F467624

General Info

Members Datasets Scaffolds Average Seq Length
597 331 1194 102

Family's Representative Sequence

Representative Sequence 3300003354|JGI25160J50197_1062263|JGI25160J50197_10622632
Length 120
Sequence MGPVSAHPSPTTTLRPHRCTLSVPVEIERPESSEAPFEVPXPDVPWVTIVHNDPVXLMSYVSYVFQSYFGYSKDKAHQLMLDVHHKGRAVVSSGSREEMERDVQAMHGYGLWATLQQDRR

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
141 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
163 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
164 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
165 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
166 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
167 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
168 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
169 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
172 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
173 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
174 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
175 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
176 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
177 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
178 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
179 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
180 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
183 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
208 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
258 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
259 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
283 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
284 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
285 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
286 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
287 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
288 2643221548 Streptomyces sp. Root55 Isolate Unclassified
289 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
290 2643221615 Nocardioides sp. Root224 Isolate Unclassified
291 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
292 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
293 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
294 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
295 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
296 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
297 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
298 2808606448 Streptomyces sp. 193411 Isolate Unclassified
299 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
300 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
301 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
302 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
303 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
304 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
305 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
306 2862574272 Streptomyces sp. AcE210 Isolate Nodule
307 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
308 2867428634 Streptomyces sp. RP5T Isolate Unclassified
309 2867475112 Streptomyces sp. TM32 Isolate Unclassified
310 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
311 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
312 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
313 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
314 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
315 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
316 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
317 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
318 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
319 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
320 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
321 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
322 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
323 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
324 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
325 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
326 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
327 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
328 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
329 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
330 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
331 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.29
Metatranscriptomes 0.17
Isolates 7.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.19
Nodule 0.5
Rhizoplane 6.37
Rhizosphere 80.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1062263 3300003354 Bacteria 740
2 LJQas_1004173 3300000549 Bacteria 1894
3 JGI24740J21852_10020524 3300001979 Bacteria 2302
4 JGI24737J22298_10230469 3300001990 Bacteria 547
5 JGI24735J21928_10094395 3300002067 Bacteria 858
6 JGI24751J29686_10090116 3300002459 Bacteria 638
7 JGI25406J46586_10070357 3300003203 Bacteria 1100
8 rootH2_10007408 3300003320 Bacteria 2299
9 rootH2_10053788 3300003320 Bacteria 4998
10 rootL2_10009965 3300003322 Bacteria 6392
11 rootH1_10009629 3300003323 Bacteria 3446
12 Ga0070683_100488443 3300005329 Bacteria 1176
13 Ga0070683_101262937 3300005329 Bacteria 710
14 Ga0070690_101528303 3300005330 Bacteria 540
15 Ga0070670_101752970 3300005331 Bacteria 572
16 Ga0070677_10291426 3300005333 Bacteria 826
17 Ga0070682_100672854 3300005337 Bacteria 827
18 Ga0068868_101416384 3300005338 Bacteria 649
19 Ga0070660_100279860 3300005339 Bacteria 1365
20 Ga0070689_100761918 3300005340 Bacteria 849
21 Ga0070691_10089637 3300005341 Bacteria 1515
22 Ga0070691_10145902 3300005341 Bacteria 1210
23 Ga0070687_101380503 3300005343 Bacteria 526
24 Ga0070661_101660205 3300005344 Bacteria 541
25 Ga0070692_10369908 3300005345 Bacteria 896
26 Ga0070668_100212222 3300005347 Bacteria 1593
27 Ga0070669_100430148 3300005353 Bacteria 1085
28 Ga0070674_100160231 3300005356 Bacteria 1707
29 Ga0070674_100365109 3300005356 Bacteria 1170
