F467604
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 596 | 337 | 596 | 319 |
Family's Representative Sequence
| Representative Sequence | 3300049824|Ga0501045_0087567|Ga0501045_0087567_1139_2287 |
| Length | 382 |
| Sequence | VAREEAHLRLPAAVVAGELVDEDDRRSVAGLLVMKAGAVVRASVWHRFFAKRRPLSLHHILMGSPVRALIACFVLGFSSLVSAQAGYPNRPIRLIVTVPPGGAADFIARLVGGKVADALGQPVLVENRGGAGGTIAADAVAKAPADGYTLLQNSITTHGVGPHLYSKLPYDPVKDFAAVGGLALLPLVMAVNADLSAKTVDEVISLSKKTSLNFASSGNGGAPHMAAELFKSVTGAALTHVPYKGSGPAVADLVGGRVQIMFDAPPSLIQHIRGGKLRVLAAASAQRNRLLPEAPTFAELGYPQVAVSLWYGLLAPAGTPRPVIARLNAEVSRALQSSEVRDRLQAQGAEPMPGTPEAFAAFMREEMAKWAPVVKQAGVKLD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 2 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 3 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 4 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 5 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 64 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 65 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 66 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 67 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 68 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 69 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 70 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 71 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 77 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 78 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 82 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 83 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 93 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 94 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 95 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 97 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 98 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 173 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 176 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 178 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 179 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 182 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 183 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 196 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 198 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 200 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 202 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 203 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 204 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 206 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 208 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 210 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 221 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 222 | 3300042117 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 | Metagenome | Rhizosphere |
| 223 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 224 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 225 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 226 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 315 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 317 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 318 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 319 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 333 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 334 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 335 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.21 |
