F467624
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 597 | 331 | 1194 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300003354|JGI25160J50197_1062263|JGI25160J50197_10622632 |
| Length | 120 |
| Sequence | MGPVSAHPSPTTTLRPHRCTLSVPVEIERPESSEAPFEVPXPDVPWVTIVHNDPVXLMSYVSYVFQSYFGYSKDKAHQLMLDVHHKGRAVVSSGSREEMERDVQAMHGYGLWATLQQDRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 80 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 139 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 140 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 141 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 142 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 143 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 144 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 145 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 147 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 148 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 149 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 150 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 151 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 152 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 153 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 154 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 155 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 156 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 157 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 158 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 159 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 160 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 161 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 162 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 163 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 164 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 165 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 166 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 168 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 169 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 170 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 172 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 173 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 174 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 175 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 176 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 177 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 178 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 179 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 180 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 181 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 182 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 183 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 184 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 185 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 186 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 196 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 197 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 198 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 199 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 200 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 225 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 226 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 233 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 236 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 263 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 271 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 272 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 283 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 286 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 287 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 288 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 289 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 290 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 291 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 292 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 293 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 294 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 295 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 296 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 297 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 298 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 299 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 300 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 301 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 302 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 303 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 304 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 305 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 306 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 307 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 308 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 309 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 310 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 311 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 312 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 313 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 314 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 315 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 316 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 317 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 318 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 319 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 320 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 321 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 322 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 323 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 324 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 325 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 326 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 327 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 328 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 329 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 330 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 331 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.29 |
| Metatranscriptomes | 0.17 |
| Isolates | 7.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.19 |
| Nodule | 0.5 |
| Rhizoplane | 6.37 |
| Rhizosphere | 80.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25160J50197_1062263 | 3300003354 | Bacteria | 740 |
| 2 | LJQas_1004173 | 3300000549 | Bacteria | 1894 |
| 3 | JGI24740J21852_10020524 | 3300001979 | Bacteria | 2302 |
| 4 | JGI24737J22298_10230469 | 3300001990 | Bacteria | 547 |
| 5 | JGI24735J21928_10094395 | 3300002067 | Bacteria | 858 |
| 6 | JGI24751J29686_10090116 | 3300002459 | Bacteria | 638 |
| 7 | JGI25406J46586_10070357 | 3300003203 | Bacteria | 1100 |
| 8 | rootH2_10007408 | 3300003320 | Bacteria | 2299 |
| 9 | rootH2_10053788 | 3300003320 | Bacteria | 4998 |
| 10 | rootL2_10009965 | 3300003322 | Bacteria | 6392 |
| 11 | rootH1_10009629 | 3300003323 | Bacteria | 3446 |
| 12 | Ga0070683_100488443 | 3300005329 | Bacteria | 1176 |
| 13 | Ga0070683_101262937 | 3300005329 | Bacteria | 710 |
| 14 | Ga0070690_101528303 | 3300005330 | Bacteria | 540 |
| 15 | Ga0070670_101752970 | 3300005331 | Bacteria | 572 |
| 16 | Ga0070677_10291426 | 3300005333 | Bacteria | 826 |
| 17 | Ga0070682_100672854 | 3300005337 | Bacteria | 827 |
| 18 | Ga0068868_101416384 | 3300005338 | Bacteria | 649 |
| 19 | Ga0070660_100279860 | 3300005339 | Bacteria | 1365 |
| 20 | Ga0070689_100761918 | 3300005340 | Bacteria | 849 |
| 21 | Ga0070691_10089637 | 3300005341 | Bacteria | 1515 |