30 Ga0070673_101207769 3300005364 Bacteria 708
31 Ga0070688_100491989 3300005365 Bacteria 924
32 Ga0070667_100529302 3300005367 Bacteria 1082
33 Ga0070709_11061164 3300005434 Bacteria 647
34 Ga0070709_11260159 3300005434 Bacteria 595
35 Ga0070714_100386347 3300005435 Bacteria 1320
36 Ga0070714_100823612 3300005435 Bacteria 899
37 Ga0070713_100307772 3300005436 Bacteria 1460
38 Ga0070713_100498026 3300005436 Bacteria 1149
39 Ga0070713_102108960 3300005436 Bacteria 546
40 Ga0070710_10156542 3300005437 Bacteria 1409
41 Ga0070710_10173995 3300005437 Bacteria 1343
42 Ga0070710_10372573 3300005437 Bacteria 950
43 Ga0070701_10121383 3300005438 Bacteria 1473
44 Ga0070711_100415972 3300005439 Bacteria 1094
45 Ga0070711_101005478 3300005439 Bacteria 715
46 Ga0070705_100136006 3300005440 Bacteria 1610
47 Ga0070700_100150585 3300005441 Bacteria 1591
48 Ga0070708_100678927 3300005445 Bacteria 970
49 Ga0070678_100511847 3300005456 Bacteria 1061
50 Ga0070681_10811635 3300005458 Bacteria 853
51 Ga0070681_11160522 3300005458 Bacteria 694
52 Ga0068867_101436108 3300005459 Bacteria 641
53 Ga0070706_100219306 3300005467 Bacteria 1775
54 Ga0070707_100019996 3300005468 Bacteria 6312
55 Ga0070707_100664102 3300005468 Bacteria 1005
56 Ga0070707_100766672 3300005468 Bacteria 928
57 Ga0070698_100001650 3300005471 Bacteria 24887
58 Ga0070698_100022765 3300005471 Bacteria 6552
59 Ga0070679_100002885 3300005530 Bacteria 15616
60 Ga0070679_101217685 3300005530 Bacteria 698
61 Ga0070697_100460256 3300005536 Bacteria 1109
62 Ga0070672_100633828 3300005543 Bacteria 933
63 Ga0070686_100480276 3300005544 Bacteria 961
64 Ga0070686_101409869 3300005544 Bacteria 585
65 Ga0070693_100581380 3300005547 Bacteria 806
66 Ga0070665_100435125 3300005548 Bacteria 1321
67 Ga0070704_100569037 3300005549 Bacteria 992
68 Ga0068855_100077001 3300005563 Bacteria 3870
69 Ga0068857_100169061 3300005577 Bacteria 1987
70 Ga0068854_101274540 3300005578 Bacteria 661
71 Ga0068856_100383186 3300005614 Bacteria 1425
72 Ga0068856_100857429 3300005614 Bacteria 927
73 Ga0068856_102135154 3300005614 Bacteria 569
74 Ga0070702_100931606 3300005615 Bacteria 682
75 Ga0068852_100515224 3300005616 Bacteria 1193
76 Ga0068852_101860191 3300005616 Bacteria 624
77 Ga0068859_100441686 3300005617 Bacteria 1397
78 Ga0068864_100057547 3300005618 Bacteria 3359
79 Ga0068861_100154759 3300005719 Bacteria 1884
80 Ga0068861_100214562 3300005719 Bacteria 1623
81 Ga0068851_10160348 3300005834 Bacteria 1235
82 Ga0068870_10158236 3300005840 Bacteria 1341
83 Ga0068863_100870418 3300005841 Bacteria 900
84 Ga0068858_100013331 3300005842 Bacteria 7754
85 Ga0068860_100000467 3300005843 Bacteria 50515
86 Ga0068860_100054711 3300005843 Bacteria 3793
87 Ga0081455_10163073 3300005937 Bacteria 1706
88 Ga0081538_10150382 3300005981 Bacteria 1055
89 Ga0081539_10013720 3300005985 Bacteria 6081
90 Ga0081539_10084471 3300005985 Bacteria 1659
91 Ga0070717_10120085 3300006028 Bacteria 2251
92 Ga0075365_10049406 3300006038 Bacteria 2771
93 Ga0075365_10170561 3300006038 Bacteria 1519
94 Ga0075365_10207238 3300006038 Bacteria 1374
95 Ga0075365_10280761 3300006038 Bacteria 1172
96 Ga0075365_10295573 3300006038 Bacteria 1139
97 Ga0075364_10119296 3300006051 Bacteria 1765
98 Ga0075364_10412767 3300006051 Bacteria 921
99 Ga0075364_10445356 3300006051 Bacteria 885
100 Ga0070715_10013648 3300006163 Bacteria 2988
101 Ga0070716_100022605 3300006173 Bacteria 3325
102 Ga0075367_10408745 3300006178 Bacteria 859
103 Ga0075369_10368810 3300006186 Bacteria 675
104 Ga0097621_100170976 3300006237 Bacteria 1873
105 Ga0075370_10096719 3300006353 Bacteria 1706
106 Ga0068871_100072817 3300006358 Bacteria 2831
107 Ga0068871_100829297 3300006358 Bacteria 854
108 Ga0075428_100006426 3300006844 Bacteria 13075
109 Ga0075430_100009753 3300006846 Bacteria 8119
110 Ga0075430_100582546 3300006846 Bacteria 923
111 Ga0075431_100000052 3300006847 Bacteria 63044
112 Ga0075431_100011593 3300006847 Bacteria 8890
113 Ga0075434_100122642 3300006871 Bacteria 2615
114 Ga0075429_100008808 3300006880 Bacteria 8775
115 Ga0068865_101051333 3300006881 Bacteria 715
116 Ga0097620_100441726 3300006931 Bacteria 1397
117 Ga0075435_101085052 3300007076 Bacteria 700
118 Ga0105251_10158474 3300009011 Bacteria 1021
119 Ga0111539_10047224 3300009094 Bacteria 5147
120 Ga0111539_11380007 3300009094 Bacteria 817
121 Ga0105245_10408482 3300009098 Bacteria 1358
122 Ga0105247_10035857 3300009101 Bacteria 3024
123 Ga0105247_11355002 3300009101 Bacteria 574
124 Ga0105247_11418403 3300009101 Bacteria 563
125 Ga0114129_10098569 3300009147 Bacteria 4045
126 Ga0105243_10156210 3300009148 Bacteria 1962
127 Ga0105243_11131811 3300009148 Bacteria 793
128 Ga0105241_12408986 3300009174 Bacteria 526
129 Ga0105242_10713677 3300009176 Bacteria 983
130 Ga0105242_12100474 3300009176 Bacteria 609
131 Ga0105248_10674572 3300009177 Bacteria 1166
132 Ga0105237_10085563 3300009545 Bacteria 3143
133 Ga0105237_11406864 3300009545 Bacteria 704
134 Ga0105238_10089008 3300009551 Bacteria 3074
135 Ga0105238_10179959 3300009551 Bacteria 2091
136 Ga0105238_10797141 3300009551 Bacteria 960
137 Ga0105238_12722830 3300009551 Bacteria 531
138 Ga0105249_10279708 3300009553 Bacteria 1666
139 Ga0105249_10539824 3300009553 Bacteria 1216
140 Ga0105249_11967364 3300009553 Bacteria 657
141 Ga0105239_11056776 3300010375 Bacteria 934
142 Ga0105239_11069635 3300010375 Bacteria 928
143 Ga0105239_11489049 3300010375 Bacteria 782
144 Ga0105239_12162714 3300010375 Bacteria 647
145 Ga0105246_10345661 3300011119 Bacteria 1217
146 Ga0105246_11475659 3300011119 Bacteria 638
147 Ga0105246_11599094 3300011119 Bacteria 616
148 Ga0105246_11702073 3300011119 Bacteria 599
149 Ga0157370_10305957 3300013104 Bacteria 1467
150 Ga0157369_11859452 3300013105 Bacteria 611
151 Ga0157374_10117689 3300013296 Bacteria 2561
152 Ga0157374_12347251 3300013296 Bacteria 561
153 Ga0157378_10688249 3300013297 Bacteria 1041
154 Ga0163162_10405760 3300013306 Bacteria 1495
155 Ga0163162_11725077 3300013306 Bacteria 715
156 Ga0157372_12304761 3300013307 Bacteria 618