| Nodule | 0 |
| Rhizoplane | 4.7 |
| Rhizosphere | 88.42 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10009334 | 3300001991 | Bacteria | 1736 |
| 2 | JGI24738J21930_10018815 | 3300002075 | Unclassified | 1443 |
| 3 | JGI24744J21845_10013371 | 3300002077 | Unclassified | 1655 |
| 4 | JGI24742J22300_10008724 | 3300002244 | Unclassified | 1671 |
| 5 | JGI25153J46596_10002964 | 3300003215 | Bacteria | 9616 |
| 6 | JGI25153J46596_10004430 | 3300003215 | Bacteria | 7576 |
| 7 | Ga0065712_10076209 | 3300005290 | Bacteria | 3710 |
| 8 | Ga0070683_100007986 | 3300005329 | Bacteria | 8978 |
| 9 | Ga0070683_100080356 | 3300005329 | Bacteria | 3052 |
| 10 | Ga0070690_100002470 | 3300005330 | Bacteria | 9938 |
| 11 | Ga0070670_100046961 | 3300005331 | Bacteria | 3715 |
| 12 | Ga0070677_10030825 | 3300005333 | Bacteria | 2044 |
| 13 | Ga0068869_100063712 | 3300005334 | Unclassified | 2709 |
| 14 | Ga0068869_100095903 | 3300005334 | Bacteria | 2238 |
| 15 | Ga0068869_100309620 | 3300005334 | Bacteria | 1278 |
| 16 | Ga0070666_10021763 | 3300005335 | Bacteria | 4156 |
| 17 | Ga0070680_100013168 | 3300005336 | Bacteria | 6438 |
| 18 | Ga0070680_100025401 | 3300005336 | Bacteria | 4735 |
| 19 | Ga0070682_100122885 | 3300005337 | Bacteria | 1745 |
| 20 | Ga0068868_100005853 | 3300005338 | Bacteria | 8669 |
| 21 | Ga0068868_100006058 | 3300005338 | Bacteria | 8539 |
| 22 | Ga0068868_100008082 | 3300005338 | Bacteria | 7525 |
| 23 | Ga0070689_100013130 | 3300005340 | Bacteria | 5986 |
| 24 | Ga0070691_10001532 | 3300005341 | Bacteria | 9941 |
| 25 | Ga0070691_10133705 | 3300005341 | Unclassified | 1259 |
| 26 | Ga0070687_100000563 | 3300005343 | Bacteria | 12391 |
| 27 | Ga0070661_100006718 | 3300005344 | Bacteria | 7931 |
| 28 | Ga0070661_100052899 | 3300005344 | Bacteria | 2971 |
| 29 | Ga0070668_100157882 | 3300005347 | Unclassified | 1838 |
| 30 | Ga0070669_100004794 | 3300005353 | Bacteria | 9761 |
| 31 | Ga0070675_100000678 | 3300005354 | Bacteria | 23632 |
| 32 | Ga0070675_100042286 | 3300005354 | Bacteria | 3723 |
| 33 | Ga0070671_100000403 | 3300005355 | Bacteria | 29810 |
| 34 | Ga0070671_100182696 | 3300005355 | Bacteria | 1776 |
| 35 | Ga0070674_100010484 | 3300005356 | Bacteria | 5606 |
| 36 | Ga0070673_100005786 | 3300005364 | Bacteria | 7963 |
| 37 | Ga0070659_100243602 | 3300005366 | Unclassified | 1489 |
| 38 | Ga0070667_100293096 | 3300005367 | Bacteria | 1464 |
| 39 | Ga0070667_100336110 | 3300005367 | Bacteria | 1365 |
| 40 | Ga0070703_10051590 | 3300005406 | Bacteria | 1317 |
| 41 | Ga0070714_100026265 | 3300005435 | Bacteria | 4811 |
| 42 | Ga0070713_100103250 | 3300005436 | Bacteria | 2473 |
| 43 | Ga0070713_100485481 | 3300005436 | Unclassified | 1164 |
| 44 | Ga0070701_10000846 | 3300005438 | Bacteria | 10972 |
| 45 | Ga0070705_100007263 | 3300005440 | Bacteria | 5449 |
| 46 | Ga0070705_100011771 | 3300005440 | Bacteria | 4426 |
| 47 | Ga0070700_100027753 | 3300005441 | Bacteria | 3360 |
