 Bacteria 1151
33 Ga0070679_100014974 3300005530 Bacteria 7451
34 Ga0070679_101182165 3300005530 Bacteria 710
35 Ga0070684_100002700 3300005535 Bacteria 13104
36 Ga0070684_100553608 3300005535 Bacteria 1067
37 Ga0070684_100583617 3300005535 Bacteria 1039
38 Ga0070684_100637642 3300005535 Bacteria 991
39 Ga0068853_100772831 3300005539 Bacteria 919
40 Ga0070672_100513252 3300005543 Bacteria 1038
41 Ga0070665_100000877 3300005548 Bacteria 38753
42 Ga0070665_100423055 3300005548 Bacteria 1341
43 Ga0070665_100657533 3300005548 Bacteria 1061
44 Ga0070665_101159583 3300005548 Bacteria 784
45 Ga0070665_101298292 3300005548 Bacteria 738
46 Ga0070664_100537703 3300005564 Bacteria 1080
47 Ga0070664_100886459 3300005564 Bacteria 836
48 Ga0070664_101731282 3300005564 Bacteria 593
49 Ga0068857_102050413 3300005577 Bacteria 561
50 Ga0068854_100528354 3300005578 Bacteria 997
51 Ga0068856_100029166 3300005614 Bacteria 5390
52 Ga0068856_100545271 3300005614 Bacteria 1181
53 Ga0068856_100948216 3300005614 Bacteria 879
54 Ga0070702_100102669 3300005615 Bacteria 1757
55 Ga0070702_100159394 3300005615 Bacteria 1457
56 Ga0070702_100268666 3300005615 Bacteria 1165
57 Ga0070702_100902707 3300005615 Bacteria 692
58 Ga0068852_102273535 3300005616 Bacteria 563
59 Ga0068859_100416354 3300005617 Bacteria 1440
60 Ga0068864_100011843 3300005618 Bacteria 7204
61 Ga0068864_102601787 3300005618 Bacteria 512
62 Ga0068861_100283448 3300005719 Bacteria 1428
63 Ga0068870_10052666 3300005840 Bacteria 2159
64 Ga0068870_10961216 3300005840 Bacteria 607
65 Ga0068858_100558410 3300005842 Bacteria 1108
66 Ga0068860_100000301 3300005843 Bacteria 68703
67 Ga0081539_10008946 3300005985 Bacteria 8534
68 Ga0081539_10043147 3300005985 Bacteria 2618
69 Ga0081539_10048462 3300005985 Bacteria 2417
70 Ga0075365_10000189 3300006038 Bacteria 20092
71 Ga0075365_10002426 3300006038 Bacteria 9141
72 Ga0075365_10003128 3300006038 Bacteria 8429
73 Ga0075365_10006867 3300006038 Bacteria 6314
74 Ga0075365_10017442 3300006038 Bacteria 4392
75 Ga0075365_10023003 3300006038 Bacteria 3914
76 Ga0075365_10023672 3300006038 Bacteria 3865
77 Ga0075365_10088615 3300006038 Bacteria 2106
78 Ga0075365_10119948 3300006038 Bacteria 1813
79 Ga0075365_10165877 3300006038 Bacteria 1541
80 Ga0075365_10169534 3300006038 Bacteria 1523
81 Ga0075365_10238263 3300006038 Bacteria 1278
82 Ga0075365_10244046 3300006038 Bacteria 1261
83 Ga0075365_10272987 3300006038 Bacteria 1189
84 Ga0075365_10927135 3300006038 Bacteria 614
85 Ga0075368_10001269 3300006042 Bacteria 8002
86 Ga0075368_10027238 3300006042 Bacteria 2203
87 Ga0075368_10083519 3300006042 Bacteria 1301
88 Ga0075363_100006239 3300006048 Bacteria 5395
89 Ga0075363_100012273 3300006048 Bacteria 4126
90 Ga0075363_100024270 3300006048 Bacteria 3081
91 Ga0075363_100024913 3300006048 Bacteria 3045
92 Ga0075363_100059219 3300006048 Bacteria 2059
93 Ga0075363_100082559 3300006048 Bacteria 1759
94 Ga0075363_100091224 3300006048 Bacteria 1677
95 Ga0075363_100257604 3300006048 Bacteria 1006
96 Ga0075364_10024407 3300006051 Bacteria 3839
97 Ga0075364_10071859 3300006051 Bacteria 2280
98 Ga0075364_10080616 3300006051 Bacteria 2152
99 Ga0075364_10138594 3300006051 Bacteria 1635
100 Ga0075364_10187556 3300006051 Bacteria 1400
101 Ga0075364_10193180 3300006051 Bacteria 1379
102 Ga0075364_10206227 3300006051 Bacteria 1333
103 Ga0075364_11066054 3300006051 Bacteria 549
104 Ga0075432_10166161 3300006058 Bacteria 856
105 Ga0075362_10010907 3300006177 Bacteria 3565
106 Ga0075367_10004368 3300006178 Bacteria 6894
107 Ga0075367_10052366 3300006178 Bacteria 2416
108 Ga0075367_10114152 3300006178 Bacteria 1660
109 Ga0075367_10366298 3300006178 Bacteria 910
110 Ga0075367_10626855 3300006178 Bacteria 684
111 Ga0075367_10751573 3300006178 Bacteria 620
112 Ga0097621_100315323 3300006237 Bacteria 1384
113 Ga0075370_10012341 3300006353 Bacteria 4512
114 Ga0075370_10032874 3300006353 Bacteria 2902
115 Ga0075370_10179037 3300006353 Bacteria 1247
116 Ga0075370_10807803 3300006353 Bacteria 572
117 Ga0068871_100128495 3300006358 Bacteria 2147
118 Ga0075434_100419664 3300006871 Bacteria 1359
119 Ga0068865_100061445 3300006881 Bacteria 2634
120 Ga0068865_100154801 3300006881 Bacteria 1742
121 Ga0068865_100917552 3300006881 Bacteria 762
122 Ga0068865_102025385 3300006881 Bacteria 523
123 Ga0097620_100416264 3300006931 Bacteria 1440
124 Ga0075435_101178022 3300007076 Bacteria 670
125 Ga0111539_10191167 3300009094 Bacteria 2389
126 Ga0105245_10001875 3300009098 Bacteria 19079
127 Ga0105247_10914485 3300009101 Bacteria 679
128 Ga0105247_11459538 3300009101 Bacteria 556
129 Ga0105243_10041344 3300009148 Bacteria 3606
130 Ga0105243_10064495 3300009148 Bacteria 2940
131 Ga0105243_10353630 3300009148 Bacteria 1350
132 Ga0105243_10510943 3300009148 Bacteria 1141
133 Ga0105248_10284289 3300009177 Bacteria 1862
134 Ga0105249_10086207 3300009553 Bacteria 2928
135 Ga0105249_10220155 3300009553 Bacteria 1867
136 Ga0105249_10243438 3300009553 Bacteria 1779
137 Ga0105249_13275994 3300009553 Bacteria 521
138 Ga0105239_10006772 3300010375 Bacteria 13230
139 Ga0105246_10000332 3300011119 Bacteria 25139
140 Ga0105246_10310636 3300011119 Bacteria 1277
141 Ga0157374_10667862 3300013296 Bacteria 1051
142 Ga0163162_10350189 3300013306 Bacteria 1610