157 Ga0157375_10459446 3300013308 Bacteria 1439
158 Ga0157375_11207097 3300013308 Bacteria 887
159 Ga0163163_10038366 3300014325 Bacteria 4669
160 Ga0163163_10277388 3300014325 Bacteria 1728
161 Ga0163163_11716847 3300014325 Bacteria 688
162 Ga0157380_10565170 3300014326 Bacteria 1118
163 Ga0182008_10175829 3300014497 Bacteria 1082
164 Ga0157377_10376717 3300014745 Bacteria 960
165 Ga0157377_10878841 3300014745 Bacteria 668
166 Ga0157379_10006934 3300014968 Bacteria 9797
167 Ga0157379_12302367 3300014968 Bacteria 536
168 Ga0157376_11400927 3300014969 Bacteria 731
169 Ga0163161_10099196 3300017792 Bacteria 2165
170 Ga0206353_11349908 3300020082 Bacteria 933
171 Ga0209758_1007198 3300025297 Bacteria 7662
172 Ga0207426_1001387 3300025302 Bacteria 20464
173 Ga0207426_1014403 3300025302 Bacteria 2897
174 Ga0207426_1039252 3300025302 Bacteria 1484
175 Ga0207692_11019656 3300025898 Bacteria 547
176 Ga0207688_10178787 3300025901 Bacteria 1265
177 Ga0207647_10044575 3300025904 Bacteria 2770
178 Ga0207643_10045551 3300025908 Bacteria 2478
179 Ga0207705_10016424 3300025909 Bacteria 5307
180 Ga0207657_10244712 3300025919 Bacteria 1431
181 Ga0207652_10017591 3300025921 Bacteria 5852
182 Ga0207664_10018076 3300025929 Bacteria 5180
183 Ga0207644_10345206 3300025931 Bacteria 1208
184 Ga0207669_10133813 3300025937 Bacteria 1709
185 Ga0207691_10063419 3300025940 Bacteria 3351
186 Ga0207691_10547114 3300025940 Bacteria 982
187 Ga0207691_10744114 3300025940 Bacteria 826
188 Ga0207661_10386276 3300025944 Bacteria 1268
189 Ga0207679_12179699 3300025945 Bacteria 503
190 Ga0207677_10114154 3300026023 Bacteria 2018
191 Ga0207677_11353693 3300026023 Bacteria 655
192 Ga0207639_10243481 3300026041 Bacteria 1565
193 Ga0207639_11827955 3300026041 Bacteria 568
194 Ga0207648_10368769 3300026089 Bacteria 1296
195 Ga0207675_100332985 3300026118 Bacteria 1484
196 Ga0207683_10940209 3300026121 Bacteria 803
197 Ga0207698_10191797 3300026142 Bacteria 1821
198 Ga0207428_10023204 3300027907 Bacteria 5220
199 Ga0268264_10000250 3300028381 Bacteria 100909
200 Ga0307513_10000209 3300031456 Bacteria 84521
201 Ga0307509_10007230 3300031507 Bacteria 14611
202 Ga0307408_100731526 3300031548 Bacteria 892
203 Ga0307408_101674942 3300031548 Bacteria 605
204 Ga0307514_10006992 3300031649 Bacteria 9749
205 Ga0316576_10922740 3300031727 Bacteria 625
206 Ga0316578_10093769 3300031728 Bacteria 1795
207 Ga0307516_10005616 3300031730 Bacteria 14931
208 Ga0307405_10210605 3300031731 Bacteria 1419
209 Ga0307413_11224210 3300031824 Bacteria 654
210 Ga0307410_10631926 3300031852 Bacteria 896
211 Ga0307410_11384689 3300031852 Bacteria 617
212 Ga0307406_10298795 3300031901 Bacteria 1236
213 Ga0307406_10809927 3300031901 Bacteria 791
214 Ga0307407_10256309 3300031903 Bacteria 1201
215 Ga0307407_10512101 3300031903 Bacteria 881
216 Ga0307412_10033273 3300031911 Bacteria 3275
217 Ga0307409_100007272 3300031995 Bacteria 6607
218 Ga0307409_100034386 3300031995 Bacteria 3701
219 Ga0307409_100183591 3300031995 Bacteria 1854
220 Ga0307409_100392480 3300031995 Bacteria 1323
221 Ga0307416_100000326 3300032002 Bacteria 24620
222 Ga0307416_100114022 3300032002 Bacteria 2390
223 Ga0307416_100124818 3300032002 Bacteria 2304
224 Ga0307416_100588015 3300032002 Bacteria 1191
225 Ga0307416_101123811 3300032002 Bacteria 891
226 Ga0307416_101149903 3300032002 Bacteria 881
227 Ga0307416_101742539 3300032002 Bacteria 727
228 Ga0307416_101977651 3300032002 Bacteria 686
229 Ga0307411_10002743 3300032005 Bacteria 7915
230 Ga0307411_10356600 3300032005 Bacteria 1194
231 Ga0307415_100000660 3300032126 Bacteria 15214
232 Ga0307415_100131275 3300032126 Bacteria 1897
233 Ga0307415_100398940 3300032126 Bacteria 1174
234 Ga0307510_10024931 3300033180 Bacteria 6905
235 Ga0307510_10368155 3300033180 Bacteria 884
236 Ga0316584_0123568 3300036712 Bacteria 1933
237 Ga0395898_0170577 3300037466 Bacteria 2080
238 Ga0395905_0223722 3300037471 Bacteria 1761
239 Ga0436364_0516352 3300037853 Bacteria 571
240 Ga0436364_0528435 3300037853 Bacteria 652
241 Ga0395901_0116228 3300038443 Bacteria 2810
242 Ga0436365_1227487 3300039437 Bacteria 574
243 Ga0439439_0083960 3300041406 Bacteria 864
244 Ga0439461_0015637 3300041410 Bacteria 1456
245 Ga0439465_0199099 3300041413 Bacteria 729
246 Ga0451787_724674 3300041441 Bacteria 942
247 Ga0451791_1279547 3300041451 Bacteria 558
248 Ga0451797_0302219 3300041453 Bacteria 1058
249 Ga0451797_0641885 3300041453 Bacteria 1930
250 Ga0451800_0289522 3300041459 Bacteria 1444
251 Ga0451804_0715057 3300041463 Bacteria 596
252 Ga0451807_1734761 3300041486 Bacteria 1444
253 Ga0451833_1005422 3300041491 Bacteria 662
254 Ga0451835_1169925 3300041492 Bacteria 639
255 Ga0451837_0229405 3300041494 Bacteria 1493
256 Ga0451837_1022782 3300041494 Bacteria 757
257 Ga0451837_1532142 3300041494 Bacteria 575
258 Ga0451837_1738520 3300041494 Bacteria 957
259 Ga0451839_0505972 3300041496 Bacteria 553
260 Ga0451841_0536699 3300041498 Bacteria 1005
261 Ga0451841_0883659 3300041498 Bacteria 699
262 Ga0451841_1390613 3300041498 Bacteria 757
263 Ga0451847_0737900 3300041503 Bacteria 582
264 Ga0451851_1147222 3300041507 Bacteria 850
265 Ga0451843_1043714 3300041509 Bacteria 714
266 Ga0451855_0393681 3300041511 Bacteria 651
267 Ga0451853_2518537 3300041512 Bacteria 2480
268 Ga0451853_2818236 3300041512 Bacteria 1116
269 Ga0439431_0002237 3300041997 Bacteria 4268
270 Ga0439442_087991 3300042002 Bacteria 667
271 Ga0439452_142804 3300042010 Bacteria 506
272 Ga0439457_127077 3300042014 Bacteria 605
273 Ga0439446_0179925 3300042156 Bacteria 706
274 Ga0439434_0003237 3300042435 Bacteria 4781
275 Ga0466972_0011723 3300044658 Bacteria 4401
276 Ga0466972_0019078 3300044658 Bacteria 3429
277 Ga0466972_0054516 3300044658 Bacteria 1923
278 Ga0466965_0001830 3300044683 Bacteria 8843
279 Ga0466965_0016698 3300044683 Bacteria 3498
280 Ga0466965_0032063 3300044683 Bacteria 2566
281 Ga0466966_0056157 3300044684 Bacteria 2491
282 Ga0466966_0157589 3300044684 Bacteria 1383