| 48 | Ga0070694_100004374 | 3300005444 | Bacteria | 8500 |
| 49 | Ga0070694_100036957 | 3300005444 | Bacteria | 3237 |
| 50 | Ga0070694_100095538 | 3300005444 | Bacteria | 2093 |
| 51 | Ga0070678_100004377 | 3300005456 | Bacteria | 8000 |
| 52 | Ga0070662_100048244 | 3300005457 | Bacteria | 3067 |
| 53 | Ga0070681_10004036 | 3300005458 | Bacteria | 13848 |
| 54 | Ga0070681_10085487 | 3300005458 | Bacteria | 3106 |
| 55 | Ga0068867_100001052 | 3300005459 | Bacteria | 18822 |
| 56 | Ga0068867_100027859 | 3300005459 | Bacteria | 4064 |
| 57 | Ga0068867_100191118 | 3300005459 | Unclassified | 1634 |
| 58 | Ga0070685_10137947 | 3300005466 | Unclassified | 1532 |
| 59 | Ga0070706_100038959 | 3300005467 | Bacteria | 4387 |
| 60 | Ga0070707_100066222 | 3300005468 | Bacteria | 3471 |
| 61 | Ga0070698_100084696 | 3300005471 | Bacteria | 3158 |
| 62 | Ga0070698_100265190 | 3300005471 | Bacteria | 1649 |
| 63 | Ga0070699_100003640 | 3300005518 | Bacteria | 13637 |
| 64 | Ga0070699_100019712 | 3300005518 | Bacteria | 5812 |
| 65 | Ga0070699_100115561 | 3300005518 | Bacteria | 2358 |
| 66 | Ga0070699_100149460 | 3300005518 | Bacteria | 2065 |
| 67 | Ga0070679_100040873 | 3300005530 | Bacteria | 4614 |
| 68 | Ga0070679_100211279 | 3300005530 | Bacteria | 1904 |
| 69 | Ga0070679_100332290 | 3300005530 | Bacteria | 1468 |
| 70 | Ga0070684_100009449 | 3300005535 | Bacteria | 7680 |
| 71 | Ga0070684_100018260 | 3300005535 | Bacteria | 5776 |
| 72 | Ga0070684_100337857 | 3300005535 | Unclassified | 1384 |
| 73 | Ga0070697_100040276 | 3300005536 | Bacteria | 3779 |
| 74 | Ga0070697_100128533 | 3300005536 | Bacteria | 2123 |
| 75 | Ga0068853_100357414 | 3300005539 | Bacteria | 1360 |
| 76 | Ga0070672_100004172 | 3300005543 | Bacteria | 9433 |
| 77 | Ga0070672_100058929 | 3300005543 | Bacteria | 3020 |
| 78 | Ga0070672_100077266 | 3300005543 | Bacteria | 2662 |
| 79 | Ga0070686_100004643 | 3300005544 | Bacteria | 7575 |
| 80 | Ga0070695_100013642 | 3300005545 | Bacteria | 4884 |
| 81 | Ga0070696_100000286 | 3300005546 | Bacteria | 30468 |
| 82 | Ga0070696_100005387 | 3300005546 | Bacteria | 8533 |
| 83 | Ga0070696_100009006 | 3300005546 | Bacteria | 6682 |
| 84 | Ga0070693_100000272 | 3300005547 | Bacteria | 24379 |
| 85 | Ga0070693_100024057 | 3300005547 | Bacteria | 3263 |
| 86 | Ga0070704_100000332 | 3300005549 | Bacteria | 21391 |
| 87 | Ga0070704_100258769 | 3300005549 | Bacteria | 1433 |
| 88 | Ga0068855_100056798 | 3300005563 | Bacteria | 4590 |
| 89 | Ga0068855_100331863 | 3300005563 | Bacteria | 1679 |
| 90 | Ga0068855_100626910 | 3300005563 | Bacteria | 1157 |
| 91 | Ga0070664_100000715 | 3300005564 | Bacteria | 25421 |
| 92 | Ga0068857_100147192 | 3300005577 | Bacteria | 2132 |
| 93 | Ga0068854_100013961 | 3300005578 | Bacteria | 5284 |
| 94 | Ga0068854_100017041 | 3300005578 | Bacteria | 4856 |
| 95 | Ga0068854_100155115 | 3300005578 | Unclassified | 1769 |
| 96 | Ga0068856_100123154 | 3300005614 | Bacteria | 2595 |
| 97 | Ga0068856_100172592 | 3300005614 | Bacteria | 2174 |
| 98 | Ga0070702_100002099 | 3300005615 | Bacteria | 8457 |
| 99 | Ga0070702_100136354 | 3300005615 | Unclassified | 1557 |
| 100 | Ga0068852_100012610 | 3300005616 | Bacteria | 6425 |
| 101 | Ga0068852_100268956 | 3300005616 | Unclassified | 1639 |