143 Ga0157372_10296624 3300013307 Bacteria 1880
144 Ga0157372_11921240 3300013307 Bacteria 680
145 Ga0157375_10092611 3300013308 Bacteria 3086
146 Ga0157375_10240501 3300013308 Bacteria 1970
147 Ga0157375_11305254 3300013308 Bacteria 853
148 Ga0157375_12820239 3300013308 Bacteria 581
149 Ga0163163_10028616 3300014325 Bacteria 5354
150 Ga0163163_10065609 3300014325 Bacteria 3604
151 Ga0163163_11753234 3300014325 Bacteria 681
152 Ga0157380_11371327 3300014326 Bacteria 757
153 Ga0157380_12861959 3300014326 Bacteria 549
154 Ga0157379_10002556 3300014968 Bacteria 15266
155 Ga0157379_12634205 3300014968 Bacteria 504
156 Ga0163161_10014421 3300017792 Bacteria 5502
157 Ga0163161_10145355 3300017792 Bacteria 1798
158 Ga0163161_12101892 3300017792 Bacteria 502
159 Ga0206354_10493325 3300020081 Bacteria 612
160 Ga0206354_11458792 3300020081 Bacteria 739
161 Ga0207642_10084224 3300025899 Bacteria 1552
162 Ga0207642_10455211 3300025899 Bacteria 776
163 Ga0207688_10013563 3300025901 Bacteria 4430
164 Ga0207647_10011261 3300025904 Bacteria 6278
165 Ga0207647_10034403 3300025904 Bacteria 3235
166 Ga0207643_10065903 3300025908 Bacteria 2076
167 Ga0207705_10081096 3300025909 Bacteria 2365
168 Ga0207707_10080592 3300025912 Bacteria 2843
169 Ga0207660_10178317 3300025917 Bacteria 1649
170 Ga0207662_10038177 3300025918 Bacteria 2813
171 Ga0207652_10061867 3300025921 Bacteria 3234
172 Ga0207652_10847595 3300025921 Bacteria 809
173 Ga0207694_10955936 3300025924 Bacteria 725
174 Ga0207694_11494084 3300025924 Bacteria 570
175 Ga0207659_10829616 3300025926 Bacteria 795
176 Ga0207687_10008754 3300025927 Bacteria 6614
177 Ga0207687_10320931 3300025927 Bacteria 1254
178 Ga0207687_10715263 3300025927 Bacteria 851
179 Ga0207690_11702495 3300025932 Bacteria 527
180 Ga0207706_11238658 3300025933 Bacteria 619
181 Ga0207709_10155229 3300025935 Bacteria 1590
182 Ga0207709_10366912 3300025935 Bacteria 1092
183 Ga0207670_10048577 3300025936 Bacteria 2833
184 Ga0207669_10495194 3300025937 Bacteria 977
185 Ga0207704_10254474 3300025938 Bacteria 1320
186 Ga0207704_10539757 3300025938 Bacteria 946
187 Ga0207704_10595885 3300025938 Bacteria 904
188 Ga0207704_10856647 3300025938 Bacteria 762
189 Ga0207704_11767804 3300025938 Bacteria 532
190 Ga0207691_10185473 3300025940 Bacteria 1816
191 Ga0207691_10256810 3300025940 Bacteria 1507
192 Ga0207689_10096284 3300025942 Bacteria 2431
193 Ga0207661_10059525 3300025944 Bacteria 3078
194 Ga0207661_10179793 3300025944 Bacteria 1847
195 Ga0207661_10810092 3300025944 Bacteria 862
196 Ga0207661_10819562 3300025944 Bacteria 857
197 Ga0207661_11066572 3300025944 Bacteria 744
198 Ga0207679_10130051 3300025945 Bacteria 2018
199 Ga0207679_10656756 3300025945 Bacteria 949
200 Ga0207651_11318134 3300025960 Bacteria 649
201 Ga0207712_10060317 3300025961 Bacteria 2689
202 Ga0207712_11084000 3300025961 Bacteria 713
203 Ga0207668_11007549 3300025972 Bacteria 745
204 Ga0207658_10298753 3300025986 Bacteria 1386
205 Ga0207677_10936478 3300026023 Bacteria 783
206 Ga0207703_10658854 3300026035 Bacteria 993
207 Ga0207639_10433358 3300026041 Bacteria 1191
208 Ga0207708_10167844 3300026075 Bacteria 1736
209 Ga0207708_10315582 3300026075 Bacteria 1274
210 Ga0207702_10038554 3300026078 Bacteria 4001
211 Ga0207702_10214386 3300026078 Bacteria 1791
212 Ga0207676_10074186 3300026095 Bacteria 2740
213 Ga0207676_11779705 3300026095 Bacteria 615
214 Ga0207674_10659236 3300026116 Bacteria 1011
215 Ga0207675_100024205 3300026118 Bacteria 5646
216 Ga0207683_11072183 3300026121 Bacteria 747
217 Ga0207698_11016838 3300026142 Bacteria 840
218 Ga0207698_11404949 3300026142 Bacteria 713
219 Ga0209813_10035339 3300027866 Bacteria 1496
220 Ga0207428_10195820 3300027907 Bacteria 1522
221 Ga0268266_10006138 3300028379 Bacteria 11059
222 Ga0268266_10866825 3300028379 Bacteria 873
223 Ga0268264_10000269 3300028381 Bacteria 91321
224 Ga0307515_10164094 3300028794 Bacteria 2249
225 Ga0307515_10341741 3300028794 Bacteria 1149
226 Ga0265340_10001488 3300031247 Bacteria 13428
227 Ga0307513_10000149 3300031456 Bacteria 99930
228 Ga0307513_10855213 3300031456 Bacteria 616
229 Ga0316579_10000149 3300031691 Bacteria 19674
230 Ga0307405_10106433 3300031731 Bacteria 1892
231 Ga0307405_10454872 3300031731 Bacteria 1016
232 Ga0307413_10116769 3300031824 Bacteria 1799
233 Ga0307413_10609570 3300031824 Bacteria 895
234 Ga0307410_10107313 3300031852 Bacteria 2014
235 Ga0307410_10257344 3300031852 Bacteria 1360
236 Ga0307410_10829865 3300031852 Bacteria 788
237 Ga0307410_11128219 3300031852 Bacteria 681
238 Ga0307406_10417671 3300031901 Bacteria 1068
239 Ga0307406_10955464 3300031901 Bacteria 733
240 Ga0307407_10193137 3300031903 Bacteria 1359
241 Ga0307407_10552874 3300031903 Bacteria 851
242 Ga0307407_10826744 3300031903 Bacteria 706
243 Ga0307407_11717880 3300031903 Bacteria 500
244 Ga0307412_10366765 3300031911 Bacteria 1161
245 Ga0307412_10425090 3300031911 Bacteria 1088
246 Ga0307409_100013627 3300031995 Bacteria 5245
247 Ga0307409_100051735 3300031995 Bacteria 3145
248 Ga0307409_100254323 3300031995 Bacteria 1608
249 Ga0307409_100500130 3300031995 Bacteria 1184
250 Ga0307416_100568016 3300032002 Bacteria 1210
251 Ga0307416_101350004 3300032002 Bacteria 819
252 Ga0307416_101403686 3300032002 Bacteria 804
253 Ga0307416_102202467 3300032002 Bacteria 652