| 22 | Ga0070691_10145902 | 3300005341 | Bacteria | 1210 |
| 23 | Ga0070687_101380503 | 3300005343 | Bacteria | 526 |
| 24 | Ga0070661_101660205 | 3300005344 | Bacteria | 541 |
| 25 | Ga0070692_10369908 | 3300005345 | Bacteria | 896 |
| 26 | Ga0070668_100212222 | 3300005347 | Bacteria | 1593 |
| 27 | Ga0070669_100430148 | 3300005353 | Bacteria | 1085 |
| 28 | Ga0070674_100160231 | 3300005356 | Bacteria | 1707 |
| 29 | Ga0070674_100365109 | 3300005356 | Bacteria | 1170 |
| 30 | Ga0070673_101207769 | 3300005364 | Bacteria | 708 |
| 31 | Ga0070688_100491989 | 3300005365 | Bacteria | 924 |
| 32 | Ga0070667_100529302 | 3300005367 | Bacteria | 1082 |
| 33 | Ga0070709_11061164 | 3300005434 | Bacteria | 647 |
| 34 | Ga0070709_11260159 | 3300005434 | Bacteria | 595 |
| 35 | Ga0070714_100386347 | 3300005435 | Bacteria | 1320 |
| 36 | Ga0070714_100823612 | 3300005435 | Bacteria | 899 |
| 37 | Ga0070713_100307772 | 3300005436 | Bacteria | 1460 |
| 38 | Ga0070713_100498026 | 3300005436 | Bacteria | 1149 |
| 39 | Ga0070713_102108960 | 3300005436 | Bacteria | 546 |
| 40 | Ga0070710_10156542 | 3300005437 | Bacteria | 1409 |
| 41 | Ga0070710_10173995 | 3300005437 | Bacteria | 1343 |
| 42 | Ga0070710_10372573 | 3300005437 | Bacteria | 950 |
| 43 | Ga0070701_10121383 | 3300005438 | Bacteria | 1473 |
| 44 | Ga0070711_100415972 | 3300005439 | Bacteria | 1094 |
| 45 | Ga0070711_101005478 | 3300005439 | Bacteria | 715 |
| 46 | Ga0070705_100136006 | 3300005440 | Bacteria | 1610 |
| 47 | Ga0070700_100150585 | 3300005441 | Bacteria | 1591 |
| 48 | Ga0070708_100678927 | 3300005445 | Bacteria | 970 |
| 49 | Ga0070678_100511847 | 3300005456 | Bacteria | 1061 |
| 50 | Ga0070681_10811635 | 3300005458 | Bacteria | 853 |
| 51 | Ga0070681_11160522 | 3300005458 | Bacteria | 694 |
| 52 | Ga0068867_101436108 | 3300005459 | Bacteria | 641 |
| 53 | Ga0070706_100219306 | 3300005467 | Bacteria | 1775 |
| 54 | Ga0070707_100019996 | 3300005468 | Bacteria | 6312 |
| 55 | Ga0070707_100664102 | 3300005468 | Bacteria | 1005 |
| 56 | Ga0070707_100766672 | 3300005468 | Bacteria | 928 |
| 57 | Ga0070698_100001650 | 3300005471 | Bacteria | 24887 |
| 58 | Ga0070698_100022765 | 3300005471 | Bacteria | 6552 |
| 59 | Ga0070679_100002885 | 3300005530 | Bacteria | 15616 |
| 60 | Ga0070679_101217685 | 3300005530 | Bacteria | 698 |
| 61 | Ga0070697_100460256 | 3300005536 | Bacteria | 1109 |
| 62 | Ga0070672_100633828 | 3300005543 | Bacteria | 933 |
| 63 | Ga0070686_100480276 | 3300005544 | Bacteria | 961 |
| 64 | Ga0070686_101409869 | 3300005544 | Bacteria | 585 |
| 65 | Ga0070693_100581380 | 3300005547 | Bacteria | 806 |
| 66 | Ga0070665_100435125 | 3300005548 | Bacteria | 1321 |
| 67 | Ga0070704_100569037 | 3300005549 | Bacteria | 992 |
| 68 | Ga0068855_100077001 | 3300005563 | Bacteria | 3870 |
| 69 | Ga0068857_100169061 | 3300005577 | Bacteria | 1987 |
| 70 | Ga0068854_101274540 | 3300005578 | Bacteria | 661 |
| 71 | Ga0068856_100383186 | 3300005614 | Bacteria | 1425 |
| 72 | Ga0068856_100857429 | 3300005614 | Bacteria | 927 |
| 73 | Ga0068856_102135154 | 3300005614 | Bacteria | 569 |
| 74 | Ga0070702_100931606 | 3300005615 | Bacteria | 682 |
| 75 | Ga0068852_100515224 | 3300005616 | Bacteria | 1193 |
| 76 | Ga0068852_101860191 | 3300005616 | Bacteria | 624 |
| 77 | Ga0068859_100441686 | 3300005617 | Bacteria | 1397 |
| 78 | Ga0068864_100057547 | 3300005618 | Bacteria | 3359 |
| 79 | Ga0068861_100154759 | 3300005719 | Bacteria | 1884 |
| 80 | Ga0068861_100214562 | 3300005719 | Bacteria | 1623 |
| 81 | Ga0068851_10160348 | 3300005834 | Bacteria | 1235 |
| 82 | Ga0068870_10158236 | 3300005840 | Bacteria | 1341 |
| 83 | Ga0068863_100870418 | 3300005841 | Bacteria | 900 |
| 84 | Ga0068858_100013331 | 3300005842 | Bacteria | 7754 |
| 85 | Ga0068860_100000467 | 3300005843 | Bacteria | 50515 |
| 86 | Ga0068860_100054711 | 3300005843 | Bacteria | 3793 |
| 87 | Ga0081455_10163073 | 3300005937 | Bacteria | 1706 |
| 88 | Ga0081538_10150382 | 3300005981 | Bacteria | 1055 |
| 89 | Ga0081539_10013720 | 3300005985 | Bacteria | 6081 |
| 90 | Ga0081539_10084471 | 3300005985 | Bacteria | 1659 |
| 91 | Ga0070717_10120085 | 3300006028 | Bacteria | 2251 |
| 92 | Ga0075365_10049406 | 3300006038 | Bacteria | 2771 |
| 93 | Ga0075365_10170561 | 3300006038 | Bacteria | 1519 |
| 94 | Ga0075365_10207238 | 3300006038 | Bacteria | 1374 |
| 95 | Ga0075365_10280761 | 3300006038 | Bacteria | 1172 |
| 96 | Ga0075365_10295573 | 3300006038 | Bacteria | 1139 |
| 97 | Ga0075364_10119296 | 3300006051 | Bacteria | 1765 |
| 98 | Ga0075364_10412767 | 3300006051 | Bacteria | 921 |
| 99 | Ga0075364_10445356 | 3300006051 | Bacteria | 885 |
| 100 | Ga0070715_10013648 | 3300006163 | Bacteria | 2988 |
| 101 | Ga0070716_100022605 | 3300006173 | Bacteria | 3325 |
| 102 | Ga0075367_10408745 | 3300006178 | Bacteria | 859 |
| 103 | Ga0075369_10368810 | 3300006186 | Bacteria | 675 |
| 104 | Ga0097621_100170976 | 3300006237 | Bacteria | 1873 |
| 105 | Ga0075370_10096719 | 3300006353 | Bacteria | 1706 |
| 106 | Ga0068871_100072817 | 3300006358 | Bacteria | 2831 |
| 107 | Ga0068871_100829297 | 3300006358 | Bacteria | 854 |
| 108 | Ga0075428_100006426 | 3300006844 | Bacteria | 13075 |
| 109 | Ga0075430_100009753 | 3300006846 | Bacteria | 8119 |
| 110 | Ga0075430_100582546 | 3300006846 | Bacteria | 923 |
| 111 | Ga0075431_100000052 | 3300006847 | Bacteria | 63044 |
| 112 | Ga0075431_100011593 | 3300006847 | Bacteria | 8890 |
| 113 | Ga0075434_100122642 | 3300006871 | Bacteria | 2615 |
| 114 | Ga0075429_100008808 | 3300006880 | Bacteria | 8775 |
| 115 | Ga0068865_101051333 | 3300006881 | Bacteria | 715 |
| 116 | Ga0097620_100441726 | 3300006931 | Bacteria | 1397 |
| 117 | Ga0075435_101085052 | 3300007076 | Bacteria | 700 |
| 118 | Ga0105251_10158474 | 3300009011 | Bacteria | 1021 |
| 119 | Ga0111539_10047224 | 3300009094 | Bacteria | 5147 |
| 120 | Ga0111539_11380007 | 3300009094 | Bacteria | 817 |
| 121 | Ga0105245_10408482 | 3300009098 | Bacteria | 1358 |
| 122 | Ga0105247_10035857 | 3300009101 | Bacteria | 3024 |
| 123 | Ga0105247_11355002 | 3300009101 | Bacteria | 574 |
| 124 | Ga0105247_11418403 | 3300009101 | Bacteria | 563 |
| 125 | Ga0114129_10098569 | 3300009147 | Bacteria | 4045 |
| 126 | Ga0105243_10156210 | 3300009148 | Bacteria | 1962 |
| 127 | Ga0105243_11131811 | 3300009148 | Bacteria | 793 |
| 128 | Ga0105241_12408986 | 3300009174 | Bacteria | 526 |
| 129 | Ga0105242_10713677 | 3300009176 | Bacteria | 983 |
| 130 | Ga0105242_12100474 | 3300009176 | Bacteria | 609 |
| 131 | Ga0105248_10674572 | 3300009177 | Bacteria | 1166 |
| 132 | Ga0105237_10085563 | 3300009545 | Bacteria | 3143 |
| 133 | Ga0105237_11406864 | 3300009545 | Bacteria | 704 |
| 134 | Ga0105238_10089008 | 3300009551 | Bacteria | 3074 |
| 135 | Ga0105238_10179959 | 3300009551 | Bacteria | 2091 |
| 136 | Ga0105238_10797141 | 3300009551 | Bacteria | 960 |
| 137 | Ga0105238_12722830 | 3300009551 | Bacteria | 531 |
| 138 | Ga0105249_10279708 | 3300009553 | Bacteria | 1666 |
| 139 | Ga0105249_10539824 | 3300009553 | Bacteria | 1216 |
| 140 | Ga0105249_11967364 | 3300009553 | Bacteria | 657 |
| 141 | Ga0105239_11056776 | 3300010375 | Bacteria | 934 |
| 142 | Ga0105239_11069635 | 3300010375 | Bacteria | 928 |
| 143 | Ga0105239_11489049 | 3300010375 | Bacteria | 782 |
| 144 | Ga0105239_12162714 | 3300010375 | Bacteria | 647 |
| 145 | Ga0105246_10345661 | 3300011119 | Bacteria | 1217 |
| 146 | Ga0105246_11475659 | 3300011119 | Bacteria | 638 |
| 147 | Ga0105246_11599094 | 3300011119 | Bacteria | 616 |
| 148 | Ga0105246_11702073 | 3300011119 | Bacteria | 599 |
| 149 | Ga0157370_10305957 | 3300013104 | Bacteria | 1467 |
| 150 | Ga0157369_11859452 | 3300013105 | Bacteria | 611 |
| 151 | Ga0157374_10117689 | 3300013296 | Bacteria | 2561 |
| 152 | Ga0157374_12347251 | 3300013296 | Bacteria | 561 |
| 153 | Ga0157378_10688249 | 3300013297 | Bacteria | 1041 |