| 102 | Ga0068859_100326350 | 3300005617 | Unclassified | 1629 |
| 103 | Ga0068864_100000855 | 3300005618 | Bacteria | 25703 |
| 104 | Ga0068864_100007948 | 3300005618 | Bacteria | 8742 |
| 105 | Ga0068866_10000268 | 3300005718 | Bacteria | 24645 |
| 106 | Ga0068866_10043756 | 3300005718 | Unclassified | 2236 |
| 107 | Ga0068861_100000494 | 3300005719 | Bacteria | 22919 |
| 108 | Ga0068861_100003214 | 3300005719 | Bacteria | 10812 |
| 109 | Ga0068861_100078036 | 3300005719 | Bacteria | 2585 |
| 110 | Ga0068851_10006680 | 3300005834 | Bacteria | 5278 |
| 111 | Ga0068870_10013548 | 3300005840 | Bacteria | 3835 |
| 112 | Ga0068870_10048226 | 3300005840 | Bacteria | 2242 |
| 113 | Ga0068863_100021690 | 3300005841 | Bacteria | 6127 |
| 114 | Ga0068863_100171565 | 3300005841 | Bacteria | 2080 |
| 115 | Ga0068858_100094887 | 3300005842 | Bacteria | 2779 |
| 116 | Ga0068858_100163526 | 3300005842 | Bacteria | 2096 |
| 117 | Ga0068860_100001071 | 3300005843 | Bacteria | 30156 |
| 118 | Ga0068862_100005771 | 3300005844 | Bacteria | 10322 |
| 119 | Ga0068862_100146254 | 3300005844 | Bacteria | 2101 |
| 120 | Ga0081455_10003936 | 3300005937 | Bacteria | 16884 |
| 121 | Ga0081455_10014656 | 3300005937 | Bacteria | 7666 |
| 122 | Ga0081455_10048635 | 3300005937 | Bacteria | 3662 |
| 123 | Ga0081455_10050038 | 3300005937 | Bacteria | 3597 |
| 124 | Ga0081455_10180659 | 3300005937 | Bacteria | 1598 |
| 125 | Ga0081540_1000026 | 3300005983 | Bacteria | 155402 |
| 126 | Ga0081539_10008045 | 3300005985 | Bacteria | 9340 |
| 127 | Ga0081539_10033748 | 3300005985 | Bacteria | 3109 |
| 128 | Ga0070717_10159162 | 3300006028 | Bacteria | 1958 |
| 129 | Ga0075365_10012874 | 3300006038 | Bacteria | 4985 |
| 130 | Ga0075365_10038691 | 3300006038 | Bacteria | 3102 |
| 131 | Ga0075365_10059819 | 3300006038 | Bacteria | 2540 |
| 132 | Ga0075365_10181074 | 3300006038 | Bacteria | 1473 |
| 133 | Ga0075368_10004530 | 3300006042 | Bacteria | 4722 |
| 134 | Ga0075368_10050465 | 3300006042 | Bacteria | 1652 |
| 135 | Ga0075363_100000486 | 3300006048 | Bacteria | 12590 |
| 136 | Ga0075363_100045905 | 3300006048 | Bacteria | 2317 |
| 137 | Ga0075364_10058077 | 3300006051 | Bacteria | 2535 |
| 138 | Ga0075364_10086138 | 3300006051 | Bacteria | 2081 |
| 139 | Ga0070716_100027556 | 3300006173 | Bacteria | 3054 |
| 140 | Ga0070716_100271943 | 3300006173 | Bacteria | 1165 |
| 141 | Ga0070712_100018198 | 3300006175 | Bacteria | 4560 |
| 142 | Ga0075367_10075989 | 3300006178 | Bacteria | 2026 |
| 143 | Ga0075367_10120661 | 3300006178 | Bacteria | 1615 |
| 144 | Ga0075369_10013341 | 3300006186 | Bacteria | 3260 |
| 145 | Ga0075369_10025096 | 3300006186 | Bacteria | 2476 |
| 146 | Ga0075369_10065295 | 3300006186 | Bacteria | 1595 |
| 147 | Ga0075366_10053412 | 3300006195 | Bacteria | 2400 |
| 148 | Ga0097621_100002822 | 3300006237 | Bacteria | 11907 |
| 149 | Ga0097621_100003412 | 3300006237 | Bacteria | 10943 |
| 150 | Ga0097621_100050446 | 3300006237 | Bacteria | 3384 |
| 151 | Ga0075370_10021086 | 3300006353 | Bacteria | 3568 |
| 152 | Ga0068871_100002838 | 3300006358 | Bacteria | 11867 |
| 153 | Ga0068871_100003826 | 3300006358 | Bacteria | 10375 |
| 154 | Ga0068871_100460242 | 3300006358 | Archaea | 1142 |