254 Ga0307416_103048610 3300032002 Bacteria 560
255 Ga0307414_10507897 3300032004 Bacteria 1068
256 Ga0307414_11161853 3300032004 Bacteria 714
257 Ga0307411_10249207 3300032005 Bacteria 1395
258 Ga0307411_10308290 3300032005 Bacteria 1273
259 Ga0307411_10597158 3300032005 Bacteria 949
260 Ga0307411_10753928 3300032005 Bacteria 853
261 Ga0307411_11444200 3300032005 Bacteria 631
262 Ga0307415_100001214 3300032126 Bacteria 12076
263 Ga0307415_100022177 3300032126 Bacteria 3915
264 Ga0307415_100107087 3300032126 Bacteria 2065
265 Ga0307415_100716195 3300032126 Bacteria 905
266 Ga0307415_101509591 3300032126 Bacteria 643
267 Ga0395900_0542831 3300037418 Bacteria 1108
268 Ga0395905_1536847 3300037471 Bacteria 570
269 Ga0395905_1840891 3300037471 Bacteria 511
270 Ga0395901_0082341 3300038443 Bacteria 3362
271 Ga0395901_0434745 3300038443 Bacteria 1344
272 Ga0395901_0614704 3300038443 Bacteria 1094
273 Ga0400485_01414 3300038735 Bacteria 113112
274 Ga0400488_21897 3300038741 Bacteria 3392
275 Ga0400486_23067 3300038742 Bacteria 58321
276 Ga0436365_1820305 3300039437 Bacteria 1630
277 Ga0439461_0193443 3300041410 Bacteria 544
278 Ga0451791_0590008 3300041451 Bacteria 538
279 Ga0451791_1734020 3300041451 Bacteria 903
280 Ga0451793_0092524 3300041452 Bacteria 634
281 Ga0451797_0414131 3300041453 Bacteria 888
282 Ga0451795_0235003 3300041456 Bacteria 510
283 Ga0451800_0119237 3300041459 Bacteria 653
284 Ga0451802_2075214 3300041460 Bacteria 698
285 Ga0451802_2090143 3300041460 Bacteria 560
286 Ga0451833_0164527 3300041491 Bacteria 1311
287 Ga0451833_0422870 3300041491 Unclassified 783
288 Ga0451837_0901888 3300041494 Bacteria 802
289 Ga0451841_0285562 3300041498 Bacteria 2639
290 Ga0451841_0472516 3300041498 Bacteria 550
291 Ga0451841_1105273 3300041498 Bacteria 928
292 Ga0451849_0563043 3300041505 Bacteria 664
293 Ga0451849_0834527 3300041505 Unclassified 1298
294 Ga0451849_1275582 3300041505 Bacteria 553
295 Ga0451843_0593688 3300041509 Bacteria 2682
296 Ga0451843_1113644 3300041509 Bacteria 503
297 Ga0451853_1708812 3300041512 Bacteria 892
298 Ga0451853_2609276 3300041512 Bacteria 2235
299 Ga0466972_0041765 3300044658 Bacteria 2232
300 Ga0466965_0045772 3300044683 Bacteria 2165
301 Ga0466965_0845207 3300044683 Bacteria 532
302 Ga0466966_0153452 3300044684 Bacteria 1404
303 Ga0466966_0649768 3300044684 Bacteria 635
304 Ga0466963_0056636 3300044694 Bacteria 2609
305 Ga0466963_0293383 3300044694 Bacteria 1143
306 Ga0466963_0953311 3300044694 Bacteria 604
307 Ga0466964_0005552 3300044706 Bacteria 4684
308 Ga0466964_0122326 3300044706 Bacteria 1175
309 Ga0466971_0339836 3300044719 Bacteria 725
310 Ga0466971_0606818 3300044719 Bacteria 546
311 Ga0466968_0116724 3300044735 Bacteria 1205
312 Ga0466968_0130593 3300044735 Bacteria 1143
313 Ga0466970_0033861 3300044765 Bacteria 2702
314 Ga0466970_0033930 3300044765 Bacteria 2699
315 Ga0466970_0098940 3300044765 Bacteria 1588
316 Ga0466970_0194671 3300044765 Bacteria 1127
317 Ga0466970_0631744 3300044765 Bacteria 622
318 Ga0466957_0434370 3300044842 Bacteria 902
319 Ga0466960_0026531 3300044901 Bacteria 2633
320 Ga0466960_0055296 3300044901 Bacteria 1930
321 Ga0466960_0137027 3300044901 Bacteria 1297
322 Ga0466960_0738966 3300044901 Bacteria 592
323 Ga0466960_0752142 3300044901 Bacteria 587
324 Ga0466959_0158450 3300045049 Bacteria 1592
325 Ga0466958_0148813 3300045836 Bacteria 1476
326 Ga0466967_0031503 3300045976 Bacteria 4464
327 Ga0466967_0086920 3300045976 Bacteria 2833
328 Ga0466967_0286249 3300045976 Bacteria 1582
329 Ga0466967_0298553 3300045976 Bacteria 1549
330 Ga0466967_0326824 3300045976 Bacteria 1480
331 Ga0466967_0739526 3300045976 Bacteria 975
332 Ga0466967_1540245 3300045976 Bacteria 662
333 Ga0466967_1596766 3300045976 Bacteria 650
334 Ga0495603_0131281 3300046455 Bacteria 1459
335 Ga0495638_0038896 3300046460 Bacteria 3021
336 Ga0495608_0805207 3300046511 Bacteria 554
337 Ga0495640_0423977 3300046533 Bacteria 815
338 Ga0495657_0584918 3300046675 Bacteria 647
339 Ga0495686_0196812 3300047472 Bacteria 1158
340 Ga0496100_0312043 3300048903 Bacteria 1179
341 Ga0496101_0016073 3300048904 Bacteria 5052
342 Ga0496101_0077725 3300048904 Bacteria 2446
343 Ga0496101_0138855 3300048904 Bacteria 1851
344 Ga0496101_1564495 3300048904 Bacteria 513
345 Ga0496102_0009370 3300048905 Bacteria 8411
346 Ga0496102_0151073 3300048905 Bacteria 2182
347 Ga0496102_0845640 3300048905 Bacteria 837
348 Ga0496103_0020455 3300048906 Bacteria 3975
349 Ga0496103_0076275 3300048906 Bacteria 2103
350 Ga0496103_0632507 3300048906 Bacteria 681
351 Ga0496104_0832040 3300048907 Bacteria 829
352 Ga0496104_0842348 3300048907 Bacteria 822
353 Ga0496104_1138538 3300048907 Bacteria 684
354 Ga0496105_0176748 3300048908 Bacteria 1748
355 Ga0496105_0971283 3300048908 Bacteria 637
356 Ga0496106_0200963 3300048909 Bacteria 1586
357 Ga0496106_0227118 3300048909 Bacteria 1490
358 Ga0496106_0308591 3300048909 Bacteria 1269
359 Ga0496107_0044083 3300048910 Bacteria 3206
360 Ga0496107_0207807 3300048910 Bacteria 1455
361 Ga0496107_0948853 3300048910 Bacteria 626
362 Ga0496108_0026911 3300048911 Bacteria 4746
363 Ga0496108_0139999 3300048911 Bacteria 2084
364 Ga0496108_0258816 3300048911 Bacteria 1514
365 Ga0496108_0342137 3300048911 Bacteria 1305