| 154 | Ga0163162_10405760 | 3300013306 | Bacteria | 1495 |
| 155 | Ga0163162_11725077 | 3300013306 | Bacteria | 715 |
| 156 | Ga0157372_12304761 | 3300013307 | Bacteria | 618 |
| 157 | Ga0157375_10459446 | 3300013308 | Bacteria | 1439 |
| 158 | Ga0157375_11207097 | 3300013308 | Bacteria | 887 |
| 159 | Ga0163163_10038366 | 3300014325 | Bacteria | 4669 |
| 160 | Ga0163163_10277388 | 3300014325 | Bacteria | 1728 |
| 161 | Ga0163163_11716847 | 3300014325 | Bacteria | 688 |
| 162 | Ga0157380_10565170 | 3300014326 | Bacteria | 1118 |
| 163 | Ga0182008_10175829 | 3300014497 | Bacteria | 1082 |
| 164 | Ga0157377_10376717 | 3300014745 | Bacteria | 960 |
| 165 | Ga0157377_10878841 | 3300014745 | Bacteria | 668 |
| 166 | Ga0157379_10006934 | 3300014968 | Bacteria | 9797 |
| 167 | Ga0157379_12302367 | 3300014968 | Bacteria | 536 |
| 168 | Ga0157376_11400927 | 3300014969 | Bacteria | 731 |
| 169 | Ga0163161_10099196 | 3300017792 | Bacteria | 2165 |
| 170 | Ga0206353_11349908 | 3300020082 | Bacteria | 933 |
| 171 | Ga0209758_1007198 | 3300025297 | Bacteria | 7662 |
| 172 | Ga0207426_1001387 | 3300025302 | Bacteria | 20464 |
| 173 | Ga0207426_1014403 | 3300025302 | Bacteria | 2897 |
| 174 | Ga0207426_1039252 | 3300025302 | Bacteria | 1484 |
| 175 | Ga0207692_11019656 | 3300025898 | Bacteria | 547 |
| 176 | Ga0207688_10178787 | 3300025901 | Bacteria | 1265 |
| 177 | Ga0207647_10044575 | 3300025904 | Bacteria | 2770 |
| 178 | Ga0207643_10045551 | 3300025908 | Bacteria | 2478 |
| 179 | Ga0207705_10016424 | 3300025909 | Bacteria | 5307 |
| 180 | Ga0207657_10244712 | 3300025919 | Bacteria | 1431 |
| 181 | Ga0207652_10017591 | 3300025921 | Bacteria | 5852 |
| 182 | Ga0207664_10018076 | 3300025929 | Bacteria | 5180 |
| 183 | Ga0207644_10345206 | 3300025931 | Bacteria | 1208 |
| 184 | Ga0207669_10133813 | 3300025937 | Bacteria | 1709 |
| 185 | Ga0207691_10063419 | 3300025940 | Bacteria | 3351 |
| 186 | Ga0207691_10547114 | 3300025940 | Bacteria | 982 |
| 187 | Ga0207691_10744114 | 3300025940 | Bacteria | 826 |
| 188 | Ga0207661_10386276 | 3300025944 | Bacteria | 1268 |
| 189 | Ga0207679_12179699 | 3300025945 | Bacteria | 503 |
| 190 | Ga0207677_10114154 | 3300026023 | Bacteria | 2018 |
| 191 | Ga0207677_11353693 | 3300026023 | Bacteria | 655 |
| 192 | Ga0207639_10243481 | 3300026041 | Bacteria | 1565 |
| 193 | Ga0207639_11827955 | 3300026041 | Bacteria | 568 |
| 194 | Ga0207648_10368769 | 3300026089 | Bacteria | 1296 |
| 195 | Ga0207675_100332985 | 3300026118 | Bacteria | 1484 |
| 196 | Ga0207683_10940209 | 3300026121 | Bacteria | 803 |
| 197 | Ga0207698_10191797 | 3300026142 | Bacteria | 1821 |
| 198 | Ga0207428_10023204 | 3300027907 | Bacteria | 5220 |
| 199 | Ga0268264_10000250 | 3300028381 | Bacteria | 100909 |
| 200 | Ga0307513_10000209 | 3300031456 | Bacteria | 84521 |
| 201 | Ga0307509_10007230 | 3300031507 | Bacteria | 14611 |
| 202 | Ga0307408_100731526 | 3300031548 | Bacteria | 892 |
| 203 | Ga0307408_101674942 | 3300031548 | Bacteria | 605 |
| 204 | Ga0307514_10006992 | 3300031649 | Bacteria | 9749 |
| 205 | Ga0316576_10922740 | 3300031727 | Bacteria | 625 |
| 206 | Ga0316578_10093769 | 3300031728 | Bacteria | 1795 |
| 207 | Ga0307516_10005616 | 3300031730 | Bacteria | 14931 |
| 208 | Ga0307405_10210605 | 3300031731 | Bacteria | 1419 |
| 209 | Ga0307413_11224210 | 3300031824 | Bacteria | 654 |
| 210 | Ga0307410_10631926 | 3300031852 | Bacteria | 896 |
| 211 | Ga0307410_11384689 | 3300031852 | Bacteria | 617 |
| 212 | Ga0307406_10298795 | 3300031901 | Bacteria | 1236 |
| 213 | Ga0307406_10809927 | 3300031901 | Bacteria | 791 |
| 214 | Ga0307407_10256309 | 3300031903 | Bacteria | 1201 |
| 215 | Ga0307407_10512101 | 3300031903 | Bacteria | 881 |
| 216 | Ga0307412_10033273 | 3300031911 | Bacteria | 3275 |
| 217 | Ga0307409_100007272 | 3300031995 | Bacteria | 6607 |
| 218 | Ga0307409_100034386 | 3300031995 | Bacteria | 3701 |
| 219 | Ga0307409_100183591 | 3300031995 | Bacteria | 1854 |
| 220 | Ga0307409_100392480 | 3300031995 | Bacteria | 1323 |
| 221 | Ga0307416_100000326 | 3300032002 | Bacteria | 24620 |
| 222 | Ga0307416_100114022 | 3300032002 | Bacteria | 2390 |
| 223 | Ga0307416_100124818 | 3300032002 | Bacteria | 2304 |
| 224 | Ga0307416_100588015 | 3300032002 | Bacteria | 1191 |
| 225 | Ga0307416_101123811 | 3300032002 | Bacteria | 891 |
| 226 | Ga0307416_101149903 | 3300032002 | Bacteria | 881 |
| 227 | Ga0307416_101742539 | 3300032002 | Bacteria | 727 |
| 228 | Ga0307416_101977651 | 3300032002 | Bacteria | 686 |
| 229 | Ga0307411_10002743 | 3300032005 | Bacteria | 7915 |
| 230 | Ga0307411_10356600 | 3300032005 | Bacteria | 1194 |
| 231 | Ga0307415_100000660 | 3300032126 | Bacteria | 15214 |
| 232 | Ga0307415_100131275 | 3300032126 | Bacteria | 1897 |
| 233 | Ga0307415_100398940 | 3300032126 | Bacteria | 1174 |
| 234 | Ga0307510_10024931 | 3300033180 | Bacteria | 6905 |
| 235 | Ga0307510_10368155 | 3300033180 | Bacteria | 884 |
| 236 | Ga0316584_0123568 | 3300036712 | Bacteria | 1933 |
| 237 | Ga0395898_0170577 | 3300037466 | Bacteria | 2080 |
| 238 | Ga0395905_0223722 | 3300037471 | Bacteria | 1761 |
| 239 | Ga0436364_0516352 | 3300037853 | Bacteria | 571 |
| 240 | Ga0436364_0528435 | 3300037853 | Bacteria | 652 |
| 241 | Ga0395901_0116228 | 3300038443 | Bacteria | 2810 |
| 242 | Ga0436365_1227487 | 3300039437 | Bacteria | 574 |
| 243 | Ga0439439_0083960 | 3300041406 | Bacteria | 864 |
| 244 | Ga0439461_0015637 | 3300041410 | Bacteria | 1456 |
| 245 | Ga0439465_0199099 | 3300041413 | Bacteria | 729 |
| 246 | Ga0451787_724674 | 3300041441 | Bacteria | 942 |
| 247 | Ga0451791_1279547 | 3300041451 | Bacteria | 558 |
| 248 | Ga0451797_0302219 | 3300041453 | Bacteria | 1058 |
| 249 | Ga0451797_0641885 | 3300041453 | Bacteria | 1930 |
| 250 | Ga0451800_0289522 | 3300041459 | Bacteria | 1444 |
| 251 | Ga0451804_0715057 | 3300041463 | Bacteria | 596 |
| 252 | Ga0451807_1734761 | 3300041486 | Bacteria | 1444 |
| 253 | Ga0451833_1005422 | 3300041491 | Bacteria | 662 |
| 254 | Ga0451835_1169925 | 3300041492 | Bacteria | 639 |
| 255 | Ga0451837_0229405 | 3300041494 | Bacteria | 1493 |
| 256 | Ga0451837_1022782 | 3300041494 | Bacteria | 757 |
| 257 | Ga0451837_1532142 | 3300041494 | Bacteria | 575 |
| 258 | Ga0451837_1738520 | 3300041494 | Bacteria | 957 |
| 259 | Ga0451839_0505972 | 3300041496 | Bacteria | 553 |
| 260 | Ga0451841_0536699 | 3300041498 | Bacteria | 1005 |
| 261 | Ga0451841_0883659 | 3300041498 | Bacteria | 699 |
| 262 | Ga0451841_1390613 | 3300041498 | Bacteria | 757 |
| 263 | Ga0451847_0737900 | 3300041503 | Bacteria | 582 |
| 264 | Ga0451851_1147222 | 3300041507 | Bacteria | 850 |
| 265 | Ga0451843_1043714 | 3300041509 | Bacteria | 714 |
| 266 | Ga0451855_0393681 | 3300041511 | Bacteria | 651 |
| 267 | Ga0451853_2518537 | 3300041512 | Bacteria | 2480 |
| 268 | Ga0451853_2818236 | 3300041512 | Bacteria | 1116 |
| 269 | Ga0439431_0002237 | 3300041997 | Bacteria | 4268 |
| 270 | Ga0439442_087991 | 3300042002 | Bacteria | 667 |
| 271 | Ga0439452_142804 | 3300042010 | Bacteria | 506 |
| 272 | Ga0439457_127077 | 3300042014 | Bacteria | 605 |
| 273 | Ga0439446_0179925 | 3300042156 | Bacteria | 706 |
| 274 | Ga0439434_0003237 | 3300042435 | Bacteria | 4781 |
| 275 | Ga0466972_0011723 | 3300044658 | Bacteria | 4401 |
| 276 | Ga0466972_0019078 | 3300044658 | Bacteria | 3429 |
| 277 | Ga0466972_0054516 | 3300044658 | Bacteria | 1923 |
| 278 | Ga0466965_0001830 | 3300044683 | Bacteria | 8843 |
| 279 | Ga0466965_0016698 | 3300044683 | Bacteria | 3498 |
| 280 | Ga0466965_0032063 | 3300044683 | Bacteria | 2566 |
| 281 | Ga0466966_0056157 | 3300044684 | Bacteria | 2491 |
| 282 | Ga0466966_0157589 | 3300044684 | Bacteria | 1383 |
| 283 | Ga0466966_0455476 | 3300044684 | Bacteria | 769 |
| 284 | Ga0466961_0000293 | 3300044693 | Bacteria | 33169 |
| 285 | Ga0466961_0048976 | 3300044693 | Bacteria | 2701 |
| 286 | Ga0466961_0070849 | 3300044693 | Bacteria | 2213 |
| 287 | Ga0466963_0003954 | 3300044694 | Bacteria | 8574 |