| 155 | Ga0075428_100011372 | 3300006844 | Bacteria | 9899 |
| 156 | Ga0075428_100011770 | 3300006844 | Bacteria | 9740 |
| 157 | Ga0075428_100429266 | 3300006844 | Bacteria | 1416 |
| 158 | Ga0075430_100003725 | 3300006846 | Bacteria | 12810 |
| 159 | Ga0075430_100026920 | 3300006846 | Bacteria | 4890 |
| 160 | Ga0075430_100036267 | 3300006846 | Bacteria | 4181 |
| 161 | Ga0075430_100163239 | 3300006846 | Bacteria | 1854 |
| 162 | Ga0075431_100030894 | 3300006847 | Bacteria | 5517 |
| 163 | Ga0075431_100044305 | 3300006847 | Bacteria | 4589 |
| 164 | Ga0075431_100492529 | 3300006847 | Bacteria | 1218 |
| 165 | Ga0075433_10001763 | 3300006852 | Bacteria | 16187 |
| 166 | Ga0075433_10516578 | 3300006852 | Bacteria | 1051 |
| 167 | Ga0075434_100000033 | 3300006871 | Bacteria | 63711 |
| 168 | Ga0075434_100000318 | 3300006871 | Bacteria | 34363 |
| 169 | Ga0075434_100001207 | 3300006871 | Bacteria | 21477 |
| 170 | Ga0075434_100124510 | 3300006871 | Bacteria | 2595 |
| 171 | Ga0075429_100000191 | 3300006880 | Bacteria | 40312 |
| 172 | Ga0075429_100004031 | 3300006880 | Bacteria | 12579 |
| 173 | Ga0075429_100004103 | 3300006880 | Bacteria | 12459 |
| 174 | Ga0075429_100054026 | 3300006880 | Bacteria | 3495 |
| 175 | Ga0068865_100005516 | 3300006881 | Bacteria | 7677 |
| 176 | Ga0068865_100007719 | 3300006881 | Bacteria | 6631 |
| 177 | Ga0075436_100001263 | 3300006914 | Bacteria | 17167 |
| 178 | Ga0075436_100001365 | 3300006914 | Bacteria | 16615 |
| 179 | Ga0075436_100018853 | 3300006914 | Bacteria | 4724 |
| 180 | Ga0075436_100065802 | 3300006914 | Bacteria | 2505 |
| 181 | Ga0075436_100166024 | 3300006914 | Bacteria | 1558 |
| 182 | Ga0097620_100326361 | 3300006931 | Unclassified | 1629 |
| 183 | Ga0075435_100000095 | 3300007076 | Bacteria | 47869 |
| 184 | Ga0075435_100086020 | 3300007076 | Bacteria | 2588 |
| 185 | Ga0075435_100100107 | 3300007076 | Bacteria | 2401 |
| 186 | Ga0075435_100141893 | 3300007076 | Bacteria | 2016 |
| 187 | Ga0075435_100377384 | 3300007076 | Bacteria | 1218 |
| 188 | Ga0099794_10005841 | 3300007265 | Bacteria | 4963 |
| 189 | Ga0099794_10032073 | 3300007265 | Bacteria | 2464 |
| 190 | Ga0099794_10040210 | 3300007265 | Bacteria | 2222 |
| 191 | Ga0099795_10008852 | 3300007788 | Bacteria | 2895 |
| 192 | Ga0111539_10027400 | 3300009094 | Bacteria | 6960 |
| 193 | Ga0111539_10030515 | 3300009094 | Bacteria | 6551 |
| 194 | Ga0111539_10031451 | 3300009094 | Bacteria | 6446 |
| 195 | Ga0111539_10056838 | 3300009094 | Bacteria | 4649 |
| 196 | Ga0111539_10074451 | 3300009094 | Bacteria | 4001 |
| 197 | Ga0111539_10370177 | 3300009094 | Unclassified | 1668 |
| 198 | Ga0111539_10528040 | 3300009094 | Bacteria | 1375 |
| 199 | Ga0105245_10000900 | 3300009098 | Bacteria | 27069 |
| 200 | Ga0114129_10027395 | 3300009147 | Bacteria | 8068 |
| 201 | Ga0114129_10155472 | 3300009147 | Bacteria | 3128 |
| 202 | Ga0114129_10225554 | 3300009147 | Bacteria | 2526 |
| 203 | Ga0114129_10258851 | 3300009147 | Bacteria | 2333 |
| 204 | Ga0114129_10320129 | 3300009147 | Bacteria | 2062 |
| 205 | Ga0114129_10415902 | 3300009147 | Bacteria | 1769 |
| 206 | Ga0114129_10495655 | 3300009147 | Bacteria | 1596 |
| 207 | Ga0114129_10557743 | 3300009147 | Bacteria | 1489 |