366 Ga0496108_0344778 3300048911 Bacteria 1300
367 Ga0496108_0394908 3300048911 Bacteria 1208
368 Ga0496108_0913519 3300048911 Bacteria 753
369 Ga0496109_0008290 3300048912 Bacteria 8822
370 Ga0496109_0022947 3300048912 Bacteria 5532
371 Ga0496109_0079990 3300048912 Bacteria 3011
372 Ga0496109_0172532 3300048912 Bacteria 2029
373 Ga0496109_0451995 3300048912 Bacteria 1213
374 Ga0496109_0885889 3300048912 Bacteria 830
375 Ga0496110_0001726 3300048913 Bacteria 16096
376 Ga0496110_0081685 3300048913 Bacteria 2881
377 Ga0496110_0217441 3300048913 Bacteria 1738
378 Ga0496110_0290639 3300048913 Bacteria 1489
379 Ga0496110_0645517 3300048913 Bacteria 958
380 Ga0496110_1006849 3300048913 Bacteria 741
381 Ga0496110_1412671 3300048913 Bacteria 605
382 Ga0496111_0011123 3300048914 Bacteria 6057
383 Ga0496111_0012422 3300048914 Bacteria 5765
384 Ga0496111_0069923 3300048914 Bacteria 2553
385 Ga0496111_0458750 3300048914 Bacteria 940
386 Ga0496111_0957848 3300048914 Bacteria 614
387 Ga0496112_0343404 3300048915 Bacteria 1436
388 Ga0496112_0550270 3300048915 Bacteria 1088
389 Ga0496113_0199269 3300048916 Bacteria 1591
390 Ga0496113_0437637 3300048916 Bacteria 1050
391 Ga0496113_0439640 3300048916 Bacteria 1048
392 Ga0496113_0641466 3300048916 Bacteria 849
393 Ga0496113_0877857 3300048916 Bacteria 710
394 Ga0496113_1320122 3300048916 Bacteria 561
395 Ga0496114_0014328 3300048917 Bacteria 6361
396 Ga0496114_0031998 3300048917 Bacteria 4328
397 Ga0496114_0035945 3300048917 Bacteria 4093
398 Ga0496114_0063780 3300048917 Bacteria 3085
399 Ga0496114_0114287 3300048917 Bacteria 2315
400 Ga0496114_0309168 3300048917 Bacteria 1396
401 Ga0496114_0673267 3300048917 Bacteria 909
402 Ga0496115_0032997 3300048918 Bacteria 4086
403 Ga0496115_0046864 3300048918 Bacteria 3456
404 Ga0496124_0394383 3300048927 Bacteria 963
405 Ga0501031_0349270 3300049568 Bacteria 957
406 Ga0501031_0367345 3300049568 Bacteria 931
407 Ga0501031_0953951 3300049568 Bacteria 548
408 Ga0501032_0133418 3300049569 Bacteria 1637
409 Ga0501034_0034026 3300049571 Bacteria 5167
410 Ga0501034_0384793 3300049571 Bacteria 1327
411 Ga0501036_0013225 3300049572 Bacteria 6854
412 Ga0501036_0116086 3300049572 Bacteria 2261
413 Ga0501036_0204005 3300049572 Bacteria 1663
414 Ga0501036_0767250 3300049572 Bacteria 795
415 Ga0501037_0086595 3300049573 Bacteria 2268
416 Ga0501037_0155260 3300049573 Bacteria 1634
417 Ga0501038_0137223 3300049574 Bacteria 2003
418 Ga0501038_0174789 3300049574 Bacteria 1736
419 Ga0501038_0197017 3300049574 Bacteria 1619
420 Ga0501038_0218784 3300049574 Bacteria 1520
421 Ga0501039_0011693 3300049575 Bacteria 6687
422 Ga0501039_0076303 3300049575 Bacteria 2606
423 Ga0501039_0113969 3300049575 Bacteria 2115
424 Ga0501039_0240007 3300049575 Bacteria 1425
425 Ga0501039_0691962 3300049575 Bacteria 797
426 Ga0501040_0052653 3300049576 Bacteria 2787
427 Ga0501040_0053884 3300049576 Bacteria 2756
428 Ga0501040_0521718 3300049576 Bacteria 857
429 Ga0501040_1245569 3300049576 Bacteria 540
430 Ga0501041_0052190 3300049577 Bacteria 2493
431 Ga0501041_0104559 3300049577 Bacteria 1754
432 Ga0501041_0150998 3300049577 Bacteria 1451
433 Ga0501042_0028993 3300049578 Bacteria 3903
434 Ga0501042_0210964 3300049578 Bacteria 1401
435 Ga0501042_1247801 3300049578 Bacteria 542
436 Ga0501043_0288008 3300049579 Bacteria 1258
437 Ga0501046_0238152 3300049580 Bacteria 1343
438 Ga0501046_0294996 3300049580 Bacteria 1185
439 Ga0501046_0445098 3300049580 Bacteria 932
440 Ga0501046_0609653 3300049580 Bacteria 774
441 Ga0501047_0905245 3300049581 Bacteria 696
442 Ga0501048_0035838 3300049582 Bacteria 3568
443 Ga0501048_0161727 3300049582 Bacteria 1585
444 Ga0501048_0491863 3300049582 Bacteria 879
445 Ga0501048_0517937 3300049582 Bacteria 855
446 Ga0501048_0725407 3300049582 Bacteria 714
447 Ga0501067_0000678 3300049583 Bacteria 18332
448 Ga0501067_0026564 3300049583 Bacteria 3207
449 Ga0501067_0064629 3300049583 Bacteria 2026
450 Ga0501067_0076503 3300049583 Bacteria 1854
451 Ga0501067_0343286 3300049583 Bacteria 832
452 Ga0501068_0009091 3300049584 Bacteria 5546
453 Ga0501068_0043105 3300049584 Bacteria 2714
454 Ga0501068_0091329 3300049584 Bacteria 1879
455 Ga0501068_0099126 3300049584 Bacteria 1805
456 Ga0501068_0146914 3300049584 Bacteria 1480
457 Ga0501069_0028702 3300049585 Bacteria 3051
458 Ga0501069_0079304 3300049585 Bacteria 1848
459 Ga0501069_0412976 3300049585 Bacteria 799
460 Ga0501069_0448836 3300049585 Bacteria 766
461 Ga0501069_0955435 3300049585 Bacteria 522
462 Ga0501070_0008976 3300049586 Bacteria 8456
463 Ga0501070_0143072 3300049586 Bacteria 1974
464 Ga0501070_1176969 3300049586 Bacteria 589
465 Ga0501070_1474379 3300049586 Bacteria 515
466 Ga0501071_0004517 3300049587 Bacteria 8824
467 Ga0501071_0017020 3300049587 Bacteria 5006
468 Ga0501071_0043833 3300049587 Bacteria 3209
469 Ga0501071_0204459 3300049587 Bacteria 1484
470 Ga0501071_0474212 3300049587 Bacteria 959
471 Ga0501072_0023720 3300049588 Bacteria 4766
472 Ga0501072_0042154 3300049588 Bacteria 3585
473 Ga0501072_0086300 3300049588 Bacteria 2491
474 Ga0501072_0107204 3300049588 Bacteria 2222
475 Ga0501072_0155161 3300049588 Bacteria 1826
476 Ga0501072_0218770 3300049588 Bacteria 1518
477 Ga0501072_1593662 3300049588 Bacteria 503
478 Ga0501073_0001258 3300049589 Bacteria 18570