| 288 | Ga0466963_0014143 | 3300044694 | Bacteria | 4916 |
| 289 | Ga0466964_0013591 | 3300044706 | Bacteria | 3089 |
| 290 | Ga0466964_0015187 | 3300044706 | Bacteria | 2931 |
| 291 | Ga0466964_0149118 | 3300044706 | Bacteria | 1082 |
| 292 | Ga0466971_0002061 | 3300044719 | Bacteria | 8512 |
| 293 | Ga0466968_0270499 | 3300044735 | Bacteria | 811 |
| 294 | Ga0466970_0000816 | 3300044765 | Bacteria | 14971 |
| 295 | Ga0466970_0010529 | 3300044765 | Bacteria | 4697 |
| 296 | Ga0466970_0205653 | 3300044765 | Bacteria | 1096 |
| 297 | Ga0466970_0461418 | 3300044765 | Bacteria | 729 |
| 298 | Ga0466957_0001533 | 3300044842 | Bacteria | 12167 |
| 299 | Ga0466957_0029122 | 3300044842 | Bacteria | 3292 |
| 300 | Ga0466960_0002414 | 3300044901 | Bacteria | 7044 |
| 301 | Ga0466960_0011491 | 3300044901 | Bacteria | 3708 |
| 302 | Ga0466960_0175914 | 3300044901 | Bacteria | 1158 |
| 303 | Ga0466959_0038391 | 3300045049 | Bacteria | 3538 |
| 304 | Ga0466958_0006441 | 3300045836 | Bacteria | 6388 |
| 305 | Ga0466958_0040188 | 3300045836 | Bacteria | 2811 |
| 306 | Ga0466967_0048022 | 3300045976 | Bacteria | 3725 |
| 307 | Ga0466967_0054402 | 3300045976 | Bacteria | 3522 |
| 308 | Ga0466967_0191111 | 3300045976 | Bacteria | 1935 |
| 309 | Ga0466967_0217067 | 3300045976 | Bacteria | 1816 |
| 310 | Ga0495603_0002172 | 3300046455 | Bacteria | 11545 |
| 311 | Ga0495603_0010747 | 3300046455 | Bacteria | 5552 |
| 312 | Ga0495629_0001923 | 3300046459 | Bacteria | 16192 |
| 313 | Ga0495629_0015476 | 3300046459 | Bacteria | 5477 |
| 314 | Ga0495638_0223996 | 3300046460 | Bacteria | 1050 |
| 315 | Ga0495662_0018837 | 3300046476 | Bacteria | 3340 |
| 316 | Ga0495585_0240514 | 3300046492 | Bacteria | 906 |
| 317 | Ga0495594_0003083 | 3300046499 | Bacteria | 8627 |
| 318 | Ga0495594_0290089 | 3300046499 | Bacteria | 932 |
| 319 | Ga0495631_0142228 | 3300046518 | Bacteria | 1030 |
| 320 | Ga0495652_0852300 | 3300046529 | Bacteria | 604 |
| 321 | Ga0495640_0146579 | 3300046533 | Bacteria | 1518 |
| 322 | Ga0495622_0022365 | 3300046557 | Bacteria | 2946 |
| 323 | Ga0495622_0426721 | 3300046557 | Bacteria | 569 |
| 324 | Ga0495656_0097031 | 3300046615 | Bacteria | 1357 |
| 325 | Ga0495668_0772439 | 3300046616 | Bacteria | 532 |
| 326 | Ga0495611_0058222 | 3300046648 | Bacteria | 1752 |
| 327 | Ga0495588_0005067 | 3300046674 | Bacteria | 5852 |
| 328 | Ga0495658_0317270 | 3300046683 | Bacteria | 987 |
| 329 | Ga0495613_0003894 | 3300046689 | Bacteria | 11168 |
| 330 | Ga0495624_0112946 | 3300046690 | Bacteria | 1670 |
| 331 | Ga0495589_0145832 | 3300046794 | Bacteria | 1132 |
| 332 | Ga0495589_0337009 | 3300046794 | Bacteria | 696 |
| 333 | Ga0495604_0099912 | 3300047317 | Bacteria | 2134 |
| 334 | Ga0495636_0108628 | 3300047318 | Bacteria | 1219 |
| 335 | Ga0495636_0206993 | 3300047318 | Bacteria | 897 |
| 336 | Ga0495676_0010371 | 3300047321 | Bacteria | 8451 |
| 337 | Ga0495676_0010487 | 3300047321 | Bacteria | 8404 |
| 338 | Ga0495614_0030609 | 3300048089 | Bacteria | 2316 |
| 339 | Ga0496101_0373185 | 3300048904 | Bacteria | 1122 |
| 340 | Ga0496102_0207762 | 3300048905 | Bacteria | 1846 |
| 341 | Ga0496103_0652782 | 3300048906 | Bacteria | 668 |
| 342 | Ga0496104_0034400 | 3300048907 | Bacteria | 4725 |
| 343 | Ga0496104_0239846 | 3300048907 | Bacteria | 1725 |
| 344 | Ga0496104_0258615 | 3300048907 | Bacteria | 1654 |
| 345 | Ga0496104_0612671 | 3300048907 | Bacteria | 999 |
| 346 | Ga0496104_1770682 | 3300048907 | Bacteria | 520 |
| 347 | Ga0496105_0011827 | 3300048908 | Bacteria | 6912 |
| 348 | Ga0496105_0500108 | 3300048908 | Bacteria | 954 |
| 349 | Ga0496107_0086427 | 3300048910 | Bacteria | 2289 |
| 350 | Ga0496108_0083539 | 3300048911 | Bacteria | 2709 |
| 351 | Ga0496108_0151668 | 3300048911 | Bacteria | 2000 |
| 352 | Ga0496108_0184682 | 3300048911 | Bacteria | 1806 |
| 353 | Ga0496108_0550251 | 3300048911 | Bacteria | 1007 |
| 354 | Ga0496108_0774104 | 3300048911 | Bacteria | 829 |
| 355 | Ga0496108_1257219 | 3300048911 | Bacteria | 624 |
| 356 | Ga0496109_0187318 | 3300048912 | Bacteria | 1944 |
| 357 | Ga0496109_0286331 | 3300048912 | Bacteria | 1553 |
| 358 | Ga0496109_0350898 | 3300048912 | Bacteria | 1394 |
| 359 | Ga0496110_0045230 | 3300048913 | Bacteria | 3847 |
| 360 | Ga0496110_0583520 | 3300048913 | Bacteria | 1015 |
| 361 | Ga0496110_0959519 | 3300048913 | Bacteria | 762 |
| 362 | Ga0496110_1217616 | 3300048913 | Bacteria | 662 |
| 363 | Ga0496111_0647040 | 3300048914 | Bacteria | 771 |
| 364 | Ga0496114_0044896 | 3300048917 | Bacteria | 3668 |
| 365 | Ga0496114_0095199 | 3300048917 | Bacteria | 2534 |
| 366 | Ga0496114_0231551 | 3300048917 | Bacteria | 1623 |
| 367 | Ga0496114_0458126 | 3300048917 | Bacteria | 1129 |
| 368 | Ga0496115_0007901 | 3300048918 | Bacteria | 7847 |
| 369 | Ga0496124_0767587 | 3300048927 | Bacteria | 602 |
| 370 | Ga0501031_0009312 | 3300049568 | Bacteria | 6384 |
| 371 | Ga0501031_0064870 | 3300049568 | Bacteria | 2379 |
| 372 | Ga0501031_0152487 | 3300049568 | Bacteria | 1510 |
| 373 | Ga0501031_0345556 | 3300049568 | Bacteria | 963 |
| 374 | Ga0501031_1102857 | 3300049568 | Bacteria | 506 |
| 375 | Ga0501032_0001743 | 3300049569 | Bacteria | 17198 |
| 376 | Ga0501032_0008677 | 3300049569 | Bacteria | 7405 |
| 377 | Ga0501032_0040248 | 3300049569 | Bacteria | 3177 |
| 378 | Ga0501032_0079131 | 3300049569 | Bacteria | 2188 |
| 379 | Ga0501032_0160232 | 3300049569 | Bacteria | 1478 |
| 380 | Ga0501032_0333759 | 3300049569 | Bacteria | 977 |
| 381 | Ga0501033_0018100 | 3300049570 | Bacteria | 5322 |
| 382 | Ga0501033_0050384 | 3300049570 | Bacteria | 3089 |
| 383 | Ga0501033_0061911 | 3300049570 | Bacteria | 2756 |
| 384 | Ga0501033_0311593 | 3300049570 | Bacteria | 1106 |
| 385 | Ga0501033_0312619 | 3300049570 | Bacteria | 1104 |
| 386 | Ga0501033_0412157 | 3300049570 | Bacteria | 941 |
| 387 | Ga0501033_0549950 | 3300049570 | Bacteria | 795 |
| 388 | Ga0501034_0003737 | 3300049571 | Bacteria | 17198 |
| 389 | Ga0501034_0017585 | 3300049571 | Bacteria | 7330 |
| 390 | Ga0501034_0089485 | 3300049571 | Bacteria | 3076 |
| 391 | Ga0501034_0102313 | 3300049571 | Bacteria | 2858 |
| 392 | Ga0501036_0001675 | 3300049572 | Bacteria | 17187 |
| 393 | Ga0501036_0004390 | 3300049572 | Bacteria | 11381 |
| 394 | Ga0501036_0005938 | 3300049572 | Bacteria | 9891 |
| 395 | Ga0501036_0033865 | 3300049572 | Bacteria | 4321 |
| 396 | Ga0501036_0106914 | 3300049572 | Bacteria | 2366 |
| 397 | Ga0501036_0167338 | 3300049572 | Bacteria | 1852 |
| 398 | Ga0501036_0512954 | 3300049572 | Bacteria | 997 |
| 399 | Ga0501036_1169688 | 3300049572 | Bacteria | 627 |
| 400 | Ga0501037_0002548 | 3300049573 | Bacteria | 13174 |
| 401 | Ga0501037_0020944 | 3300049573 | Bacteria | 4830 |
| 402 | Ga0501037_0058652 | 3300049573 | Bacteria | 2808 |
| 403 | Ga0501037_0431995 | 3300049573 | Bacteria | 900 |
| 404 | Ga0501037_0610895 | 3300049573 | Bacteria | 731 |
| 405 | Ga0501038_0002585 | 3300049574 | Bacteria | 16895 |
| 406 | Ga0501038_0047153 | 3300049574 | Bacteria | 3733 |
| 407 | Ga0501038_0049188 | 3300049574 | Bacteria | 3646 |
| 408 | Ga0501038_0049500 | 3300049574 | Bacteria | 3633 |
| 409 | Ga0501038_0224255 | 3300049574 | Bacteria | 1498 |
| 410 | Ga0501038_0277746 | 3300049574 | Bacteria | 1319 |
| 411 | Ga0501038_0723430 | 3300049574 | Bacteria | 744 |
| 412 | Ga0501039_0020906 | 3300049575 | Bacteria | 5018 |
| 413 | Ga0501039_0028578 | 3300049575 | Bacteria | 4292 |
| 414 | Ga0501039_0061682 | 3300049575 | Bacteria | 2904 |
| 415 | Ga0501039_0171294 | 3300049575 | Bacteria | 1707 |
| 416 | Ga0501039_0264600 | 3300049575 | Bacteria | 1351 |
| 417 | Ga0501039_0922680 | 3300049575 | Bacteria | 679 |
| 418 | Ga0501040_0010997 | 3300049576 | Bacteria | 5918 |
| 419 | Ga0501040_0037034 | 3300049576 | Bacteria | 3312 |
| 420 | Ga0501041_0002122 | 3300049577 | Bacteria | 11174 |
| 421 | Ga0501041_0199461 | 3300049577 | Bacteria | 1254 |