283 Ga0466966_0455476 3300044684 Bacteria 769
284 Ga0466961_0000293 3300044693 Bacteria 33169
285 Ga0466961_0048976 3300044693 Bacteria 2701
286 Ga0466961_0070849 3300044693 Bacteria 2213
287 Ga0466963_0003954 3300044694 Bacteria 8574
288 Ga0466963_0014143 3300044694 Bacteria 4916
289 Ga0466964_0013591 3300044706 Bacteria 3089
290 Ga0466964_0015187 3300044706 Bacteria 2931
291 Ga0466964_0149118 3300044706 Bacteria 1082
292 Ga0466971_0002061 3300044719 Bacteria 8512
293 Ga0466968_0270499 3300044735 Bacteria 811
294 Ga0466970_0000816 3300044765 Bacteria 14971
295 Ga0466970_0010529 3300044765 Bacteria 4697
296 Ga0466970_0205653 3300044765 Bacteria 1096
297 Ga0466970_0461418 3300044765 Bacteria 729
298 Ga0466957_0001533 3300044842 Bacteria 12167
299 Ga0466957_0029122 3300044842 Bacteria 3292
300 Ga0466960_0002414 3300044901 Bacteria 7044
301 Ga0466960_0011491 3300044901 Bacteria 3708
302 Ga0466960_0175914 3300044901 Bacteria 1158
303 Ga0466959_0038391 3300045049 Bacteria 3538
304 Ga0466958_0006441 3300045836 Bacteria 6388
305 Ga0466958_0040188 3300045836 Bacteria 2811
306 Ga0466967_0048022 3300045976 Bacteria 3725
307 Ga0466967_0054402 3300045976 Bacteria 3522
308 Ga0466967_0191111 3300045976 Bacteria 1935
309 Ga0466967_0217067 3300045976 Bacteria 1816
310 Ga0495603_0002172 3300046455 Bacteria 11545
311 Ga0495603_0010747 3300046455 Bacteria 5552
312 Ga0495629_0001923 3300046459 Bacteria 16192
313 Ga0495629_0015476 3300046459 Bacteria 5477
314 Ga0495638_0223996 3300046460 Bacteria 1050
315 Ga0495662_0018837 3300046476 Bacteria 3340
316 Ga0495585_0240514 3300046492 Bacteria 906
317 Ga0495594_0003083 3300046499 Bacteria 8627
318 Ga0495594_0290089 3300046499 Bacteria 932
319 Ga0495631_0142228 3300046518 Bacteria 1030
320 Ga0495652_0852300 3300046529 Bacteria 604
321 Ga0495640_0146579 3300046533 Bacteria 1518
322 Ga0495622_0022365 3300046557 Bacteria 2946
323 Ga0495622_0426721 3300046557 Bacteria 569
324 Ga0495656_0097031 3300046615 Bacteria 1357
325 Ga0495668_0772439 3300046616 Bacteria 532
326 Ga0495611_0058222 3300046648 Bacteria 1752
327 Ga0495588_0005067 3300046674 Bacteria 5852
328 Ga0495658_0317270 3300046683 Bacteria 987
329 Ga0495613_0003894 3300046689 Bacteria 11168
330 Ga0495624_0112946 3300046690 Bacteria 1670
331 Ga0495589_0145832 3300046794 Bacteria 1132
332 Ga0495589_0337009 3300046794 Bacteria 696
333 Ga0495604_0099912 3300047317 Bacteria 2134
334 Ga0495636_0108628 3300047318 Bacteria 1219
335 Ga0495636_0206993 3300047318 Bacteria 897
336 Ga0495676_0010371 3300047321 Bacteria 8451
337 Ga0495676_0010487 3300047321 Bacteria 8404
338 Ga0495614_0030609 3300048089 Bacteria 2316
339 Ga0496101_0373185 3300048904 Bacteria 1122
340 Ga0496102_0207762 3300048905 Bacteria 1846
341 Ga0496103_0652782 3300048906 Bacteria 668
342 Ga0496104_0034400 3300048907 Bacteria 4725
343 Ga0496104_0239846 3300048907 Bacteria 1725
344 Ga0496104_0258615 3300048907 Bacteria 1654
345 Ga0496104_0612671 3300048907 Bacteria 999
346 Ga0496104_1770682 3300048907 Bacteria 520
347 Ga0496105_0011827 3300048908 Bacteria 6912
348 Ga0496105_0500108 3300048908 Bacteria 954
349 Ga0496107_0086427 3300048910 Bacteria 2289
350 Ga0496108_0083539 3300048911 Bacteria 2709
351 Ga0496108_0151668 3300048911 Bacteria 2000
352 Ga0496108_0184682 3300048911 Bacteria 1806
353 Ga0496108_0550251 3300048911 Bacteria 1007
354 Ga0496108_0774104 3300048911 Bacteria 829
355 Ga0496108_1257219 3300048911 Bacteria 624
356 Ga0496109_0187318 3300048912 Bacteria 1944
357 Ga0496109_0286331 3300048912 Bacteria 1553
358 Ga0496109_0350898 3300048912 Bacteria 1394
359 Ga0496110_0045230 3300048913 Bacteria 3847
360 Ga0496110_0583520 3300048913 Bacteria 1015
361 Ga0496110_0959519 3300048913 Bacteria 762
362 Ga0496110_1217616 3300048913 Bacteria 662
363 Ga0496111_0647040 3300048914 Bacteria 771
364 Ga0496114_0044896 3300048917 Bacteria 3668
365 Ga0496114_0095199 3300048917 Bacteria 2534
366 Ga0496114_0231551 3300048917 Bacteria 1623
367 Ga0496114_0458126 3300048917 Bacteria 1129
368 Ga0496115_0007901 3300048918 Bacteria 7847
369 Ga0496124_0767587 3300048927 Bacteria 602
370 Ga0501031_0009312 3300049568 Bacteria 6384
371 Ga0501031_0064870 3300049568 Bacteria 2379
372 Ga0501031_0152487 3300049568 Bacteria 1510
373 Ga0501031_0345556 3300049568 Bacteria 963
374 Ga0501031_1102857 3300049568 Bacteria 506
375 Ga0501032_0001743 3300049569 Bacteria 17198
376 Ga0501032_0008677 3300049569 Bacteria 7405
377 Ga0501032_0040248 3300049569 Bacteria 3177
378 Ga0501032_0079131 3300049569 Bacteria 2188
379 Ga0501032_0160232 3300049569 Bacteria 1478
380 Ga0501032_0333759 3300049569 Bacteria 977
381 Ga0501033_0018100 3300049570 Bacteria 5322
382 Ga0501033_0050384 3300049570 Bacteria 3089
383 Ga0501033_0061911 3300049570 Bacteria 2756
384 Ga0501033_0311593 3300049570 Bacteria 1106
385 Ga0501033_0312619 3300049570 Bacteria 1104
386 Ga0501033_0412157 3300049570 Bacteria 941
387 Ga0501033_0549950 3300049570 Bacteria 795
388 Ga0501034_0003737 3300049571 Bacteria 17198
389 Ga0501034_0017585 3300049571 Bacteria 7330
390 Ga0501034_0089485 3300049571 Bacteria 3076
391 Ga0501034_0102313 3300049571 Bacteria 2858
392 Ga0501036_0001675 3300049572 Bacteria 17187
393 Ga0501036_0004390 3300049572 Bacteria 11381
394 Ga0501036_0005938 3300049572 Bacteria 9891
395 Ga0501036_0033865 3300049572 Bacteria 4321
396 Ga0501036_0106914 3300049572 Bacteria 2366
397 Ga0501036_0167338 3300049572 Bacteria 1852
398 Ga0501036_0512954 3300049572 Bacteria 997
399 Ga0501036_1169688 3300049572 Bacteria 627
400 Ga0501037_0002548 3300049573 Bacteria 13174
401 Ga0501037_0020944 3300049573 Bacteria 4830
402 Ga0501037_0058652 3300049573 Bacteria 2808
403 Ga0501037_0431995 3300049573 Bacteria 900
404 Ga0501037_0610895 3300049573 Bacteria 731
405 Ga0501038_0002585 3300049574 Bacteria 16895
406 Ga0501038_0047153 3300049574 Bacteria 3733
407 Ga0501038_0049188 3300049574 Bacteria 3646
408 Ga0501038_0049500 3300049574 Bacteria 3633
409 Ga0501038_0224255 3300049574 Bacteria 1498
410 Ga0501038_0277746 3300049574 Bacteria 1319
411 Ga0501038_0723430 3300049574 Bacteria 744