479 Ga0501073_0017190 3300049589 Bacteria 5238
480 Ga0501074_0003132 3300049590 Bacteria 11665
481 Ga0501074_0027443 3300049590 Bacteria 4128
482 Ga0501074_0053497 3300049590 Bacteria 2912
483 Ga0501074_0447708 3300049590 Bacteria 916
484 Ga0501074_0538553 3300049590 Bacteria 827
485 Ga0501075_0073118 3300049591 Bacteria 2592
486 Ga0501075_0126766 3300049591 Bacteria 1944
487 Ga0501075_0250142 3300049591 Bacteria 1351
488 Ga0501075_0554110 3300049591 Bacteria 877
489 Ga0501076_0233995 3300049592 Bacteria 1502
490 Ga0501076_0459823 3300049592 Bacteria 1048
491 Ga0501076_0494357 3300049592 Bacteria 1008
492 Ga0501077_0025256 3300049593 Bacteria 3773
493 Ga0501077_0075523 3300049593 Bacteria 2134
494 Ga0501077_0201711 3300049593 Bacteria 1264
495 Ga0501079_0006191 3300049741 Bacteria 8979
496 Ga0501079_0011363 3300049741 Bacteria 6795
497 Ga0501079_0055273 3300049741 Bacteria 3063
498 Ga0501079_0109989 3300049741 Bacteria 2141
499 Ga0501079_1105351 3300049741 Bacteria 625
500 Ga0501079_1222221 3300049741 Bacteria 592
501 Ga0501079_1316305 3300049741 Bacteria 569
502 Ga0501080_0004291 3300049742 Bacteria 12654
503 Ga0501080_0085329 3300049742 Bacteria 2934
504 Ga0501080_0218297 3300049742 Bacteria 1745
505 Ga0501080_0357210 3300049742 Bacteria 1319
506 Ga0501080_0440019 3300049742 Bacteria 1170
507 Ga0501080_0901398 3300049742 Bacteria 771
508 Ga0501081_0836524 3300049743 Bacteria 693
509 Ga0501081_1049491 3300049743 Bacteria 616
510 Ga0501081_1128260 3300049743 Bacteria 593
511 Ga0501083_0013713 3300049744 Bacteria 5669
512 Ga0501083_0028972 3300049744 Bacteria 3813
513 Ga0501083_1105936 3300049744 Bacteria 516
514 Ga0501035_0290813 3300049822 Bacteria 1379
515 Ga0501035_0598509 3300049822 Bacteria 899
516 Ga0501044_0948766 3300049823 Bacteria 733
517 Ga0501045_0028401 3300049824 Bacteria 4036
518 Ga0501045_0301849 3300049824 Bacteria 1192
519 Ga0501045_0997329 3300049824 Bacteria 614
520 Ga0501045_1050644 3300049824 Bacteria 596
521 nmdc:mga03683_315982_c1 3300050489 Bacteria 735
522 nmdc:mga03n38_107546_c1 3300050490 Bacteria 1354
523 nmdc:mga03n38_160386_c1 3300050490 Bacteria 1138
524 nmdc:mga03n38_189074_c1 3300050490 Bacteria 1060
525 nmdc:mga03n38_65887_c1 3300050490 Bacteria 1662
526 nmdc:mga03n38_92701_c2 3300050490 Bacteria 775
527 nmdc:mga00v17_122321_c1 3300050491 Bacteria 1658
528 nmdc:mga00v17_219823_c1 3300050491 Bacteria 1230
529 nmdc:mga00v17_263200_c1 3300050491 Bacteria 1119
530 nmdc:mga00v17_292485_c1 3300050491 Bacteria 1058
531 nmdc:mga00v17_478150_c1 3300050491 Bacteria 808
532 nmdc:mga00v17_52519_c1 3300050491 Bacteria 2480
533 nmdc:mga00v17_738691_c1 3300050491 Bacteria 630
534 nmdc:mga0yw44_1013748_c1 3300050492 Bacteria 562
535 nmdc:mga0yw44_101841_c1 3300050492 Bacteria 1830
536 nmdc:mga0yw44_150419_c1 3300050492 Bacteria 1518
537 nmdc:mga0yw44_154457_c1 3300050492 Bacteria 1499
538 nmdc:mga0yw44_172278_c1 3300050492 Bacteria 1422
539 nmdc:mga0yw44_179133_c1 3300050492 Bacteria 1394
540 nmdc:mga0yw44_348606_c1 3300050492 Bacteria 997
541 nmdc:mga0yw44_35464_c1 3300050492 Bacteria 2932
542 nmdc:mga0yw44_456272_c1 3300050492 Bacteria 866
543 nmdc:mga0yw44_60010_c1 3300050492 Bacteria 2329
544 nmdc:mga0yw44_64836_c1 3300050492 Bacteria 2249
545 nmdc:mga0yw44_681150_c1 3300050492 Bacteria 699
546 nmdc:mga0yw44_754595_c1 3300050492 Bacteria 661
547 nmdc:mga0yw44_763_c1 3300050492 Bacteria 11926
548 nmdc:mga0yw44_96103_c1 3300050492 Bacteria 1880
549 nmdc:mga06z11_14916_c1 3300050494 Bacteria 3455
550 nmdc:mga06z11_26300_c1 3300050494 Bacteria 2768
551 nmdc:mga06z11_338446_c1 3300050494 Bacteria 899
552 nmdc:mga06z11_778270_c1 3300050494 Bacteria 583
553 nmdc:mga06z11_85299_c1 3300050494 Bacteria 1703
554 nmdc:mga06z11_857353_c1 3300050494 Bacteria 553
555 nmdc:mga04h51_57371_c1 3300050495 Bacteria 1325
556 nmdc:mga07m45_176900_c1 3300050496 Bacteria 1241
557 nmdc:mga07m45_183205_c1 3300050496 Bacteria 1218
558 nmdc:mga07m45_679226_c1 3300050496 Bacteria 593
559 nmdc:mga08y16_475167_c1 3300050511 Bacteria 1272
560 nmdc:mga08y16_71619_c1 3300050511 Bacteria 3612
561 nmdc:mga08x19_309300_c1 3300050514 Bacteria 1098
562 nmdc:mga0sz30_544721_c1 3300050516 Bacteria 523
563 Ga0495601_0795284 3300053077 Bacteria 601
564 Ga0495655_0170593 3300053083 Bacteria 696
565 Ga0495619_0272112 3300053085 Bacteria 1174
566 Ga0500641_0271876 3300053096 Bacteria 705
567 Ga0500554_215284 3300053102 Bacteria 640
568 Ga0500556_0000643 3300053104 Bacteria 21878
569 Ga0500594_0196708 3300053118 Bacteria 661
570 Ga0500573_0048870 3300053140 Bacteria 2435
571 Ga0500616_0001823 3300053153 Bacteria 19306
572 Ga0500627_0269531 3300053158 Bacteria 750
573 Ga0501084_0070803 3300054114 Bacteria 2919
574 Ga0501084_0412479 3300054114 Bacteria 1141
575 Ga0501084_0464519 3300054114 Bacteria 1070
576 Ga0501084_1175864 3300054114 Bacteria 643
577 Ga0501082_0046326 3300060353 Bacteria 3748
578 Ga0501082_0107074 3300060353 Bacteria 2418
579 Ga0501082_0135742 3300060353 Bacteria 2135
580 Ga0530510_0134774 3300061734 Bacteria 1818
581 Ga0530510_0275104 3300061734 Bacteria 1257
582 Ga0530510_0339481 3300061734 Bacteria 1128
583 Ga0530510_0398117 3300061734 Bacteria 1038
584 Ga0530510_0582699 3300061734 Bacteria 850
585 2643889209 2643221576 Bacteria 5214352
586 2643958264 2643221590 Bacteria 5214697