| 422 | Ga0501041_0745450 | 3300049577 | Bacteria | 627 |
| 423 | Ga0501041_0808070 | 3300049577 | Bacteria | 601 |
| 424 | Ga0501041_0847740 | 3300049577 | Bacteria | 587 |
| 425 | Ga0501042_0016005 | 3300049578 | Bacteria | 5144 |
| 426 | Ga0501042_0067397 | 3300049578 | Bacteria | 2558 |
| 427 | Ga0501042_0139533 | 3300049578 | Bacteria | 1747 |
| 428 | Ga0501042_0354562 | 3300049578 | Bacteria | 1061 |
| 429 | Ga0501042_0471586 | 3300049578 | Bacteria | 911 |
| 430 | Ga0501043_0002049 | 3300049579 | Bacteria | 17200 |
| 431 | Ga0501043_0027772 | 3300049579 | Bacteria | 4442 |
| 432 | Ga0501043_0037912 | 3300049579 | Bacteria | 3791 |
| 433 | Ga0501043_0042365 | 3300049579 | Bacteria | 3578 |
| 434 | Ga0501043_0090459 | 3300049579 | Bacteria | 2406 |
| 435 | Ga0501046_0005530 | 3300049580 | Bacteria | 11284 |
| 436 | Ga0501046_0028997 | 3300049580 | Bacteria | 4503 |
| 437 | Ga0501046_0126368 | 3300049580 | Bacteria | 1942 |
| 438 | Ga0501046_0185202 | 3300049580 | Bacteria | 1555 |
| 439 | Ga0501047_0000327 | 3300049581 | Bacteria | 54775 |
| 440 | Ga0501047_0002504 | 3300049581 | Bacteria | 17509 |
| 441 | Ga0501047_0023850 | 3300049581 | Bacteria | 5874 |
| 442 | Ga0501047_0049316 | 3300049581 | Bacteria | 4065 |
| 443 | Ga0501047_0093203 | 3300049581 | Bacteria | 2891 |
| 444 | Ga0501047_0166864 | 3300049581 | Bacteria | 2072 |
| 445 | Ga0501047_0234869 | 3300049581 | Bacteria | 1685 |
| 446 | Ga0501047_0528940 | 3300049581 | Bacteria | 1004 |
| 447 | Ga0501048_0004074 | 3300049582 | Bacteria | 11124 |
| 448 | Ga0501048_0045745 | 3300049582 | Bacteria | 3126 |
| 449 | Ga0501048_0240691 | 3300049582 | Bacteria | 1284 |
| 450 | Ga0501048_1143871 | 3300049582 | Bacteria | 560 |
| 451 | Ga0501067_0000438 | 3300049583 | Bacteria | 22797 |
| 452 | Ga0501068_0104953 | 3300049584 | Bacteria | 1753 |
| 453 | Ga0501068_0158618 | 3300049584 | Bacteria | 1425 |
| 454 | Ga0501068_0162211 | 3300049584 | Bacteria | 1409 |
| 455 | Ga0501068_0164304 | 3300049584 | Bacteria | 1400 |
| 456 | Ga0501069_0002036 | 3300049585 | Bacteria | 10131 |
| 457 | Ga0501069_0217413 | 3300049585 | Bacteria | 1110 |
| 458 | Ga0501069_0480027 | 3300049585 | Bacteria | 740 |
| 459 | Ga0501070_0005063 | 3300049586 | Bacteria | 11231 |
| 460 | Ga0501070_0019557 | 3300049586 | Bacteria | 5678 |
| 461 | Ga0501070_0056309 | 3300049586 | Bacteria | 3259 |
| 462 | Ga0501070_0063192 | 3300049586 | Bacteria | 3067 |
| 463 | Ga0501070_0101746 | 3300049586 | Bacteria | 2376 |
| 464 | Ga0501070_0299482 | 3300049586 | Bacteria | 1310 |
| 465 | Ga0501070_0302899 | 3300049586 | Bacteria | 1302 |
| 466 | Ga0501070_0305279 | 3300049586 | Bacteria | 1296 |
| 467 | Ga0501071_0000744 | 3300049587 | Bacteria | 17215 |
| 468 | Ga0501071_0002975 | 3300049587 | Bacteria | 10474 |
| 469 | Ga0501071_0200370 | 3300049587 | Bacteria | 1499 |
| 470 | Ga0501071_1528821 | 3300049587 | Bacteria | 515 |
| 471 | Ga0501072_0017899 | 3300049588 | Bacteria | 5448 |
| 472 | Ga0501072_0100074 | 3300049588 | Bacteria | 2304 |
| 473 | Ga0501072_0260095 | 3300049588 | Bacteria | 1381 |
| 474 | Ga0501072_0802575 | 3300049588 | Bacteria | 737 |
| 475 | Ga0501073_0105383 | 3300049589 | Bacteria | 1956 |
| 476 | Ga0501074_0001014 | 3300049590 | Bacteria | 18264 |
| 477 | Ga0501074_0022682 | 3300049590 | Bacteria | 4563 |
| 478 | Ga0501074_0089679 | 3300049590 | Bacteria | 2202 |
| 479 | Ga0501074_1201015 | 3300049590 | Bacteria | 532 |
| 480 | Ga0501075_0130020 | 3300049591 | Bacteria | 1918 |
| 481 | Ga0501076_0011109 | 3300049592 | Bacteria | 6699 |
| 482 | Ga0501076_0055548 | 3300049592 | Bacteria | 3140 |
| 483 | Ga0501076_0647936 | 3300049592 | Bacteria | 872 |
| 484 | Ga0501077_0023103 | 3300049593 | Bacteria | 3943 |
| 485 | Ga0501077_0321739 | 3300049593 | Bacteria | 986 |
| 486 | Ga0501077_0635939 | 3300049593 | Bacteria | 685 |
| 487 | Ga0501206_071121 | 3300049653 | Bacteria | 589 |
| 488 | Ga0501079_0001208 | 3300049741 | Bacteria | 18091 |
| 489 | Ga0501079_0277638 | 3300049741 | Bacteria | 1310 |
| 490 | Ga0501079_1092407 | 3300049741 | Bacteria | 628 |
| 491 | Ga0501080_0136169 | 3300049742 | Bacteria | 2273 |
| 492 | Ga0501080_0324627 | 3300049742 | Bacteria | 1393 |
| 493 | Ga0501080_0368392 | 3300049742 | Bacteria | 1295 |
| 494 | Ga0501080_1454278 | 3300049742 | Bacteria | 583 |
| 495 | Ga0501081_0082064 | 3300049743 | Bacteria | 2258 |
| 496 | Ga0501083_0020923 | 3300049744 | Bacteria | 4547 |
| 497 | Ga0501083_0154214 | 3300049744 | Bacteria | 1504 |
| 498 | Ga0501035_0006003 | 3300049822 | Bacteria | 11438 |
| 499 | Ga0501035_0017826 | 3300049822 | Bacteria | 6548 |
| 500 | Ga0501035_0076150 | 3300049822 | Bacteria | 2967 |
| 501 | Ga0501035_0099969 | 3300049822 | Bacteria | 2546 |
| 502 | Ga0501035_0120540 | 3300049822 | Bacteria | 2293 |
| 503 | Ga0501035_0188242 | 3300049822 | Bacteria | 1775 |
| 504 | Ga0501035_0345218 | 3300049822 | Bacteria | 1246 |
| 505 | Ga0501044_0001141 | 3300049823 | Bacteria | 31451 |
| 506 | Ga0501044_0003698 | 3300049823 | Bacteria | 17198 |
| 507 | Ga0501044_0051041 | 3300049823 | Bacteria | 4266 |
| 508 | Ga0501044_0066356 | 3300049823 | Bacteria | 3679 |
| 509 | Ga0501044_0067385 | 3300049823 | Bacteria | 3647 |
| 510 | Ga0501044_0261814 | 3300049823 | Bacteria | 1668 |
| 511 | Ga0501044_0339031 | 3300049823 | Bacteria | 1424 |
| 512 | Ga0501044_0449391 | 3300049823 | Bacteria | 1195 |
| 513 | Ga0501044_0742347 | 3300049823 | Bacteria | 864 |
| 514 | Ga0501044_0861021 | 3300049823 | Bacteria | 783 |
| 515 | Ga0501045_0027101 | 3300049824 | Bacteria | 4126 |
| 516 | Ga0501045_0030655 | 3300049824 | Bacteria | 3893 |
| 517 | Ga0501045_0083722 | 3300049824 | Bacteria | 2353 |
| 518 | Ga0501045_0097026 | 3300049824 | Bacteria | 2181 |
| 519 | Ga0501045_0167020 | 3300049824 | Bacteria | 1639 |
| 520 | Ga0501045_0296737 | 3300049824 | Bacteria | 1203 |
| 521 | Ga0501045_0904248 | 3300049824 | Bacteria | 648 |
| 522 | nmdc:mga00v17_337315_c1 | 3300050491 | Bacteria | 980 |
| 523 | nmdc:mga00v17_78846_c1 | 3300050491 | Bacteria | 2053 |
| 524 | nmdc:mga0yw44_185413_c1 | 3300050492 | Bacteria | 1371 |
| 525 | nmdc:mga0yw44_214218_c1 | 3300050492 | Bacteria | 1275 |
| 526 | nmdc:mga0yw44_26140_c1 | 3300050492 | Bacteria | 3330 |
| 527 | nmdc:mga0yw44_438301_c1 | 3300050492 | Bacteria | 885 |
| 528 | nmdc:mga06z11_184577_c1 | 3300050494 | Bacteria | 1204 |
| 529 | nmdc:mga07m45_492784_c1 | 3300050496 | Bacteria | 710 |
| 530 | nmdc:mga09592_210506_c1 | 3300050508 | Bacteria | 1151 |
| 531 | nmdc:mga09592_67959_c1 | 3300050508 | Bacteria | 3023 |
| 532 | nmdc:mga0qj67_302645_c1 | 3300050509 | Bacteria | 1295 |
| 533 | nmdc:mga0qj67_321596_c1 | 3300050509 | Bacteria | 1252 |
| 534 | nmdc:mga0qj67_64243_c1 | 3300050509 | Bacteria | 2919 |
| 535 | nmdc:mga06r32_2255_c1 | 3300050510 | Bacteria | 17254 |
| 536 | nmdc:mga06r32_271_c1 | 3300050510 | Bacteria | 43051 |
| 537 | nmdc:mga08y16_13323_c1 | 3300050511 | Bacteria | 8649 |
| 538 | nmdc:mga0rr50_1774261_c1 | 3300050513 | Bacteria | 519 |
| 539 | Ga0495612_0168966 | 3300053078 | Bacteria | 957 |
| 540 | Ga0495655_0169058 | 3300053083 | Bacteria | 699 |
| 541 | Ga0495595_0500715 | 3300053084 | Bacteria | 619 |
| 542 | Ga0500573_0028295 | 3300053140 | Bacteria | 3228 |
| 543 | Ga0501084_0027396 | 3300054114 | Bacteria | 4761 |
| 544 | Ga0501084_0725058 | 3300054114 | Bacteria | 838 |
| 545 | Ga0501084_1705613 | 3300054114 | Bacteria | 526 |
| 546 | Ga0501082_0002392 | 3300060353 | Bacteria | 16455 |
| 547 | Ga0501082_0120192 | 3300060353 | Bacteria | 2277 |
| 548 | Ga0466962_0000604 | 3300061719 | Bacteria | 15903 |
| 549 | Ga0530510_0087178 | 3300061734 | Bacteria | 2275 |
| 550 | Ga0530510_0170598 | 3300061734 | Bacteria | 1611 |
| 551 | Ga0530510_0520411 | 3300061734 | Bacteria | 902 |
| 552 | Ga0530510_0934766 | 3300061734 | Bacteria | 663 |
| 553 | 2585299048 | 2582581312 | Bacteria | 7308206 |
| 554 | 2643765433 | 2643221548 | Bacteria | 8053412 |