| 208 | Ga0105243_10002495 | 3300009148 | Bacteria | 15365 |
| 209 | Ga0105243_10012365 | 3300009148 | Bacteria | 6452 |
| 210 | Ga0105241_10013546 | 3300009174 | Bacteria | 5976 |
| 211 | Ga0105242_10000570 | 3300009176 | Bacteria | 29133 |
| 212 | Ga0105248_10029884 | 3300009177 | Bacteria | 6081 |
| 213 | Ga0105248_10046301 | 3300009177 | Bacteria | 4874 |
| 214 | Ga0105248_10292651 | 3300009177 | Bacteria | 1834 |
| 215 | Ga0105248_10590393 | 3300009177 | Bacteria | 1253 |
| 216 | Ga0105237_10021363 | 3300009545 | Bacteria | 6655 |
| 217 | Ga0105238_10001829 | 3300009551 | Bacteria | 21323 |
| 218 | Ga0105249_10004906 | 3300009553 | Bacteria | 11546 |
| 219 | Ga0105249_10011144 | 3300009553 | Bacteria | 7899 |
| 220 | Ga0105239_10710452 | 3300010375 | Bacteria | 1149 |
| 221 | Ga0105246_10107443 | 3300011119 | Bacteria | 2044 |
| 222 | Ga0157374_10013274 | 3300013296 | Bacteria | 7187 |
| 223 | Ga0157378_10013586 | 3300013297 | Bacteria | 7122 |
| 224 | Ga0163162_10074780 | 3300013306 | Bacteria | 3447 |
| 225 | Ga0157372_10200194 | 3300013307 | Bacteria | 2313 |
| 226 | Ga0157375_10014357 | 3300013308 | Bacteria | 7062 |
| 227 | Ga0157375_10224640 | 3300013308 | Bacteria | 2037 |
| 228 | Ga0157380_10072009 | 3300014326 | Bacteria | 2798 |
| 229 | Ga0157380_10119946 | 3300014326 | Bacteria | 2226 |
| 230 | Ga0157376_10025461 | 3300014969 | Bacteria | 4660 |
| 231 | Ga0157376_10049805 | 3300014969 | Bacteria | 3471 |
| 232 | Ga0209758_1000351 | 3300025297 | Bacteria | 83626 |
| 233 | Ga0209758_1001016 | 3300025297 | Bacteria | 37152 |
| 234 | Ga0209758_1049604 | 3300025297 | Bacteria | 1480 |
| 235 | Ga0207697_10102463 | 3300025315 | Bacteria | 1221 |
| 236 | Ga0207656_10004859 | 3300025321 | Bacteria | 4716 |
| 237 | Ga0207653_10030736 | 3300025885 | Bacteria | 1733 |
| 238 | Ga0207682_10041450 | 3300025893 | Bacteria | 1879 |
| 239 | Ga0207682_10075587 | 3300025893 | Bacteria | 1434 |
| 240 | Ga0207642_10028763 | 3300025899 | Bacteria | 2293 |
| 241 | Ga0207642_10095869 | 3300025899 | Bacteria | 1477 |
| 242 | Ga0207710_10051865 | 3300025900 | Unclassified | 1843 |
| 243 | Ga0207680_10012474 | 3300025903 | Bacteria | 4328 |
| 244 | Ga0207647_10060267 | 3300025904 | Bacteria | 2320 |
| 245 | Ga0207645_10039261 | 3300025907 | Bacteria | 3034 |
| 246 | Ga0207643_10002306 | 3300025908 | Bacteria | 10379 |
| 247 | Ga0207643_10007262 | 3300025908 | Bacteria | 5945 |
| 248 | Ga0207654_10050354 | 3300025911 | Bacteria | 2393 |
| 249 | Ga0207707_10023586 | 3300025912 | Bacteria | 5382 |
| 250 | Ga0207707_10132004 | 3300025912 | Bacteria | 2184 |
| 251 | Ga0207693_10184674 | 3300025915 | Bacteria | 1641 |
| 252 | Ga0207660_10003686 | 3300025917 | Bacteria | 9985 |
| 253 | Ga0207662_10000255 | 3300025918 | Bacteria | 24688 |
| 254 | Ga0207649_10011853 | 3300025920 | Bacteria | 4822 |
| 255 | Ga0207652_10063374 | 3300025921 | Bacteria | 3197 |
| 256 | Ga0207650_10008372 | 3300025925 | Bacteria | 7060 |
| 257 | Ga0207659_10005784 | 3300025926 | Bacteria | 7533 |
| 258 | Ga0207659_10008600 | 3300025926 | Bacteria | 6349 |
| 259 | Ga0207659_10017688 | 3300025926 | Bacteria | 4659 |
| 260 | Ga0207687_10008703 | 3300025927 | Bacteria | 6630 |
| 261 | Ga0207687_10060966 | 3300025927 | Bacteria | 2663 |