412 Ga0501039_0020906 3300049575 Bacteria 5018
413 Ga0501039_0028578 3300049575 Bacteria 4292
414 Ga0501039_0061682 3300049575 Bacteria 2904
415 Ga0501039_0171294 3300049575 Bacteria 1707
416 Ga0501039_0264600 3300049575 Bacteria 1351
417 Ga0501039_0922680 3300049575 Bacteria 679
418 Ga0501040_0010997 3300049576 Bacteria 5918
419 Ga0501040_0037034 3300049576 Bacteria 3312
420 Ga0501041_0002122 3300049577 Bacteria 11174
421 Ga0501041_0199461 3300049577 Bacteria 1254
422 Ga0501041_0745450 3300049577 Bacteria 627
423 Ga0501041_0808070 3300049577 Bacteria 601
424 Ga0501041_0847740 3300049577 Bacteria 587
425 Ga0501042_0016005 3300049578 Bacteria 5144
426 Ga0501042_0067397 3300049578 Bacteria 2558
427 Ga0501042_0139533 3300049578 Bacteria 1747
428 Ga0501042_0354562 3300049578 Bacteria 1061
429 Ga0501042_0471586 3300049578 Bacteria 911
430 Ga0501043_0002049 3300049579 Bacteria 17200
431 Ga0501043_0027772 3300049579 Bacteria 4442
432 Ga0501043_0037912 3300049579 Bacteria 3791
433 Ga0501043_0042365 3300049579 Bacteria 3578
434 Ga0501043_0090459 3300049579 Bacteria 2406
435 Ga0501046_0005530 3300049580 Bacteria 11284
436 Ga0501046_0028997 3300049580 Bacteria 4503
437 Ga0501046_0126368 3300049580 Bacteria 1942
438 Ga0501046_0185202 3300049580 Bacteria 1555
439 Ga0501047_0000327 3300049581 Bacteria 54775
440 Ga0501047_0002504 3300049581 Bacteria 17509
441 Ga0501047_0023850 3300049581 Bacteria 5874
442 Ga0501047_0049316 3300049581 Bacteria 4065
443 Ga0501047_0093203 3300049581 Bacteria 2891
444 Ga0501047_0166864 3300049581 Bacteria 2072
445 Ga0501047_0234869 3300049581 Bacteria 1685
446 Ga0501047_0528940 3300049581 Bacteria 1004
447 Ga0501048_0004074 3300049582 Bacteria 11124
448 Ga0501048_0045745 3300049582 Bacteria 3126
449 Ga0501048_0240691 3300049582 Bacteria 1284
450 Ga0501048_1143871 3300049582 Bacteria 560
451 Ga0501067_0000438 3300049583 Bacteria 22797
452 Ga0501068_0104953 3300049584 Bacteria 1753
453 Ga0501068_0158618 3300049584 Bacteria 1425
454 Ga0501068_0162211 3300049584 Bacteria 1409
455 Ga0501068_0164304 3300049584 Bacteria 1400
456 Ga0501069_0002036 3300049585 Bacteria 10131
457 Ga0501069_0217413 3300049585 Bacteria 1110
458 Ga0501069_0480027 3300049585 Bacteria 740
459 Ga0501070_0005063 3300049586 Bacteria 11231
460 Ga0501070_0019557 3300049586 Bacteria 5678
461 Ga0501070_0056309 3300049586 Bacteria 3259
462 Ga0501070_0063192 3300049586 Bacteria 3067
463 Ga0501070_0101746 3300049586 Bacteria 2376
464 Ga0501070_0299482 3300049586 Bacteria 1310
465 Ga0501070_0302899 3300049586 Bacteria 1302
466 Ga0501070_0305279 3300049586 Bacteria 1296
467 Ga0501071_0000744 3300049587 Bacteria 17215
468 Ga0501071_0002975 3300049587 Bacteria 10474
469 Ga0501071_0200370 3300049587 Bacteria 1499
470 Ga0501071_1528821 3300049587 Bacteria 515
471 Ga0501072_0017899 3300049588 Bacteria 5448
472 Ga0501072_0100074 3300049588 Bacteria 2304
473 Ga0501072_0260095 3300049588 Bacteria 1381
474 Ga0501072_0802575 3300049588 Bacteria 737
475 Ga0501073_0105383 3300049589 Bacteria 1956
476 Ga0501074_0001014 3300049590 Bacteria 18264
477 Ga0501074_0022682 3300049590 Bacteria 4563
478 Ga0501074_0089679 3300049590 Bacteria 2202
479 Ga0501074_1201015 3300049590 Bacteria 532
480 Ga0501075_0130020 3300049591 Bacteria 1918
481 Ga0501076_0011109 3300049592 Bacteria 6699
482 Ga0501076_0055548 3300049592 Bacteria 3140
483 Ga0501076_0647936 3300049592 Bacteria 872
484 Ga0501077_0023103 3300049593 Bacteria 3943
485 Ga0501077_0321739 3300049593 Bacteria 986
486 Ga0501077_0635939 3300049593 Bacteria 685
487 Ga0501206_071121 3300049653 Bacteria 589
488 Ga0501079_0001208 3300049741 Bacteria 18091
489 Ga0501079_0277638 3300049741 Bacteria 1310
490 Ga0501079_1092407 3300049741 Bacteria 628
491 Ga0501080_0136169 3300049742 Bacteria 2273
492 Ga0501080_0324627 3300049742 Bacteria 1393
493 Ga0501080_0368392 3300049742 Bacteria 1295
494 Ga0501080_1454278 3300049742 Bacteria 583
495 Ga0501081_0082064 3300049743 Bacteria 2258
496 Ga0501083_0020923 3300049744 Bacteria 4547
497 Ga0501083_0154214 3300049744 Bacteria 1504
498 Ga0501035_0006003 3300049822 Bacteria 11438
499 Ga0501035_0017826 3300049822 Bacteria 6548
500 Ga0501035_0076150 3300049822 Bacteria 2967
501 Ga0501035_0099969 3300049822 Bacteria 2546
502 Ga0501035_0120540 3300049822 Bacteria 2293
503 Ga0501035_0188242 3300049822 Bacteria 1775
504 Ga0501035_0345218 3300049822 Bacteria 1246
505 Ga0501044_0001141 3300049823 Bacteria 31451
506 Ga0501044_0003698 3300049823 Bacteria 17198
507 Ga0501044_0051041 3300049823 Bacteria 4266
508 Ga0501044_0066356 3300049823 Bacteria 3679
509 Ga0501044_0067385 3300049823 Bacteria 3647
510 Ga0501044_0261814 3300049823 Bacteria 1668
511 Ga0501044_0339031 3300049823 Bacteria 1424
512 Ga0501044_0449391 3300049823 Bacteria 1195
513 Ga0501044_0742347 3300049823 Bacteria 864
514 Ga0501044_0861021 3300049823 Bacteria 783
515 Ga0501045_0027101 3300049824 Bacteria 4126
516 Ga0501045_0030655 3300049824 Bacteria 3893
517 Ga0501045_0083722 3300049824 Bacteria 2353
518 Ga0501045_0097026 3300049824 Bacteria 2181
519 Ga0501045_0167020 3300049824 Bacteria 1639
520 Ga0501045_0296737 3300049824 Bacteria 1203
521 Ga0501045_0904248 3300049824 Bacteria 648
522 nmdc:mga00v17_337315_c1 3300050491 Bacteria 980
523 nmdc:mga00v17_78846_c1 3300050491 Bacteria 2053
524 nmdc:mga0yw44_185413_c1 3300050492 Bacteria 1371
525 nmdc:mga0yw44_214218_c1 3300050492 Bacteria 1275
526 nmdc:mga0yw44_26140_c1 3300050492 Bacteria 3330
527 nmdc:mga0yw44_438301_c1 3300050492 Bacteria 885
528 nmdc:mga06z11_184577_c1 3300050494 Bacteria 1204
529 nmdc:mga07m45_492784_c1 3300050496 Bacteria 710
530 nmdc:mga09592_210506_c1 3300050508 Bacteria 1151
531 nmdc:mga09592_67959_c1 3300050508 Bacteria 3023
532 nmdc:mga0qj67_302645_c1 3300050509 Bacteria 1295
533 nmdc:mga0qj67_321596_c1 3300050509 Bacteria 1252
534 nmdc:mga0qj67_64243_c1 3300050509 Bacteria 2919
535 nmdc:mga06r32_2255_c1 3300050510 Bacteria 17254
536 nmdc:mga06r32_271_c1 3300050510 Bacteria 43051
537 nmdc:mga08y16_13323_c1 3300050511 Bacteria 8649