587 2644036446 2643221604 Bacteria 5014917
588 2644090696 2643221615 Bacteria 5487866
589 2644099117 2643221617 Bacteria 5139111
590 2644114998 2643221620 Bacteria 5134593
591 2644320500 2643221657 Bacteria 5490246
592 2738867834 2738541305 Bacteria 4910150
593 2740167605 2739367898 Bacteria 4367674
594 2812332157 2811994874 Bacteria 5367947
595 2855390702 2855386786 Bacteria 4752232
596 2984576893 2984576629 Bacteria 4248407
597 2990258641 2990256926 Bacteria 4252839
598 Ga0070683_101439733
599 Ga0070658_10027602
600 Ga0070658_10191059
601 Ga0070676_10433073
602 Ga0070683_100019224
603 Ga0070683_100050301
604 Ga0070683_100051373
605 Ga0070683_102287501
606 Ga0070670_100303976
607 Ga0070670_101982698
608 Ga0068869_101571030
609 Ga0070682_100076042
610 Ga0068868_100142321
611 Ga0070691_10109708
612 Ga0070687_100032940
613 Ga0070661_101811281
614 Ga0070692_10048184
615 Ga0070692_10081983
616 Ga0070668_101218039
617 Ga0070668_102048730
618 Ga0070675_100135728
619 Ga0070659_100192009
620 Ga0070667_100356975
621 Ga0070700_100107067
622 Ga0070700_100282958
623 Ga0070700_100819267
624 Ga0070663_100280232
625 Ga0070678_100070045
626 Ga0070662_101021569
627 Ga0070681_10140826
628 Ga0070685_10174406
629 Ga0070685_10261464
630 Ga0070679_100014974
631 Ga0070679_101182165
632 Ga0070684_100002700
633 Ga0070684_100553608
634 Ga0070684_100583617
635 Ga0070684_100637642
636 Ga0068853_100772831
637 Ga0070672_100513252
638 Ga0070665_100000877
639 Ga0070665_100423055
640 Ga0070665_100657533
641 Ga0070665_101159583
642 Ga0070665_101298292
643 Ga0070664_100537703
644 Ga0070664_100886459
645 Ga0070664_101731282
646 Ga0068857_102050413
647 Ga0068854_100528354
648 Ga0068856_100029166
649 Ga0068856_100545271
650 Ga0068856_100948216
651 Ga0070702_100102669
652 Ga0070702_100159394
653 Ga0070702_100268666
654 Ga0070702_100902707
655 Ga0068852_102273535
656 Ga0068859_100416354
657 Ga0068864_100011843
658 Ga0068864_102601787
659 Ga0068861_100283448
660 Ga0068870_10052666
661 Ga0068870_10961216
662 Ga0068858_100558410
663 Ga0068860_100000301
664 Ga0081539_10008946
665 Ga0081539_10043147
666 Ga0081539_10048462
667 Ga0075365_10000189
668 Ga0075365_10002426
669 Ga0075365_10003128
670 Ga0075365_10006867
671 Ga0075365_10017442
672 Ga0075365_10023003
673 Ga0075365_10023672
674 Ga0075365_10088615
675 Ga0075365_10119948
676 Ga0075365_10165877
677 Ga0075365_10169534
678 Ga0075365_10238263
679 Ga0075365_10244046
680 Ga0075365_10272987
681 Ga0075365_10927135
682 Ga0075368_10001269
683 Ga0075368_10027238
684 Ga0075368_10083519
685 Ga0075363_100006239
686 Ga0075363_100012273
687 Ga0075363_100024270
688 Ga0075363_100024913
689 Ga0075363_100059219
690 Ga0075363_100082559
691 Ga0075363_100091224
692 Ga0075363_100257604
693 Ga0075364_10024407
694 Ga0075364_10071859
695 Ga0075364_10080616
696 Ga0075364_10138594
697 Ga0075364_10187556
698 Ga0075364_10193180
699 Ga0075364_10206227
700 Ga0075364_11066054
701 Ga0075432_10166161
702 Ga0075362_10010907
703 Ga0075367_10004368
704 Ga0075367_10052366
705 Ga0075367_10114152
706 Ga0075367_10366298
707 Ga0075367_10626855
708 Ga0075367_10751573
709 Ga0097621_100315323
710 Ga0075370_10012341
711 Ga0075370_10032874
712 Ga0075370_10179037
713 Ga0075370_10807803
714 Ga0068871_100128495
715 Ga0075434_100419664
716 Ga0068865_100061445
717 Ga0068865_100154801
718 Ga0068865_100917552
719 Ga0068865_102025385
720 Ga0097620_100416264
721 Ga0075435_101178022
722 Ga0111539_10191167
723 Ga0105245_10001875
724 Ga0105247_10914485
725 Ga0105247_11459538
726 Ga0105243_10041344
727 Ga0105243_10064495
728 Ga0105243_10353630
729 Ga0105243_10510943
730 Ga0105248_10284289
731 Ga0105249_10086207
732 Ga0105249_10220155
733 Ga0105249_10243438
734 Ga0105249_13275994
735 Ga0105239_10006772
736 Ga0105246_10000332
737 Ga0105246_10310636
738 Ga0157374_10667862
739 Ga0163162_10350189
740 Ga0157372_10296624
741 Ga0157372_11921240
742 Ga0157375_10092611
743 Ga0157375_10240501
744 Ga0157375_11305254
745 Ga0157375_12820239
746 Ga0163163_10028616
747 Ga0163163_10065609
748 Ga0163163_11753234
749 Ga0157380_11371327
750 Ga0157380_12861959
751 Ga0157379_10002556
752 Ga0157379_12634205
753 Ga0163161_10014421
754 Ga0163161_10145355
755 Ga0163161_12101892
756 Ga0206354_10493325
757 Ga0206354_11458792
758 Ga0207642_10084224
759 Ga0207642_10455211
760 Ga0207688_10013563
761 Ga0207647_10011261
762 Ga0207647_10034403
763 Ga0207643_10065903
764 Ga0207705_10081096
765 Ga0207707_10080592
766 Ga0207660_10178317
767 Ga0207662_10038177
768 Ga0207652_10061867
769 Ga0207652_10847595
770 Ga0207694_10955936
771 Ga0207694_11494084
772 Ga0207659_10829616
773 Ga0207687_10008754
774 Ga0207687_10320931
775 Ga0207687_10715263
776 Ga0207690_11702495
777 Ga0207706_11238658
778 Ga0207709_10155229
779 Ga0207709_10366912
780 Ga0207670_10048577
781 Ga0207669_10495194
782 Ga0207704_10254474
783 Ga0207704_10539757
784 Ga0207704_10595885
785 Ga0207704_10856647
786 Ga0207704_11767804
787 Ga0207691_10185473
788 Ga0207691_10256810
789 Ga0207689_10096284
790 Ga0207661_10059525
791 Ga0207661_10179793
792 Ga0207661_10810092
793 Ga0207661_10819562
794 Ga0207661_11066572
795 Ga0207679_10130051
796 Ga0207679_10656756
797 Ga0207651_11318134
798 Ga0207712_10060317
799 Ga0207712_11084000
800 Ga0207668_11007549
801 Ga0207658_10298753
802 Ga0207677_10936478