| 262 | Ga0207700_10122738 | 3300025928 | Bacteria | 2109 |
| 263 | Ga0207700_10194097 | 3300025928 | Bacteria | 1708 |
| 264 | Ga0207644_10022367 | 3300025931 | Bacteria | 4319 |
| 265 | Ga0207644_10206479 | 3300025931 | Unclassified | 1551 |
| 266 | Ga0207706_10012014 | 3300025933 | Bacteria | 7889 |
| 267 | Ga0207706_10090481 | 3300025933 | Bacteria | 2691 |
| 268 | Ga0207686_10013086 | 3300025934 | Bacteria | 4582 |
| 269 | Ga0207709_10012837 | 3300025935 | Bacteria | 4619 |
| 270 | Ga0207709_10201511 | 3300025935 | Bacteria | 1422 |
| 271 | Ga0207709_10214755 | 3300025935 | Unclassified | 1383 |
| 272 | Ga0207670_10009101 | 3300025936 | Bacteria | 5643 |
| 273 | Ga0207670_10064336 | 3300025936 | Bacteria | 2513 |
| 274 | Ga0207669_10004046 | 3300025937 | Bacteria | 6417 |
| 275 | Ga0207669_10131893 | 3300025937 | Unclassified | 1718 |
| 276 | Ga0207704_10001889 | 3300025938 | Bacteria | 9375 |
| 277 | Ga0207704_10006023 | 3300025938 | Bacteria | 5622 |
| 278 | Ga0207665_10187817 | 3300025939 | Bacteria | 1500 |
| 279 | Ga0207691_10000553 | 3300025940 | Bacteria | 37406 |
| 280 | Ga0207711_10042867 | 3300025941 | Bacteria | 3857 |
| 281 | Ga0207711_10044549 | 3300025941 | Bacteria | 3788 |
| 282 | Ga0207711_10090988 | 3300025941 | Bacteria | 2683 |
| 283 | Ga0207689_10007381 | 3300025942 | Bacteria | 9639 |
| 284 | Ga0207689_10011317 | 3300025942 | Bacteria | 7654 |
| 285 | Ga0207661_10003659 | 3300025944 | Bacteria | 10710 |
| 286 | Ga0207661_10263640 | 3300025944 | Bacteria | 1536 |
| 287 | Ga0207679_10008461 | 3300025945 | Bacteria | 6552 |
| 288 | Ga0207667_10046208 | 3300025949 | Bacteria | 4610 |
| 289 | Ga0207651_10193691 | 3300025960 | Unclassified | 1623 |
| 290 | Ga0207651_10316624 | 3300025960 | Bacteria | 1303 |
| 291 | Ga0207712_10050627 | 3300025961 | Bacteria | 2901 |
| 292 | Ga0207712_10125394 | 3300025961 | Bacteria | 1949 |
| 293 | Ga0207712_10166362 | 3300025961 | Bacteria | 1719 |
| 294 | Ga0207712_10200625 | 3300025961 | Unclassified | 1582 |
| 295 | Ga0207668_10189061 | 3300025972 | Bacteria | 1630 |
| 296 | Ga0207640_10009859 | 3300025981 | Bacteria | 5361 |
| 297 | Ga0207640_10028180 | 3300025981 | Bacteria | 3431 |
| 298 | Ga0207658_10070530 | 3300025986 | Bacteria | 2644 |
| 299 | Ga0207677_10003501 | 3300026023 | Bacteria | 8321 |
| 300 | Ga0207677_10074232 | 3300026023 | Bacteria | 2412 |
| 301 | Ga0207677_10171145 | 3300026023 | Unclassified | 1698 |
| 302 | Ga0207703_10026263 | 3300026035 | Bacteria | 4582 |
| 303 | Ga0207703_10315216 | 3300026035 | Bacteria | 1431 |
| 304 | Ga0207639_10230104 | 3300026041 | Bacteria | 1606 |
| 305 | Ga0207678_10050216 | 3300026067 | Bacteria | 3604 |
| 306 | Ga0207708_10008564 | 3300026075 | Bacteria | 7568 |
| 307 | Ga0207708_10104799 | 3300026075 | Unclassified | 2191 |
| 308 | Ga0207702_10288799 | 3300026078 | Unclassified | 1553 |
| 309 | Ga0207641_10200765 | 3300026088 | Bacteria | 1838 |
| 310 | Ga0207648_10000276 | 3300026089 | Bacteria | 55713 |
| 311 | Ga0207648_10042769 | 3300026089 | Bacteria | 3978 |
| 312 | Ga0207676_10003972 | 3300026095 | Bacteria | 10433 |
| 313 | Ga0207676_10049583 | 3300026095 | Bacteria | 3267 |
| 314 | Ga0207674_10301308 | 3300026116 | Unclassified | 1552 |
| 315 | Ga0207674_10426547 | 3300026116 | Bacteria | 1281 |