| 555 | 2643944415 | 2643221587 | Bacteria | 7586415 |
| 556 | 2644091756 | 2643221615 | Bacteria | 5487866 |
| 557 | 2644321559 | 2643221657 | Bacteria | 5490246 |
| 558 | 2644431313 | 2643221677 | Bacteria | 7584031 |
| 559 | 2644436705 | 2643221678 | Bacteria | 9540101 |
| 560 | 2644462496 | 2643221682 | Bacteria | 6743283 |
| 561 | 2793982612 | 2791355406 | Bacteria | 11364898 |
| 562 | 2804847548 | 2802429296 | Bacteria | 7227771 |
| 563 | 2808841605 | 2808606359 | Bacteria | 9866990 |
| 564 | 2809231796 | 2808606448 | Bacteria | 8656184 |
| 565 | 2811848556 | 2808606982 | Bacteria | 7791042 |
| 566 | 2819693369 | 2818991463 | Bacteria | 7948711 |
| 567 | 2862184618 | 2862178590 | Bacteria | 8583590 |
| 568 | 2862287782 | 2862281513 | Bacteria | 9621493 |
| 569 | 2862291632 | 2862290372 | Bacteria | 7471434 |
| 570 | 2862390403 | 2862382967 | Bacteria | 10317375 |
| 571 | 2862514989 | 2862507626 | Bacteria | 9425308 |
| 572 | 2862579683 | 2862574272 | Bacteria | 10567477 |
| 573 | 2863405167 | 2863404153 | Bacteria | 9672205 |
| 574 | 2867434383 | 2867428634 | Bacteria | 9590268 |
| 575 | 2867477279 | 2867475112 | Bacteria | 6909112 |
| 576 | 2873156209 | 2873151551 | Bacteria | 8625867 |
| 577 | 2875394107 | 2875391855 | Bacteria | 7600475 |
| 578 | 2877681578 | 2877676314 | Bacteria | 9512378 |
| 579 | 2912720515 | 2912715099 | Bacteria | 9460473 |
| 580 | 2912724707 | 2912723979 | Bacteria | 8557534 |
| 581 | 2912760222 | 2912757875 | Bacteria | 7940295 |
| 582 | 2918504097 | 2918501144 | Bacteria | 8668083 |
| 583 | 2919473405 | 2919468124 | Bacteria | 9133025 |
| 584 | 2935396716 | 2935390628 | Bacteria | 7043367 |
| 585 | 2966602976 | 2966598605 | Bacteria | 7676064 |
| 586 | 2990094250 | 2990088156 | Bacteria | 6657676 |
| 587 | 2997456815 | 2997451912 | Bacteria | 8492419 |
| 588 | 3006426035 | 3006425503 | Bacteria | 6491253 |
| 589 | 3006496477 | 3006493962 | Bacteria | 8825450 |
| 590 | 8008559900 | 8008558824 | Bacteria | 10610750 |
| 591 | 8025417394 | 8025413630 | Bacteria | 7014048 |
| 592 | 8025486215 | 8025478263 | Bacteria | 8209203 |
| 593 | 8025533138 | 8025530807 | Bacteria | 8495698 |
| 594 | 8047898532 | 8047893842 | Bacteria | 11723082 |
| 595 | 8048360378 | 8048356638 | Bacteria | 11044339 |
| 596 | 8048375494 | 8048369669 | Bacteria | 11666822 |
| 597 | 8048382711 | 8048379754 | Bacteria | 11877923 |
| 598 | JGI25160J50197_1062263 | |||
| 599 | LJQas_1004173 | |||
| 600 | JGI24740J21852_10020524 | |||
| 601 | JGI24737J22298_10230469 | |||
| 602 | JGI24735J21928_10094395 | |||
| 603 | JGI24751J29686_10090116 | |||
| 604 | JGI25406J46586_10070357 | |||
| 605 | rootH2_10007408 | |||
| 606 | rootH2_10053788 | |||
| 607 | rootL2_10009965 | |||
| 608 | rootH1_10009629 | |||
| 609 | Ga0070683_100488443 | |||
| 610 | Ga0070683_101262937 | |||
| 611 | Ga0070690_101528303 | |||
| 612 | Ga0070670_101752970 | |||
| 613 | Ga0070677_10291426 | |||
| 614 | Ga0070682_100672854 | |||
| 615 | Ga0068868_101416384 | |||
| 616 | Ga0070660_100279860 | |||
| 617 | Ga0070689_100761918 | |||
| 618 | Ga0070691_10089637 | |||
| 619 | Ga0070691_10145902 | |||
| 620 | Ga0070687_101380503 | |||
| 621 | Ga0070661_101660205 | |||
| 622 | Ga0070692_10369908 | |||
| 623 | Ga0070668_100212222 | |||
| 624 | Ga0070669_100430148 | |||
| 625 | Ga0070674_100160231 | |||
| 626 | Ga0070674_100365109 | |||
| 627 | Ga0070673_101207769 | |||
| 628 | Ga0070688_100491989 | |||
| 629 | Ga0070667_100529302 | |||
| 630 | Ga0070709_11061164 | |||
| 631 | Ga0070709_11260159 | |||
| 632 | Ga0070714_100386347 | |||
| 633 | Ga0070714_100823612 | |||
| 634 | Ga0070713_100307772 | |||
| 635 | Ga0070713_100498026 | |||
| 636 | Ga0070713_102108960 | |||
| 637 | Ga0070710_10156542 | |||
| 638 | Ga0070710_10173995 | |||
| 639 | Ga0070710_10372573 | |||
| 640 | Ga0070701_10121383 | |||
| 641 | Ga0070711_100415972 | |||
| 642 | Ga0070711_101005478 | |||
| 643 | Ga0070705_100136006 | |||
| 644 | Ga0070700_100150585 | |||
| 645 | Ga0070708_100678927 | |||
| 646 | Ga0070678_100511847 | |||
| 647 | Ga0070681_10811635 | |||
| 648 | Ga0070681_11160522 | |||
| 649 | Ga0068867_101436108 | |||
| 650 | Ga0070706_100219306 | |||
| 651 | Ga0070707_100019996 | |||
| 652 | Ga0070707_100664102 | |||
| 653 | Ga0070707_100766672 | |||
| 654 | Ga0070698_100001650 | |||
| 655 | Ga0070698_100022765 | |||
| 656 | Ga0070679_100002885 | |||
| 657 | Ga0070679_101217685 | |||
| 658 | Ga0070697_100460256 | |||
| 659 | Ga0070672_100633828 | |||
| 660 | Ga0070686_100480276 | |||
| 661 | Ga0070686_101409869 | |||
| 662 | Ga0070693_100581380 | |||
| 663 | Ga0070665_100435125 | |||
| 664 | Ga0070704_100569037 | |||
| 665 | Ga0068855_100077001 | |||
| 666 | Ga0068857_100169061 | |||
| 667 | Ga0068854_101274540 | |||
| 668 | Ga0068856_100383186 | |||
| 669 | Ga0068856_100857429 | |||
| 670 | Ga0068856_102135154 | |||
| 671 | Ga0070702_100931606 | |||
| 672 | Ga0068852_100515224 | |||
| 673 | Ga0068852_101860191 | |||
| 674 | Ga0068859_100441686 | |||
| 675 | Ga0068864_100057547 | |||
| 676 | Ga0068861_100154759 | |||
| 677 | Ga0068861_100214562 | |||
| 678 | Ga0068851_10160348 | |||
| 679 | Ga0068870_10158236 | |||
| 680 | Ga0068863_100870418 | |||
| 681 | Ga0068858_100013331 | |||
| 682 | Ga0068860_100000467 | |||
| 683 | Ga0068860_100054711 | |||
| 684 | Ga0081455_10163073 | |||
| 685 | Ga0081538_10150382 | |||
| 686 | Ga0081539_10013720 | |||
| 687 | Ga0081539_10084471 | |||
| 688 | Ga0070717_10120085 | |||
| 689 | Ga0075365_10049406 | |||
| 690 | Ga0075365_10170561 | |||
| 691 | Ga0075365_10207238 | |||
| 692 | Ga0075365_10280761 | |||
| 693 | Ga0075365_10295573 | |||
| 694 | Ga0075364_10119296 | |||
| 695 | Ga0075364_10412767 | |||
| 696 | Ga0075364_10445356 | |||
| 697 | Ga0070715_10013648 | |||
| 698 | Ga0070716_100022605 | |||
| 699 | Ga0075367_10408745 | |||
| 700 | Ga0075369_10368810 | |||
| 701 | Ga0097621_100170976 | |||
| 702 | Ga0075370_10096719 | |||
| 703 | Ga0068871_100072817 | |||
| 704 | Ga0068871_100829297 | |||
| 705 | Ga0075428_100006426 | |||
| 706 | Ga0075430_100009753 | |||
| 707 | Ga0075430_100582546 | |||
| 708 | Ga0075431_100000052 | |||
| 709 | Ga0075431_100011593 | |||
| 710 | Ga0075434_100122642 | |||
| 711 | Ga0075429_100008808 | |||
| 712 | Ga0068865_101051333 | |||
| 713 | Ga0097620_100441726 | |||
| 714 | Ga0075435_101085052 | |||
| 715 | Ga0105251_10158474 | |||
| 716 | Ga0111539_10047224 | |||
| 717 | Ga0111539_11380007 | |||
| 718 | Ga0105245_10408482 | |||
| 719 | Ga0105247_10035857 | |||
| 720 | Ga0105247_11355002 | |||
| 721 | Ga0105247_11418403 | |||
| 722 | Ga0114129_10098569 | |||
| 723 | Ga0105243_10156210 | |||
| 724 | Ga0105243_11131811 | |||
| 725 | Ga0105241_12408986 | |||
| 726 | Ga0105242_10713677 | |||
| 727 | Ga0105242_12100474 | |||
| 728 | Ga0105248_10674572 | |||
| 729 | Ga0105237_10085563 | |||
| 730 | Ga0105237_11406864 | |||
| 731 | Ga0105238_10089008 | |||
| 732 | Ga0105238_10179959 | |||
| 733 | Ga0105238_10797141 | |||
| 734 | Ga0105238_12722830 | |||
| 735 | Ga0105249_10279708 | |||
| 736 | Ga0105249_10539824 | |||
| 737 | Ga0105249_11967364 | |||
| 738 | Ga0105239_11056776 | |||
| 739 | Ga0105239_11069635 | |||
| 740 | Ga0105239_11489049 | |||
| 741 | Ga0105239_12162714 | |||
| 742 | Ga0105246_10345661 | |||
| 743 | Ga0105246_11475659 | |||
| 744 | Ga0105246_11599094 | |||
| 745 | Ga0105246_11702073 | |||
| 746 | Ga0157370_10305957 | |||
| 747 | Ga0157369_11859452 | |||
| 748 | Ga0157374_10117689 | |||
| 749 | Ga0157374_12347251 | |||
| 750 | Ga0157378_10688249 | |||
| 751 | Ga0163162_10405760 | |||
| 752 | Ga0163162_11725077 | |||
| 753 | Ga0157372_12304761 | |||
| 754 | Ga0157375_10459446 | |||
| 755 | Ga0157375_11207097 | |||
| 756 | Ga0163163_10038366 | |||
| 757 | Ga0163163_10277388 | |||
| 758 | Ga0163163_11716847 | |||
| 759 | Ga0157380_10565170 | |||
| 760 | Ga0182008_10175829 | |||
| 761 | Ga0157377_10376717 | |||
| 762 | Ga0157377_10878841 | |||