803 Ga0207703_10658854
804 Ga0207639_10433358
805 Ga0207708_10167844
806 Ga0207708_10315582
807 Ga0207702_10038554
808 Ga0207702_10214386
809 Ga0207676_10074186
810 Ga0207676_11779705
811 Ga0207674_10659236
812 Ga0207675_100024205
813 Ga0207683_11072183
814 Ga0207698_11016838
815 Ga0207698_11404949
816 Ga0209813_10035339
817 Ga0207428_10195820
818 Ga0268266_10006138
819 Ga0268266_10866825
820 Ga0268264_10000269
821 Ga0307515_10164094
822 Ga0307515_10341741
823 Ga0265340_10001488
824 Ga0307513_10000149
825 Ga0307513_10855213
826 Ga0316579_10000149
827 Ga0307405_10106433
828 Ga0307405_10454872
829 Ga0307413_10116769
830 Ga0307413_10609570
831 Ga0307410_10107313
832 Ga0307410_10257344
833 Ga0307410_10829865
834 Ga0307410_11128219
835 Ga0307406_10417671
836 Ga0307406_10955464
837 Ga0307407_10193137
838 Ga0307407_10552874
839 Ga0307407_10826744
840 Ga0307407_11717880
841 Ga0307412_10366765
842 Ga0307412_10425090
843 Ga0307409_100013627
844 Ga0307409_100051735
845 Ga0307409_100254323
846 Ga0307409_100500130
847 Ga0307416_100568016
848 Ga0307416_101350004
849 Ga0307416_101403686
850 Ga0307416_102202467
851 Ga0307416_103048610
852 Ga0307414_10507897
853 Ga0307414_11161853
854 Ga0307411_10249207
855 Ga0307411_10308290
856 Ga0307411_10597158
857 Ga0307411_10753928
858 Ga0307411_11444200
859 Ga0307415_100001214
860 Ga0307415_100022177
861 Ga0307415_100107087
862 Ga0307415_100716195
863 Ga0307415_101509591
864 Ga0395900_0542831
865 Ga0395905_1536847
866 Ga0395905_1840891
867 Ga0395901_0082341
868 Ga0395901_0434745
869 Ga0395901_0614704
870 Ga0400485_01414
871 Ga0400488_21897
872 Ga0400486_23067
873 Ga0436365_1820305
874 Ga0439461_0193443
875 Ga0451791_0590008
876 Ga0451791_1734020
877 Ga0451793_0092524
878 Ga0451797_0414131
879 Ga0451795_0235003
880 Ga0451800_0119237
881 Ga0451802_2075214
882 Ga0451802_2090143
883 Ga0451833_0164527
884 Ga0451833_0422870
885 Ga0451837_0901888
886 Ga0451841_0285562
887 Ga0451841_0472516
888 Ga0451841_1105273
889 Ga0451849_0563043
890 Ga0451849_0834527
891 Ga0451849_1275582
892 Ga0451843_0593688
893 Ga0451843_1113644
894 Ga0451853_1708812
895 Ga0451853_2609276
896 Ga0466972_0041765
897 Ga0466965_0045772
898 Ga0466965_0845207
899 Ga0466966_0153452
900 Ga0466966_0649768
901 Ga0466963_0056636
902 Ga0466963_0293383
903 Ga0466963_0953311
904 Ga0466964_0005552
905 Ga0466964_0122326
906 Ga0466971_0339836
907 Ga0466971_0606818
908 Ga0466968_0116724
909 Ga0466968_0130593
910 Ga0466970_0033861
911 Ga0466970_0033930
912 Ga0466970_0098940
913 Ga0466970_0194671
914 Ga0466970_0631744
915 Ga0466957_0434370
916 Ga0466960_0026531
917 Ga0466960_0055296
918 Ga0466960_0137027
919 Ga0466960_0738966
920 Ga0466960_0752142
921 Ga0466959_0158450
922 Ga0466958_0148813
923 Ga0466967_0031503
924 Ga0466967_0086920
925 Ga0466967_0286249
926 Ga0466967_0298553
927 Ga0466967_0326824
928 Ga0466967_0739526
929 Ga0466967_1540245
930 Ga0466967_1596766
931 Ga0495603_0131281
932 Ga0495638_0038896
933 Ga0495608_0805207
934 Ga0495640_0423977
935 Ga0495657_0584918
936 Ga0495686_0196812
937 Ga0496100_0312043
938 Ga0496101_0016073
939 Ga0496101_0077725
940 Ga0496101_0138855
941 Ga0496101_1564495
942 Ga0496102_0009370
943 Ga0496102_0151073
944 Ga0496102_0845640
945 Ga0496103_0020455
946 Ga0496103_0076275
947 Ga0496103_0632507
948 Ga0496104_0832040
949 Ga0496104_0842348
950 Ga0496104_1138538
951 Ga0496105_0176748
952 Ga0496105_0971283
953 Ga0496106_0200963
954 Ga0496106_0227118
955 Ga0496106_0308591
956 Ga0496107_0044083
957 Ga0496107_0207807
958 Ga0496107_0948853
959 Ga0496108_0026911
960 Ga0496108_0139999
961 Ga0496108_0258816
962 Ga0496108_0342137
963 Ga0496108_0344778
964 Ga0496108_0394908
965 Ga0496108_0913519
966 Ga0496109_0008290
967 Ga0496109_0022947
968 Ga0496109_0079990
969 Ga0496109_0172532
970 Ga0496109_0451995
971 Ga0496109_0885889
972 Ga0496110_0001726
973 Ga0496110_0081685
974 Ga0496110_0217441
975 Ga0496110_0290639
976 Ga0496110_0645517
977 Ga0496110_1006849
978 Ga0496110_1412671
979 Ga0496111_0011123
980 Ga0496111_0012422
981 Ga0496111_0069923
982 Ga0496111_0458750
983 Ga0496111_0957848
984 Ga0496112_0343404
985 Ga0496112_0550270
986 Ga0496113_0199269
987 Ga0496113_0437637
988 Ga0496113_0439640
989 Ga0496113_0641466
990 Ga0496113_0877857
991 Ga0496113_1320122
992 Ga0496114_0014328
993 Ga0496114_0031998
994 Ga0496114_0035945
995 Ga0496114_0063780
996 Ga0496114_0114287
997 Ga0496114_0309168
998 Ga0496114_0673267
999 Ga0496115_0032997
1000 Ga0496115_0046864
1001 Ga0496124_0394383
1002 Ga0501031_0349270
1003 Ga0501031_0367345
1004 Ga0501031_0953951
1005 Ga0501032_0133418
1006 Ga0501034_0034026
1007 Ga0501034_0384793
1008 Ga0501036_0013225
1009 Ga0501036_0116086
1010 Ga0501036_0204005
1011 Ga0501036_0767250
1012 Ga0501037_0086595
1013 Ga0501037_0155260
1014 Ga0501038_0137223
1015 Ga0501038_0174789
1016 Ga0501038_0197017
1017 Ga0501038_0218784
1018 Ga0501039_0011693
1019 Ga0501039_0076303
1020 Ga0501039_0113969
1021 Ga0501039_0240007
1022 Ga0501039_0691962
1023 Ga0501040_0052653
1024 Ga0501040_0053884
1025 Ga0501040_0521718
1026 Ga0501040_1245569
1027 Ga0501041_0052190
1028 Ga0501041_0104559
1029 Ga0501041_0150998
1030 Ga0501042_0028993
1031 Ga0501042_0210964
1032 Ga0501042_1247801
1033 Ga0501043_0288008
1034 Ga0501046_0238152
1035 Ga0501046_0294996
1036 Ga0501046_0445098
1037 Ga0501046_0609653