538 nmdc:mga0rr50_1774261_c1 3300050513 Bacteria 519
539 Ga0495612_0168966 3300053078 Bacteria 957
540 Ga0495655_0169058 3300053083 Bacteria 699
541 Ga0495595_0500715 3300053084 Bacteria 619
542 Ga0500573_0028295 3300053140 Bacteria 3228
543 Ga0501084_0027396 3300054114 Bacteria 4761
544 Ga0501084_0725058 3300054114 Bacteria 838
545 Ga0501084_1705613 3300054114 Bacteria 526
546 Ga0501082_0002392 3300060353 Bacteria 16455
547 Ga0501082_0120192 3300060353 Bacteria 2277
548 Ga0466962_0000604 3300061719 Bacteria 15903
549 Ga0530510_0087178 3300061734 Bacteria 2275
550 Ga0530510_0170598 3300061734 Bacteria 1611
551 Ga0530510_0520411 3300061734 Bacteria 902
552 Ga0530510_0934766 3300061734 Bacteria 663
553 2585299048 2582581312 Bacteria 7308206
554 2643765433 2643221548 Bacteria 8053412
555 2643944415 2643221587 Bacteria 7586415
556 2644091756 2643221615 Bacteria 5487866
557 2644321559 2643221657 Bacteria 5490246
558 2644431313 2643221677 Bacteria 7584031
559 2644436705 2643221678 Bacteria 9540101
560 2644462496 2643221682 Bacteria 6743283
561 2793982612 2791355406 Bacteria 11364898
562 2804847548 2802429296 Bacteria 7227771
563 2808841605 2808606359 Bacteria 9866990
564 2809231796 2808606448 Bacteria 8656184
565 2811848556 2808606982 Bacteria 7791042
566 2819693369 2818991463 Bacteria 7948711
567 2862184618 2862178590 Bacteria 8583590
568 2862287782 2862281513 Bacteria 9621493
569 2862291632 2862290372 Bacteria 7471434
570 2862390403 2862382967 Bacteria 10317375
571 2862514989 2862507626 Bacteria 9425308
572 2862579683 2862574272 Bacteria 10567477
573 2863405167 2863404153 Bacteria 9672205
574 2867434383 2867428634 Bacteria 9590268
575 2867477279 2867475112 Bacteria 6909112
576 2873156209 2873151551 Bacteria 8625867
577 2875394107 2875391855 Bacteria 7600475
578 2877681578 2877676314 Bacteria 9512378
579 2912720515 2912715099 Bacteria 9460473
580 2912724707 2912723979 Bacteria 8557534
581 2912760222 2912757875 Bacteria 7940295
582 2918504097 2918501144 Bacteria 8668083
583 2919473405 2919468124 Bacteria 9133025
584 2935396716 2935390628 Bacteria 7043367
585 2966602976 2966598605 Bacteria 7676064
586 2990094250 2990088156 Bacteria 6657676
587 2997456815 2997451912 Bacteria 8492419
588 3006426035 3006425503 Bacteria 6491253
589 3006496477 3006493962 Bacteria 8825450
590 8008559900 8008558824 Bacteria 10610750
591 8025417394 8025413630 Bacteria 7014048
592 8025486215 8025478263 Bacteria 8209203
593 8025533138 8025530807 Bacteria 8495698
594 8047898532 8047893842 Bacteria 11723082
595 8048360378 8048356638 Bacteria 11044339
596 8048375494 8048369669 Bacteria 11666822
597 8048382711 8048379754 Bacteria 11877923
598 JGI25160J50197_1062263
599 LJQas_1004173
600 JGI24740J21852_10020524
601 JGI24737J22298_10230469
602 JGI24735J21928_10094395
603 JGI24751J29686_10090116
604 JGI25406J46586_10070357
605 rootH2_10007408
606 rootH2_10053788
607 rootL2_10009965
608 rootH1_10009629
609 Ga0070683_100488443
610 Ga0070683_101262937
611 Ga0070690_101528303
612 Ga0070670_101752970
613 Ga0070677_10291426
614 Ga0070682_100672854
615 Ga0068868_101416384
616 Ga0070660_100279860
617 Ga0070689_100761918
618 Ga0070691_10089637
619 Ga0070691_10145902
620 Ga0070687_101380503
621 Ga0070661_101660205
622 Ga0070692_10369908
623 Ga0070668_100212222
624 Ga0070669_100430148
625 Ga0070674_100160231
626 Ga0070674_100365109
627 Ga0070673_101207769
628 Ga0070688_100491989
629 Ga0070667_100529302
630 Ga0070709_11061164
631 Ga0070709_11260159
632 Ga0070714_100386347
633 Ga0070714_100823612
634 Ga0070713_100307772
635 Ga0070713_100498026
636 Ga0070713_102108960
637 Ga0070710_10156542
638 Ga0070710_10173995
639 Ga0070710_10372573
640 Ga0070701_10121383
641 Ga0070711_100415972
642 Ga0070711_101005478
643 Ga0070705_100136006
644 Ga0070700_100150585
645 Ga0070708_100678927
646 Ga0070678_100511847
647 Ga0070681_10811635
648 Ga0070681_11160522
649 Ga0068867_101436108
650 Ga0070706_100219306
651 Ga0070707_100019996
652 Ga0070707_100664102
653 Ga0070707_100766672
654 Ga0070698_100001650
655 Ga0070698_100022765
656 Ga0070679_100002885
657 Ga0070679_101217685
658 Ga0070697_100460256
659 Ga0070672_100633828
660 Ga0070686_100480276
661 Ga0070686_101409869
662 Ga0070693_100581380
663 Ga0070665_100435125
664 Ga0070704_100569037
665 Ga0068855_100077001
666 Ga0068857_100169061
667 Ga0068854_101274540
668 Ga0068856_100383186
669 Ga0068856_100857429
670 Ga0068856_102135154
671 Ga0070702_100931606
672 Ga0068852_100515224
673 Ga0068852_101860191
674 Ga0068859_100441686
675 Ga0068864_100057547
676 Ga0068861_100154759
677 Ga0068861_100214562
678 Ga0068851_10160348
679 Ga0068870_10158236
680 Ga0068863_100870418
681 Ga0068858_100013331
682 Ga0068860_100000467
683 Ga0068860_100054711
684 Ga0081455_10163073
685 Ga0081538_10150382
686 Ga0081539_10013720
687 Ga0081539_10084471
688 Ga0070717_10120085
689 Ga0075365_10049406
690 Ga0075365_10170561
691 Ga0075365_10207238
692 Ga0075365_10280761
693 Ga0075365_10295573
694 Ga0075364_10119296
695 Ga0075364_10412767
696 Ga0075364_10445356
697 Ga0070715_10013648
698 Ga0070716_100022605
699 Ga0075367_10408745
700 Ga0075369_10368810
701 Ga0097621_100170976
702 Ga0075370_10096719
703 Ga0068871_100072817
704 Ga0068871_100829297
705 Ga0075428_100006426
706 Ga0075430_100009753
707 Ga0075430_100582546
708 Ga0075431_100000052
709 Ga0075431_100011593
710 Ga0075434_100122642
711 Ga0075429_100008808
712 Ga0068865_101051333
713 Ga0097620_100441726
714 Ga0075435_101085052
715 Ga0105251_10158474
716 Ga0111539_10047224
717 Ga0111539_11380007
718 Ga0105245_10408482
719 Ga0105247_10035857
720 Ga0105247_11355002
721 Ga0105247_11418403
722 Ga0114129_10098569
723 Ga0105243_10156210
724 Ga0105243_11131811
725 Ga0105241_12408986
726 Ga0105242_10713677
727 Ga0105242_12100474
728 Ga0105248_10674572
729 Ga0105237_10085563
730 Ga0105237_11406864
731 Ga0105238_10089008
732 Ga0105238_10179959
733 Ga0105238_10797141
734 Ga0105238_12722830
735 Ga0105249_10279708
736 Ga0105249_10539824
737 Ga0105249_11967364
738 Ga0105239_11056776
739 Ga0105239_11069635