| 763 | Ga0157379_10006934 | |||
| 764 | Ga0157379_12302367 | |||
| 765 | Ga0157376_11400927 | |||
| 766 | Ga0163161_10099196 | |||
| 767 | Ga0206353_11349908 | |||
| 768 | Ga0209758_1007198 | |||
| 769 | Ga0207426_1001387 | |||
| 770 | Ga0207426_1014403 | |||
| 771 | Ga0207426_1039252 | |||
| 772 | Ga0207692_11019656 | |||
| 773 | Ga0207688_10178787 | |||
| 774 | Ga0207647_10044575 | |||
| 775 | Ga0207643_10045551 | |||
| 776 | Ga0207705_10016424 | |||
| 777 | Ga0207657_10244712 | |||
| 778 | Ga0207652_10017591 | |||
| 779 | Ga0207664_10018076 | |||
| 780 | Ga0207644_10345206 | |||
| 781 | Ga0207669_10133813 | |||
| 782 | Ga0207691_10063419 | |||
| 783 | Ga0207691_10547114 | |||
| 784 | Ga0207691_10744114 | |||
| 785 | Ga0207661_10386276 | |||
| 786 | Ga0207679_12179699 | |||
| 787 | Ga0207677_10114154 | |||
| 788 | Ga0207677_11353693 | |||
| 789 | Ga0207639_10243481 | |||
| 790 | Ga0207639_11827955 | |||
| 791 | Ga0207648_10368769 | |||
| 792 | Ga0207675_100332985 | |||
| 793 | Ga0207683_10940209 | |||
| 794 | Ga0207698_10191797 | |||
| 795 | Ga0207428_10023204 | |||
| 796 | Ga0268264_10000250 | |||
| 797 | Ga0307513_10000209 | |||
| 798 | Ga0307509_10007230 | |||
| 799 | Ga0307408_100731526 | |||
| 800 | Ga0307408_101674942 | |||
| 801 | Ga0307514_10006992 | |||
| 802 | Ga0316576_10922740 | |||
| 803 | Ga0316578_10093769 | |||
| 804 | Ga0307516_10005616 | |||
| 805 | Ga0307405_10210605 | |||
| 806 | Ga0307413_11224210 | |||
| 807 | Ga0307410_10631926 | |||
| 808 | Ga0307410_11384689 | |||
| 809 | Ga0307406_10298795 | |||
| 810 | Ga0307406_10809927 | |||
| 811 | Ga0307407_10256309 | |||
| 812 | Ga0307407_10512101 | |||
| 813 | Ga0307412_10033273 | |||
| 814 | Ga0307409_100007272 | |||
| 815 | Ga0307409_100034386 | |||
| 816 | Ga0307409_100183591 | |||
| 817 | Ga0307409_100392480 | |||
| 818 | Ga0307416_100000326 | |||
| 819 | Ga0307416_100114022 | |||
| 820 | Ga0307416_100124818 | |||
| 821 | Ga0307416_100588015 | |||
| 822 | Ga0307416_101123811 | |||
| 823 | Ga0307416_101149903 | |||
| 824 | Ga0307416_101742539 | |||
| 825 | Ga0307416_101977651 | |||
| 826 | Ga0307411_10002743 | |||
| 827 | Ga0307411_10356600 | |||
| 828 | Ga0307415_100000660 | |||
| 829 | Ga0307415_100131275 | |||
| 830 | Ga0307415_100398940 | |||
| 831 | Ga0307510_10024931 | |||
| 832 | Ga0307510_10368155 | |||
| 833 | Ga0316584_0123568 | |||
| 834 | Ga0395898_0170577 | |||
| 835 | Ga0395905_0223722 | |||
| 836 | Ga0436364_0516352 | |||
| 837 | Ga0436364_0528435 | |||
| 838 | Ga0395901_0116228 | |||
| 839 | Ga0436365_1227487 | |||
| 840 | Ga0439439_0083960 | |||
| 841 | Ga0439461_0015637 | |||
| 842 | Ga0439465_0199099 | |||
| 843 | Ga0451787_724674 | |||
| 844 | Ga0451791_1279547 | |||
| 845 | Ga0451797_0302219 | |||
| 846 | Ga0451797_0641885 | |||
| 847 | Ga0451800_0289522 | |||
| 848 | Ga0451804_0715057 | |||
| 849 | Ga0451807_1734761 | |||
| 850 | Ga0451833_1005422 | |||
| 851 | Ga0451835_1169925 | |||
| 852 | Ga0451837_0229405 | |||
| 853 | Ga0451837_1022782 | |||
| 854 | Ga0451837_1532142 | |||
| 855 | Ga0451837_1738520 | |||
| 856 | Ga0451839_0505972 | |||
| 857 | Ga0451841_0536699 | |||
| 858 | Ga0451841_0883659 | |||
| 859 | Ga0451841_1390613 | |||
| 860 | Ga0451847_0737900 | |||
| 861 | Ga0451851_1147222 | |||
| 862 | Ga0451843_1043714 | |||
| 863 | Ga0451855_0393681 | |||
| 864 | Ga0451853_2518537 | |||
| 865 | Ga0451853_2818236 | |||
| 866 | Ga0439431_0002237 | |||
| 867 | Ga0439442_087991 | |||
| 868 | Ga0439452_142804 | |||
| 869 | Ga0439457_127077 | |||
| 870 | Ga0439446_0179925 | |||
| 871 | Ga0439434_0003237 | |||
| 872 | Ga0466972_0011723 | |||
| 873 | Ga0466972_0019078 | |||
| 874 | Ga0466972_0054516 | |||
| 875 | Ga0466965_0001830 | |||
| 876 | Ga0466965_0016698 | |||
| 877 | Ga0466965_0032063 | |||
| 878 | Ga0466966_0056157 | |||
| 879 | Ga0466966_0157589 | |||
| 880 | Ga0466966_0455476 | |||
| 881 | Ga0466961_0000293 | |||
| 882 | Ga0466961_0048976 | |||
| 883 | Ga0466961_0070849 | |||
| 884 | Ga0466963_0003954 | |||
| 885 | Ga0466963_0014143 | |||
| 886 | Ga0466964_0013591 | |||
| 887 | Ga0466964_0015187 | |||
| 888 | Ga0466964_0149118 | |||
| 889 | Ga0466971_0002061 | |||
| 890 | Ga0466968_0270499 | |||
| 891 | Ga0466970_0000816 | |||
| 892 | Ga0466970_0010529 | |||
| 893 | Ga0466970_0205653 | |||
| 894 | Ga0466970_0461418 | |||
| 895 | Ga0466957_0001533 | |||
| 896 | Ga0466957_0029122 | |||
| 897 | Ga0466960_0002414 | |||
| 898 | Ga0466960_0011491 | |||
| 899 | Ga0466960_0175914 | |||
| 900 | Ga0466959_0038391 | |||
| 901 | Ga0466958_0006441 | |||
| 902 | Ga0466958_0040188 | |||
| 903 | Ga0466967_0048022 | |||
| 904 | Ga0466967_0054402 | |||
| 905 | Ga0466967_0191111 | |||
| 906 | Ga0466967_0217067 | |||
| 907 | Ga0495603_0002172 | |||
| 908 | Ga0495603_0010747 | |||
| 909 | Ga0495629_0001923 | |||
| 910 | Ga0495629_0015476 | |||
| 911 | Ga0495638_0223996 | |||
| 912 | Ga0495662_0018837 | |||
| 913 | Ga0495585_0240514 | |||
| 914 | Ga0495594_0003083 | |||
| 915 | Ga0495594_0290089 | |||
| 916 | Ga0495631_0142228 | |||
| 917 | Ga0495652_0852300 | |||
| 918 | Ga0495640_0146579 | |||
| 919 | Ga0495622_0022365 | |||
| 920 | Ga0495622_0426721 | |||
| 921 | Ga0495656_0097031 | |||
| 922 | Ga0495668_0772439 | |||
| 923 | Ga0495611_0058222 | |||
| 924 | Ga0495588_0005067 | |||
| 925 | Ga0495658_0317270 | |||
| 926 | Ga0495613_0003894 | |||
| 927 | Ga0495624_0112946 | |||
| 928 | Ga0495589_0145832 | |||
| 929 | Ga0495589_0337009 | |||
| 930 | Ga0495604_0099912 | |||
| 931 | Ga0495636_0108628 | |||
| 932 | Ga0495636_0206993 | |||
| 933 | Ga0495676_0010371 | |||
| 934 | Ga0495676_0010487 | |||
| 935 | Ga0495614_0030609 | |||
| 936 | Ga0496101_0373185 | |||
| 937 | Ga0496102_0207762 | |||
| 938 | Ga0496103_0652782 | |||
| 939 | Ga0496104_0034400 | |||
| 940 | Ga0496104_0239846 | |||
| 941 | Ga0496104_0258615 | |||
| 942 | Ga0496104_0612671 | |||
| 943 | Ga0496104_1770682 | |||
| 944 | Ga0496105_0011827 | |||
| 945 | Ga0496105_0500108 | |||
| 946 | Ga0496107_0086427 | |||
| 947 | Ga0496108_0083539 | |||
| 948 | Ga0496108_0151668 | |||
| 949 | Ga0496108_0184682 | |||
| 950 | Ga0496108_0550251 | |||
| 951 | Ga0496108_0774104 | |||
| 952 | Ga0496108_1257219 | |||
| 953 | Ga0496109_0187318 | |||
| 954 | Ga0496109_0286331 | |||
| 955 | Ga0496109_0350898 | |||
| 956 | Ga0496110_0045230 | |||
| 957 | Ga0496110_0583520 | |||
| 958 | Ga0496110_0959519 | |||
| 959 | Ga0496110_1217616 | |||
| 960 | Ga0496111_0647040 | |||
| 961 | Ga0496114_0044896 | |||
| 962 | Ga0496114_0095199 | |||
| 963 | Ga0496114_0231551 | |||
| 964 | Ga0496114_0458126 | |||
| 965 | Ga0496115_0007901 | |||
| 966 | Ga0496124_0767587 | |||
| 967 | Ga0501031_0009312 | |||
| 968 | Ga0501031_0064870 | |||
| 969 | Ga0501031_0152487 | |||
| 970 | Ga0501031_0345556 | |||
| 971 | Ga0501031_1102857 | |||
| 972 | Ga0501032_0001743 | |||
| 973 | Ga0501032_0008677 | |||
| 974 | Ga0501032_0040248 | |||
| 975 | Ga0501032_0079131 | |||
| 976 | Ga0501032_0160232 | |||
| 977 | Ga0501032_0333759 | |||
| 978 | Ga0501033_0018100 | |||
| 979 | Ga0501033_0050384 | |||
| 980 | Ga0501033_0061911 | |||
| 981 | Ga0501033_0311593 | |||
| 982 | Ga0501033_0312619 | |||
| 983 | Ga0501033_0412157 | |||
| 984 | Ga0501033_0549950 | |||
| 985 | Ga0501034_0003737 | |||
| 986 | Ga0501034_0017585 | |||
| 987 | Ga0501034_0089485 | |||
| 988 | Ga0501034_0102313 | |||
| 989 | Ga0501036_0001675 | |||
| 990 | Ga0501036_0004390 | |||
| 991 | Ga0501036_0005938 | |||
| 992 | Ga0501036_0033865 | |||
| 993 | Ga0501036_0106914 | |||
| 994 | Ga0501036_0167338 | |||
| 995 | Ga0501036_0512954 | |||
| 996 | Ga0501036_1169688 | |||
| 997 | Ga0501037_0002548 | |||
| 998 | Ga0501037_0020944 | |||
| 999 | Ga0501037_0058652 | |||
| 1000 | Ga0501037_0431995 | |||
| 1001 | Ga0501037_0610895 | |||
| 1002 | Ga0501038_0002585 | |||
| 1003 | Ga0501038_0047153 | |||
| 1004 | Ga0501038_0049188 | |||
| 1005 | Ga0501038_0049500 | |||
| 1006 | Ga0501038_0224255 | |||