1038 Ga0501047_0905245
1039 Ga0501048_0035838
1040 Ga0501048_0161727
1041 Ga0501048_0491863
1042 Ga0501048_0517937
1043 Ga0501048_0725407
1044 Ga0501067_0000678
1045 Ga0501067_0026564
1046 Ga0501067_0064629
1047 Ga0501067_0076503
1048 Ga0501067_0343286
1049 Ga0501068_0009091
1050 Ga0501068_0043105
1051 Ga0501068_0091329
1052 Ga0501068_0099126
1053 Ga0501068_0146914
1054 Ga0501069_0028702
1055 Ga0501069_0079304
1056 Ga0501069_0412976
1057 Ga0501069_0448836
1058 Ga0501069_0955435
1059 Ga0501070_0008976
1060 Ga0501070_0143072
1061 Ga0501070_1176969
1062 Ga0501070_1474379
1063 Ga0501071_0004517
1064 Ga0501071_0017020
1065 Ga0501071_0043833
1066 Ga0501071_0204459
1067 Ga0501071_0474212
1068 Ga0501072_0023720
1069 Ga0501072_0042154
1070 Ga0501072_0086300
1071 Ga0501072_0107204
1072 Ga0501072_0155161
1073 Ga0501072_0218770
1074 Ga0501072_1593662
1075 Ga0501073_0001258
1076 Ga0501073_0017190
1077 Ga0501074_0003132
1078 Ga0501074_0027443
1079 Ga0501074_0053497
1080 Ga0501074_0447708
1081 Ga0501074_0538553
1082 Ga0501075_0073118
1083 Ga0501075_0126766
1084 Ga0501075_0250142
1085 Ga0501075_0554110
1086 Ga0501076_0233995
1087 Ga0501076_0459823
1088 Ga0501076_0494357
1089 Ga0501077_0025256
1090 Ga0501077_0075523
1091 Ga0501077_0201711
1092 Ga0501079_0006191
1093 Ga0501079_0011363
1094 Ga0501079_0055273
1095 Ga0501079_0109989
1096 Ga0501079_1105351
1097 Ga0501079_1222221
1098 Ga0501079_1316305
1099 Ga0501080_0004291
1100 Ga0501080_0085329
1101 Ga0501080_0218297
1102 Ga0501080_0357210
1103 Ga0501080_0440019
1104 Ga0501080_0901398
1105 Ga0501081_0836524
1106 Ga0501081_1049491
1107 Ga0501081_1128260
1108 Ga0501083_0013713
1109 Ga0501083_0028972
1110 Ga0501083_1105936
1111 Ga0501035_0290813
1112 Ga0501035_0598509
1113 Ga0501044_0948766
1114 Ga0501045_0028401
1115 Ga0501045_0301849
1116 Ga0501045_0997329
1117 Ga0501045_1050644
1118 nmdc:mga03683_315982_c1
1119 nmdc:mga03n38_107546_c1
1120 nmdc:mga03n38_160386_c1
1121 nmdc:mga03n38_189074_c1
1122 nmdc:mga03n38_65887_c1
1123 nmdc:mga03n38_92701_c2
1124 nmdc:mga00v17_122321_c1
1125 nmdc:mga00v17_219823_c1
1126 nmdc:mga00v17_263200_c1
1127 nmdc:mga00v17_292485_c1
1128 nmdc:mga00v17_478150_c1
1129 nmdc:mga00v17_52519_c1
1130 nmdc:mga00v17_738691_c1
1131 nmdc:mga0yw44_1013748_c1
1132 nmdc:mga0yw44_101841_c1
1133 nmdc:mga0yw44_150419_c1
1134 nmdc:mga0yw44_154457_c1
1135 nmdc:mga0yw44_172278_c1
1136 nmdc:mga0yw44_179133_c1
1137 nmdc:mga0yw44_348606_c1
1138 nmdc:mga0yw44_35464_c1
1139 nmdc:mga0yw44_456272_c1
1140 nmdc:mga0yw44_60010_c1
1141 nmdc:mga0yw44_64836_c1
1142 nmdc:mga0yw44_681150_c1
1143 nmdc:mga0yw44_754595_c1
1144 nmdc:mga0yw44_763_c1
1145 nmdc:mga0yw44_96103_c1
1146 nmdc:mga06z11_14916_c1
1147 nmdc:mga06z11_26300_c1
1148 nmdc:mga06z11_338446_c1
1149 nmdc:mga06z11_778270_c1
1150 nmdc:mga06z11_85299_c1
1151 nmdc:mga06z11_857353_c1
1152 nmdc:mga04h51_57371_c1
1153 nmdc:mga07m45_176900_c1
1154 nmdc:mga07m45_183205_c1
1155 nmdc:mga07m45_679226_c1
1156 nmdc:mga08y16_475167_c1
1157 nmdc:mga08y16_71619_c1
1158 nmdc:mga08x19_309300_c1
1159 nmdc:mga0sz30_544721_c1
1160 Ga0495601_0795284
1161 Ga0495655_0170593
1162 Ga0495619_0272112
1163 Ga0500641_0271876
1164 Ga0500554_215284
1165 Ga0500556_0000643
1166 Ga0500594_0196708
1167 Ga0500573_0048870
1168 Ga0500616_0001823
1169 Ga0500627_0269531
1170 Ga0501084_0070803
1171 Ga0501084_0412479
1172 Ga0501084_0464519
1173 Ga0501084_1175864
1174 Ga0501082_0046326
1175 Ga0501082_0107074
1176 Ga0501082_0135742
1177 Ga0530510_0134774
1178 Ga0530510_0275104
1179 Ga0530510_0339481
1180 Ga0530510_0398117
1181 Ga0530510_0582699
1182 2643889209
1183 2643958264
1184 2644036446
1185 2644090696
1186 2644099117
1187 2644114998
1188 2644320500
1189 2738867834
1190 2740167605
1191 2812332157
1192 2855390702
1193 2984576893
1194 2990258641

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22636

FlK

Fluoroacetyl-CoA-specific thioesterase

15

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p3f-assembly2.cif.gz_D crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk 0.9265 1 120
4zrb-assembly1.cif.gz_D crystal structure of hypothetical thioesterase protein sp_1851 with coenzyme a from streptococcus pneumoniae tigr4 0.9254 2 112
3kx8-assembly1.cif.gz_B structural basis of the activity and substrate specificity of the fluoroacetyl-coa thioesterase flk 0.9212 1 119
3p3f-assembly2.cif.gz_D crystal structure of the f36a mutant of the fluoroacetyl-coa-specific thioesterase flk 0.9191 1 120
4ae8-assembly1.cif.gz_A crystal structure of human them4 0.9189 25 109
ID Description Score Start End Superfamily
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9593 2 119 3.10.129.10
af_Q54KW1_1_129_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9359 2 119 3.10.129.10
4ae8A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9189 25 109 3.10.129.10
4gahB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9182 25 109 3.10.129.10
3p3iA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9142 1 119 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A3L8P8F5-F1-model_v4 Thioesterase 0.9954 2 120
AF-A0A1H1XV26-F1-model_v4 Predicted thioesterase 0.994 2 120
AF-A0A2G7CZ52-F1-model_v4 deleted 0.9904 2 119
AF-A0A7Y9RV23-F1-model_v4 Putative thioesterase 0.9902 2 119
AF-A0A1Q7W5I7-F1-model_v4 Thioesterase 0.9896 5 120

Map