740 Ga0105239_11489049
741 Ga0105239_12162714
742 Ga0105246_10345661
743 Ga0105246_11475659
744 Ga0105246_11599094
745 Ga0105246_11702073
746 Ga0157370_10305957
747 Ga0157369_11859452
748 Ga0157374_10117689
749 Ga0157374_12347251
750 Ga0157378_10688249
751 Ga0163162_10405760
752 Ga0163162_11725077
753 Ga0157372_12304761
754 Ga0157375_10459446
755 Ga0157375_11207097
756 Ga0163163_10038366
757 Ga0163163_10277388
758 Ga0163163_11716847
759 Ga0157380_10565170
760 Ga0182008_10175829
761 Ga0157377_10376717
762 Ga0157377_10878841
763 Ga0157379_10006934
764 Ga0157379_12302367
765 Ga0157376_11400927
766 Ga0163161_10099196
767 Ga0206353_11349908
768 Ga0209758_1007198
769 Ga0207426_1001387
770 Ga0207426_1014403
771 Ga0207426_1039252
772 Ga0207692_11019656
773 Ga0207688_10178787
774 Ga0207647_10044575
775 Ga0207643_10045551
776 Ga0207705_10016424
777 Ga0207657_10244712
778 Ga0207652_10017591
779 Ga0207664_10018076
780 Ga0207644_10345206
781 Ga0207669_10133813
782 Ga0207691_10063419
783 Ga0207691_10547114
784 Ga0207691_10744114
785 Ga0207661_10386276
786 Ga0207679_12179699
787 Ga0207677_10114154
788 Ga0207677_11353693
789 Ga0207639_10243481
790 Ga0207639_11827955
791 Ga0207648_10368769
792 Ga0207675_100332985
793 Ga0207683_10940209
794 Ga0207698_10191797
795 Ga0207428_10023204
796 Ga0268264_10000250
797 Ga0307513_10000209
798 Ga0307509_10007230
799 Ga0307408_100731526
800 Ga0307408_101674942
801 Ga0307514_10006992
802 Ga0316576_10922740
803 Ga0316578_10093769
804 Ga0307516_10005616
805 Ga0307405_10210605
806 Ga0307413_11224210
807 Ga0307410_10631926
808 Ga0307410_11384689
809 Ga0307406_10298795
810 Ga0307406_10809927
811 Ga0307407_10256309
812 Ga0307407_10512101
813 Ga0307412_10033273
814 Ga0307409_100007272
815 Ga0307409_100034386
816 Ga0307409_100183591
817 Ga0307409_100392480
818 Ga0307416_100000326
819 Ga0307416_100114022
820 Ga0307416_100124818
821 Ga0307416_100588015
822 Ga0307416_101123811
823 Ga0307416_101149903
824 Ga0307416_101742539
825 Ga0307416_101977651
826 Ga0307411_10002743
827 Ga0307411_10356600
828 Ga0307415_100000660
829 Ga0307415_100131275
830 Ga0307415_100398940
831 Ga0307510_10024931
832 Ga0307510_10368155
833 Ga0316584_0123568
834 Ga0395898_0170577
835 Ga0395905_0223722
836 Ga0436364_0516352
837 Ga0436364_0528435
838 Ga0395901_0116228
839 Ga0436365_1227487
840 Ga0439439_0083960
841 Ga0439461_0015637
842 Ga0439465_0199099
843 Ga0451787_724674
844 Ga0451791_1279547
845 Ga0451797_0302219
846 Ga0451797_0641885
847 Ga0451800_0289522
848 Ga0451804_0715057
849 Ga0451807_1734761
850 Ga0451833_1005422
851 Ga0451835_1169925
852 Ga0451837_0229405
853 Ga0451837_1022782
854 Ga0451837_1532142
855 Ga0451837_1738520
856 Ga0451839_0505972
857 Ga0451841_0536699
858 Ga0451841_0883659
859 Ga0451841_1390613
860 Ga0451847_0737900
861 Ga0451851_1147222
862 Ga0451843_1043714
863 Ga0451855_0393681
864 Ga0451853_2518537
865 Ga0451853_2818236
866 Ga0439431_0002237
867 Ga0439442_087991
868 Ga0439452_142804
869 Ga0439457_127077
870 Ga0439446_0179925
871 Ga0439434_0003237
872 Ga0466972_0011723
873 Ga0466972_0019078
874 Ga0466972_0054516
875 Ga0466965_0001830
876 Ga0466965_0016698
877 Ga0466965_0032063
878 Ga0466966_0056157
879 Ga0466966_0157589
880 Ga0466966_0455476
881 Ga0466961_0000293
882 Ga0466961_0048976
883 Ga0466961_0070849
884 Ga0466963_0003954
885 Ga0466963_0014143
886 Ga0466964_0013591
887 Ga0466964_0015187
888 Ga0466964_0149118
889 Ga0466971_0002061
890 Ga0466968_0270499
891 Ga0466970_0000816
892 Ga0466970_0010529
893 Ga0466970_0205653
894 Ga0466970_0461418
895 Ga0466957_0001533
896 Ga0466957_0029122
897 Ga0466960_0002414
898 Ga0466960_0011491
899 Ga0466960_0175914
900 Ga0466959_0038391
901 Ga0466958_0006441
902 Ga0466958_0040188
903 Ga0466967_0048022
904 Ga0466967_0054402
905 Ga0466967_0191111
906 Ga0466967_0217067
907 Ga0495603_0002172
908 Ga0495603_0010747
909 Ga0495629_0001923
910 Ga0495629_0015476
911 Ga0495638_0223996
912 Ga0495662_0018837
913 Ga0495585_0240514
914 Ga0495594_0003083
915 Ga0495594_0290089
916 Ga0495631_0142228
917 Ga0495652_0852300
918 Ga0495640_0146579
919 Ga0495622_0022365
920 Ga0495622_0426721
921 Ga0495656_0097031
922 Ga0495668_0772439
923 Ga0495611_0058222
924 Ga0495588_0005067
925 Ga0495658_0317270
926 Ga0495613_0003894
927 Ga0495624_0112946
928 Ga0495589_0145832
929 Ga0495589_0337009
930 Ga0495604_0099912
931 Ga0495636_0108628
932 Ga0495636_0206993
933 Ga0495676_0010371
934 Ga0495676_0010487
935 Ga0495614_0030609
936 Ga0496101_0373185
937 Ga0496102_0207762
938 Ga0496103_0652782
939 Ga0496104_0034400
940 Ga0496104_0239846
941 Ga0496104_0258615
942 Ga0496104_0612671
943 Ga0496104_1770682
944 Ga0496105_0011827
945 Ga0496105_0500108
946 Ga0496107_0086427
947 Ga0496108_0083539
948 Ga0496108_0151668
949 Ga0496108_0184682
950 Ga0496108_0550251
951 Ga0496108_0774104
952 Ga0496108_1257219
953 Ga0496109_0187318
954 Ga0496109_0286331
955 Ga0496109_0350898
956 Ga0496110_0045230
957 Ga0496110_0583520
958 Ga0496110_0959519
959 Ga0496110_1217616
960 Ga0496111_0647040
961 Ga0496114_0044896
962 Ga0496114_0095199
963 Ga0496114_0231551
964 Ga0496114_0458126
965 Ga0496115_0007901
966 Ga0496124_0767587
967 Ga0501031_0009312
968 Ga0501031_0064870
969 Ga0501031_0152487
970 Ga0501031_0345556
971 Ga0501031_1102857
972 Ga0501032_0001743
973 Ga0501032_0008677
974 Ga0501032_0040248
975 Ga0501032_0079131
976 Ga0501032_0160232
977 Ga0501032_0333759
978 Ga0501033_0018100
979 Ga0501033_0050384
980 Ga0501033_0061911
981 Ga0501033_0311593
982 Ga0501033_0312619
983 Ga0501033_0412157
984 Ga0501033_0549950
985 Ga0501034_0003737
986 Ga0501034_0017585
987 Ga0501034_0089485
988 Ga0501034_0102313
989 Ga0501036_0001675
990 Ga0501036_0004390
991 Ga0501036_0005938
992 Ga0501036_0033865
993 Ga0501036_0106914
994 Ga0501036_0167338
995 Ga0501036_0512954
996 Ga0501036_1169688
997 Ga0501037_0002548
998 Ga0501037_0020944
999 Ga0501037_0058652
1000 Ga0501037_0431995
1001 Ga0501037_0610895
1002 Ga0501038_0002585
1003 Ga0501038_0047153
1004 Ga0501038_0049188
1005 Ga0501038_0049500
1006 Ga0501038_0224255
1007 Ga0501038_0277746