| 1007 | Ga0501038_0277746 | |||
| 1008 | Ga0501038_0723430 | |||
| 1009 | Ga0501039_0020906 | |||
| 1010 | Ga0501039_0028578 | |||
| 1011 | Ga0501039_0061682 | |||
| 1012 | Ga0501039_0171294 | |||
| 1013 | Ga0501039_0264600 | |||
| 1014 | Ga0501039_0922680 | |||
| 1015 | Ga0501040_0010997 | |||
| 1016 | Ga0501040_0037034 | |||
| 1017 | Ga0501041_0002122 | |||
| 1018 | Ga0501041_0199461 | |||
| 1019 | Ga0501041_0745450 | |||
| 1020 | Ga0501041_0808070 | |||
| 1021 | Ga0501041_0847740 | |||
| 1022 | Ga0501042_0016005 | |||
| 1023 | Ga0501042_0067397 | |||
| 1024 | Ga0501042_0139533 | |||
| 1025 | Ga0501042_0354562 | |||
| 1026 | Ga0501042_0471586 | |||
| 1027 | Ga0501043_0002049 | |||
| 1028 | Ga0501043_0027772 | |||
| 1029 | Ga0501043_0037912 | |||
| 1030 | Ga0501043_0042365 | |||
| 1031 | Ga0501043_0090459 | |||
| 1032 | Ga0501046_0005530 | |||
| 1033 | Ga0501046_0028997 | |||
| 1034 | Ga0501046_0126368 | |||
| 1035 | Ga0501046_0185202 | |||
| 1036 | Ga0501047_0000327 | |||
| 1037 | Ga0501047_0002504 | |||
| 1038 | Ga0501047_0023850 | |||
| 1039 | Ga0501047_0049316 | |||
| 1040 | Ga0501047_0093203 | |||
| 1041 | Ga0501047_0166864 | |||
| 1042 | Ga0501047_0234869 | |||
| 1043 | Ga0501047_0528940 | |||
| 1044 | Ga0501048_0004074 | |||
| 1045 | Ga0501048_0045745 | |||
| 1046 | Ga0501048_0240691 | |||
| 1047 | Ga0501048_1143871 | |||
| 1048 | Ga0501067_0000438 | |||
| 1049 | Ga0501068_0104953 | |||
| 1050 | Ga0501068_0158618 | |||
| 1051 | Ga0501068_0162211 | |||
| 1052 | Ga0501068_0164304 | |||
| 1053 | Ga0501069_0002036 | |||
| 1054 | Ga0501069_0217413 | |||
| 1055 | Ga0501069_0480027 | |||
| 1056 | Ga0501070_0005063 | |||
| 1057 | Ga0501070_0019557 | |||
| 1058 | Ga0501070_0056309 | |||
| 1059 | Ga0501070_0063192 | |||
| 1060 | Ga0501070_0101746 | |||
| 1061 | Ga0501070_0299482 | |||
| 1062 | Ga0501070_0302899 | |||
| 1063 | Ga0501070_0305279 | |||
| 1064 | Ga0501071_0000744 | |||
| 1065 | Ga0501071_0002975 | |||
| 1066 | Ga0501071_0200370 | |||
| 1067 | Ga0501071_1528821 | |||
| 1068 | Ga0501072_0017899 | |||
| 1069 | Ga0501072_0100074 | |||
| 1070 | Ga0501072_0260095 | |||
| 1071 | Ga0501072_0802575 | |||
| 1072 | Ga0501073_0105383 | |||
| 1073 | Ga0501074_0001014 | |||
| 1074 | Ga0501074_0022682 | |||
| 1075 | Ga0501074_0089679 | |||
| 1076 | Ga0501074_1201015 | |||
| 1077 | Ga0501075_0130020 | |||
| 1078 | Ga0501076_0011109 | |||
| 1079 | Ga0501076_0055548 | |||
| 1080 | Ga0501076_0647936 | |||
| 1081 | Ga0501077_0023103 | |||
| 1082 | Ga0501077_0321739 | |||
| 1083 | Ga0501077_0635939 | |||
| 1084 | Ga0501206_071121 | |||
| 1085 | Ga0501079_0001208 | |||
| 1086 | Ga0501079_0277638 | |||
| 1087 | Ga0501079_1092407 | |||
| 1088 | Ga0501080_0136169 | |||
| 1089 | Ga0501080_0324627 | |||
| 1090 | Ga0501080_0368392 | |||
| 1091 | Ga0501080_1454278 | |||
| 1092 | Ga0501081_0082064 | |||
| 1093 | Ga0501083_0020923 | |||
| 1094 | Ga0501083_0154214 | |||
| 1095 | Ga0501035_0006003 | |||
| 1096 | Ga0501035_0017826 | |||
| 1097 | Ga0501035_0076150 | |||
| 1098 | Ga0501035_0099969 | |||
| 1099 | Ga0501035_0120540 | |||
| 1100 | Ga0501035_0188242 | |||
| 1101 | Ga0501035_0345218 | |||
| 1102 | Ga0501044_0001141 | |||
| 1103 | Ga0501044_0003698 | |||
| 1104 | Ga0501044_0051041 | |||
| 1105 | Ga0501044_0066356 | |||
| 1106 | Ga0501044_0067385 | |||
| 1107 | Ga0501044_0261814 | |||
| 1108 | Ga0501044_0339031 | |||
| 1109 | Ga0501044_0449391 | |||
| 1110 | Ga0501044_0742347 | |||
| 1111 | Ga0501044_0861021 | |||
| 1112 | Ga0501045_0027101 | |||
| 1113 | Ga0501045_0030655 | |||
| 1114 | Ga0501045_0083722 | |||
| 1115 | Ga0501045_0097026 | |||
| 1116 | Ga0501045_0167020 | |||
| 1117 | Ga0501045_0296737 | |||
| 1118 | Ga0501045_0904248 | |||
| 1119 | nmdc:mga00v17_337315_c1 | |||
| 1120 | nmdc:mga00v17_78846_c1 | |||
| 1121 | nmdc:mga0yw44_185413_c1 | |||
| 1122 | nmdc:mga0yw44_214218_c1 | |||
| 1123 | nmdc:mga0yw44_26140_c1 | |||
| 1124 | nmdc:mga0yw44_438301_c1 | |||
| 1125 | nmdc:mga06z11_184577_c1 | |||
| 1126 | nmdc:mga07m45_492784_c1 | |||
| 1127 | nmdc:mga09592_210506_c1 | |||
| 1128 | nmdc:mga09592_67959_c1 | |||
| 1129 | nmdc:mga0qj67_302645_c1 | |||
| 1130 | nmdc:mga0qj67_321596_c1 | |||
| 1131 | nmdc:mga0qj67_64243_c1 | |||
| 1132 | nmdc:mga06r32_2255_c1 | |||
| 1133 | nmdc:mga06r32_271_c1 | |||
| 1134 | nmdc:mga08y16_13323_c1 | |||
| 1135 | nmdc:mga0rr50_1774261_c1 | |||
| 1136 | Ga0495612_0168966 | |||
| 1137 | Ga0495655_0169058 | |||
| 1138 | Ga0495595_0500715 | |||
| 1139 | Ga0500573_0028295 | |||
| 1140 | Ga0501084_0027396 | |||
| 1141 | Ga0501084_0725058 | |||
| 1142 | Ga0501084_1705613 | |||
| 1143 | Ga0501082_0002392 | |||
| 1144 | Ga0501082_0120192 | |||
| 1145 | Ga0466962_0000604 | |||
| 1146 | Ga0530510_0087178 | |||
| 1147 | Ga0530510_0170598 | |||
| 1148 | Ga0530510_0520411 | |||
| 1149 | Ga0530510_0934766 | |||
| 1150 | 2585299048 | |||
| 1151 | 2643765433 | |||
| 1152 | 2643944415 | |||
| 1153 | 2644091756 | |||
| 1154 | 2644321559 | |||
| 1155 | 2644431313 | |||
| 1156 | 2644436705 | |||
| 1157 | 2644462496 | |||
| 1158 | 2793982612 | |||
| 1159 | 2804847548 | |||
| 1160 | 2808841605 | |||
| 1161 | 2809231796 | |||
| 1162 | 2811848556 | |||
| 1163 | 2819693369 | |||
| 1164 | 2862184618 | |||
| 1165 | 2862287782 | |||
| 1166 | 2862291632 | |||
| 1167 | 2862390403 | |||
| 1168 | 2862514989 | |||
| 1169 | 2862579683 | |||
| 1170 | 2863405167 | |||
| 1171 | 2867434383 | |||
| 1172 | 2867477279 | |||
| 1173 | 2873156209 | |||
| 1174 | 2875394107 | |||
| 1175 | 2877681578 | |||
| 1176 | 2912720515 | |||
| 1177 | 2912724707 | |||
| 1178 | 2912760222 | |||
| 1179 | 2918504097 | |||
| 1180 | 2919473405 | |||
| 1181 | 2935396716 | |||
| 1182 | 2966602976 | |||
| 1183 | 2990094250 | |||
| 1184 | 2997456815 | |||
| 1185 | 3006426035 | |||
| 1186 | 3006496477 | |||
| 1187 | 8008559900 | |||
| 1188 | 8025417394 | |||
| 1189 | 8025486215 | |||
| 1190 | 8025533138 | |||
| 1191 | 8047898532 | |||
| 1192 | 8048360378 | |||
| 1193 | 8048375494 | |||
| 1194 | 8048382711 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ryk-assembly1.cif.gz_A | solution nmr structure protein yjbj from escherichia coli. northeast structural genomics consortium target et93; ontario centre for structural proteomics target ec0298_1_69; | 0.9564 | 43 | 71 |
| 3o2h-assembly1.cif.gz_A | e. coli clps in complex with a leu n-end rule peptide | 0.9561 | 29 | 103 |
| 1r6o-assembly1.cif.gz_C | atp-dependent clp protease atp-binding subunit clpa/atp-dependent clp protease adaptor protein clps | 0.9535 | 29 | 103 |
| 3o1f-assembly2.cif.gz_B | p1 crystal form of e. coli clps at 1.4 a resolution | 0.9501 | 30 | 103 |
| 1mbx-assembly1.cif.gz_C | crystal structure analysis of clpsn with transition metal ion bound | 0.9456 | 28 | 103 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B5BNY0_223_353_1.10.287.70 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9752 | 43 | 67 | 1.10.287.70 |
| 4qe7A00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.9594 | 43 | 67 | 1.10.287.70 |
| 1rykA00 | Mainly Alpha;Orthogonal Bundle;Protein Yjbj; Chain: A;;YjbJ | 0.9564 | 43 | 71 | 1.10.1470.10 |
| af_P9WJY7_198_393_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.9451 | 43 | 66 | 1.20.1250.20 |
| 4ykaD00 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS | 0.9428 | 28 | 103 | 3.30.1390.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6P0HJ10-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 1.008 | 27 | 104 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A0D0IQR1-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 1.006 | 28 | 103 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A7U9K3C2-F1-model_v4 | deleted | 1.005 | 28 | 104 |
|
| AF-A0A4R9B908-F1-model_v4 | ATP-dependent Clp protease adapter protein ClpS | 1.002 | 27 | 104 |
GO:0006508
GO:0008233 GO:0030163 |
| AF-A0A7J9Y8C1-F1-model_v4 | ATP-dependent Clp protease adapter ClpS | 0.999 | 28 | 103 |
GO:0006508
GO:0008233 GO:0030163 |