1008 Ga0501038_0723430
1009 Ga0501039_0020906
1010 Ga0501039_0028578
1011 Ga0501039_0061682
1012 Ga0501039_0171294
1013 Ga0501039_0264600
1014 Ga0501039_0922680
1015 Ga0501040_0010997
1016 Ga0501040_0037034
1017 Ga0501041_0002122
1018 Ga0501041_0199461
1019 Ga0501041_0745450
1020 Ga0501041_0808070
1021 Ga0501041_0847740
1022 Ga0501042_0016005
1023 Ga0501042_0067397
1024 Ga0501042_0139533
1025 Ga0501042_0354562
1026 Ga0501042_0471586
1027 Ga0501043_0002049
1028 Ga0501043_0027772
1029 Ga0501043_0037912
1030 Ga0501043_0042365
1031 Ga0501043_0090459
1032 Ga0501046_0005530
1033 Ga0501046_0028997
1034 Ga0501046_0126368
1035 Ga0501046_0185202
1036 Ga0501047_0000327
1037 Ga0501047_0002504
1038 Ga0501047_0023850
1039 Ga0501047_0049316
1040 Ga0501047_0093203
1041 Ga0501047_0166864
1042 Ga0501047_0234869
1043 Ga0501047_0528940
1044 Ga0501048_0004074
1045 Ga0501048_0045745
1046 Ga0501048_0240691
1047 Ga0501048_1143871
1048 Ga0501067_0000438
1049 Ga0501068_0104953
1050 Ga0501068_0158618
1051 Ga0501068_0162211
1052 Ga0501068_0164304
1053 Ga0501069_0002036
1054 Ga0501069_0217413
1055 Ga0501069_0480027
1056 Ga0501070_0005063
1057 Ga0501070_0019557
1058 Ga0501070_0056309
1059 Ga0501070_0063192
1060 Ga0501070_0101746
1061 Ga0501070_0299482
1062 Ga0501070_0302899
1063 Ga0501070_0305279
1064 Ga0501071_0000744
1065 Ga0501071_0002975
1066 Ga0501071_0200370
1067 Ga0501071_1528821
1068 Ga0501072_0017899
1069 Ga0501072_0100074
1070 Ga0501072_0260095
1071 Ga0501072_0802575
1072 Ga0501073_0105383
1073 Ga0501074_0001014
1074 Ga0501074_0022682
1075 Ga0501074_0089679
1076 Ga0501074_1201015
1077 Ga0501075_0130020
1078 Ga0501076_0011109
1079 Ga0501076_0055548
1080 Ga0501076_0647936
1081 Ga0501077_0023103
1082 Ga0501077_0321739
1083 Ga0501077_0635939
1084 Ga0501206_071121
1085 Ga0501079_0001208
1086 Ga0501079_0277638
1087 Ga0501079_1092407
1088 Ga0501080_0136169
1089 Ga0501080_0324627
1090 Ga0501080_0368392
1091 Ga0501080_1454278
1092 Ga0501081_0082064
1093 Ga0501083_0020923
1094 Ga0501083_0154214
1095 Ga0501035_0006003
1096 Ga0501035_0017826
1097 Ga0501035_0076150
1098 Ga0501035_0099969
1099 Ga0501035_0120540
1100 Ga0501035_0188242
1101 Ga0501035_0345218
1102 Ga0501044_0001141
1103 Ga0501044_0003698
1104 Ga0501044_0051041
1105 Ga0501044_0066356
1106 Ga0501044_0067385
1107 Ga0501044_0261814
1108 Ga0501044_0339031
1109 Ga0501044_0449391
1110 Ga0501044_0742347
1111 Ga0501044_0861021
1112 Ga0501045_0027101
1113 Ga0501045_0030655
1114 Ga0501045_0083722
1115 Ga0501045_0097026
1116 Ga0501045_0167020
1117 Ga0501045_0296737
1118 Ga0501045_0904248
1119 nmdc:mga00v17_337315_c1
1120 nmdc:mga00v17_78846_c1
1121 nmdc:mga0yw44_185413_c1
1122 nmdc:mga0yw44_214218_c1
1123 nmdc:mga0yw44_26140_c1
1124 nmdc:mga0yw44_438301_c1
1125 nmdc:mga06z11_184577_c1
1126 nmdc:mga07m45_492784_c1
1127 nmdc:mga09592_210506_c1
1128 nmdc:mga09592_67959_c1
1129 nmdc:mga0qj67_302645_c1
1130 nmdc:mga0qj67_321596_c1
1131 nmdc:mga0qj67_64243_c1
1132 nmdc:mga06r32_2255_c1
1133 nmdc:mga06r32_271_c1
1134 nmdc:mga08y16_13323_c1
1135 nmdc:mga0rr50_1774261_c1
1136 Ga0495612_0168966
1137 Ga0495655_0169058
1138 Ga0495595_0500715
1139 Ga0500573_0028295
1140 Ga0501084_0027396
1141 Ga0501084_0725058
1142 Ga0501084_1705613
1143 Ga0501082_0002392
1144 Ga0501082_0120192
1145 Ga0466962_0000604
1146 Ga0530510_0087178
1147 Ga0530510_0170598
1148 Ga0530510_0520411
1149 Ga0530510_0934766
1150 2585299048
1151 2643765433
1152 2643944415
1153 2644091756
1154 2644321559
1155 2644431313
1156 2644436705
1157 2644462496
1158 2793982612
1159 2804847548
1160 2808841605
1161 2809231796
1162 2811848556
1163 2819693369
1164 2862184618
1165 2862287782
1166 2862291632
1167 2862390403
1168 2862514989
1169 2862579683
1170 2863405167
1171 2867434383
1172 2867477279
1173 2873156209
1174 2875394107
1175 2877681578
1176 2912720515
1177 2912724707
1178 2912760222
1179 2918504097
1180 2919473405
1181 2935396716
1182 2966602976
1183 2990094250
1184 2997456815
1185 3006426035
1186 3006496477
1187 8008559900
1188 8025417394
1189 8025486215
1190 8025533138
1191 8047898532
1192 8048360378
1193 8048375494
1194 8048382711

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02617

ClpS

ATP-dependent Clp protease adaptor protein ClpS

41

114

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ryk-assembly1.cif.gz_A solution nmr structure protein yjbj from escherichia coli. northeast structural genomics consortium target et93; ontario centre for structural proteomics target ec0298_1_69; 0.9564 43 71
3o2h-assembly1.cif.gz_A e. coli clps in complex with a leu n-end rule peptide 0.9561 29 103
1r6o-assembly1.cif.gz_C atp-dependent clp protease atp-binding subunit clpa/atp-dependent clp protease adaptor protein clps 0.9535 29 103
3o1f-assembly2.cif.gz_B p1 crystal form of e. coli clps at 1.4 a resolution 0.9501 30 103
1mbx-assembly1.cif.gz_C crystal structure analysis of clpsn with transition metal ion bound 0.9456 28 103
ID Description Score Start End Superfamily
af_B5BNY0_223_353_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9752 43 67 1.10.287.70
4qe7A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9594 43 67 1.10.287.70
1rykA00 Mainly Alpha;Orthogonal Bundle;Protein Yjbj; Chain: A;;YjbJ 0.9564 43 71 1.10.1470.10
af_P9WJY7_198_393_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9451 43 66 1.20.1250.20
4ykaD00 Alpha Beta;2-Layer Sandwich;Ribosomal Protein L30; Chain: A,;Ribosomal protein L7/L12, C-terminal domain/Adaptor protein ClpS 0.9428 28 103 3.30.1390.10
ID Description Score Start End GO Terms
AF-A0A6P0HJ10-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 1.008 27 104 GO:0006508
GO:0008233
GO:0030163
AF-A0A0D0IQR1-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 1.006 28 103 GO:0006508
GO:0008233
GO:0030163
AF-A0A7U9K3C2-F1-model_v4 deleted 1.005 28 104
AF-A0A4R9B908-F1-model_v4 ATP-dependent Clp protease adapter protein ClpS 1.002 27 104 GO:0006508
GO:0008233
GO:0030163
AF-A0A7J9Y8C1-F1-model_v4 ATP-dependent Clp protease adapter ClpS 0.999 28 103 GO:0006508
GO:0008233
GO:0030163

Map