| 316 | Ga0207675_100006484 | 3300026118 | Bacteria | 11072 |
| 317 | Ga0207675_100007574 | 3300026118 | Bacteria | 10257 |
| 318 | Ga0207675_100008557 | 3300026118 | Bacteria | 9626 |
| 319 | Ga0207675_100467109 | 3300026118 | Bacteria | 1252 |
| 320 | Ga0207683_10009572 | 3300026121 | Bacteria | 8263 |
| 321 | Ga0207698_10006445 | 3300026142 | Bacteria | 7328 |
| 322 | Ga0207698_10091400 | 3300026142 | Bacteria | 2491 |
| 323 | Ga0207698_10513135 | 3300026142 | Bacteria | 1168 |
| 324 | Ga0207428_10000726 | 3300027907 | Bacteria | 38071 |
| 325 | Ga0207428_10059832 | 3300027907 | Bacteria | 3019 |
| 326 | Ga0207428_10103966 | 3300027907 | Bacteria | 2192 |
| 327 | Ga0268266_10097245 | 3300028379 | Bacteria | 2589 |
| 328 | Ga0268264_10017841 | 3300028381 | Bacteria | 5810 |
| 329 | Ga0268264_10247930 | 3300028381 | Bacteria | 1653 |
| 330 | Ga0307511_10000019 | 3300030521 | Bacteria | 117947 |
| 331 | Ga0307511_10010947 | 3300030521 | Bacteria | 8962 |
| 332 | Ga0265332_10000812 | 3300031238 | Bacteria | 18981 |
| 333 | Ga0265325_10078596 | 3300031241 | Bacteria | 1643 |
| 334 | Ga0265340_10002068 | 3300031247 | Bacteria | 11503 |
| 335 | Ga0265339_10000669 | 3300031249 | Bacteria | 26471 |
| 336 | Ga0265339_10094900 | 3300031249 | Bacteria | 1559 |
| 337 | Ga0265331_10006261 | 3300031250 | Bacteria | 7055 |
| 338 | Ga0265327_10006312 | 3300031251 | Bacteria | 9532 |
| 339 | Ga0265314_10031514 | 3300031711 | Bacteria | 3912 |
| 340 | Ga0265342_10000856 | 3300031712 | Bacteria | 30377 |
| 341 | Ga0307405_10260539 | 3300031731 | Bacteria | 1295 |
| 342 | Ga0307406_10084017 | 3300031901 | Bacteria | 2125 |
| 343 | Ga0307412_10126580 | 3300031911 | Bacteria | 1849 |
| 344 | Ga0307414_10066108 | 3300032004 | Bacteria | 2583 |
| 345 | Ga0307411_10217152 | 3300032005 | Bacteria | 1481 |
| 346 | Ga0373938_0021153 | 3300034957 | Bacteria | 1317 |
| 347 | Ga0373926_0002688 | 3300035083 | Bacteria | 5664 |
| 348 | Ga0373929_0015766 | 3300035085 | Bacteria | 1473 |
| 349 | Ga0373929_0022292 | 3300035085 | Bacteria | 1292 |
| 350 | Ga0373934_0015905 | 3300035086 | Bacteria | 2858 |
| 351 | Ga0373940_0046871 | 3300035088 | Bacteria | 1204 |
| 352 | Ga0373949_0033982 | 3300035090 | Bacteria | 1227 |
| 353 | Ga0373952_0021674 | 3300035092 | Bacteria | 1358 |
| 354 | Ga0373936_0025285 | 3300035113 | Bacteria | 2322 |
| 355 | Ga0373939_0002731 | 3300035114 | Bacteria | 4141 |
| 356 | Ga0373939_0084887 | 3300035114 | Bacteria | 1059 |
| 357 | Ga0373941_0005939 | 3300035115 | Bacteria | 2910 |
| 358 | Ga0373941_0012975 | 3300035115 | Bacteria | 2192 |
| 359 | Ga0373945_0003146 | 3300035116 | Bacteria | 5181 |
| 360 | Ga0373945_0004289 | 3300035116 | Bacteria | 4526 |
| 361 | Ga0373956_0090421 | 3300035119 | Unclassified | 1412 |
| 362 | Ga0373957_0008394 | 3300035120 | Unclassified | 3343 |
| 363 | Ga0373960_0014342 | 3300035121 | Bacteria | 2006 |
| 364 | Ga0373943_0004208 | 3300035170 | Bacteria | 6525 |
| 365 | Ga0373943_0048192 | 3300035170 | Bacteria | 2086 |
| 366 | Ga0373943_0216507 | 3300035170 | Bacteria | 1065 |
| 367 | Ga0373946_0019871 | 3300035171 | Bacteria | 2591 |
| 368 | Ga0373955_0007789 | 3300035172 | Unclassified | 4937 |
| 369 | Ga0373961_0009342 | 3300035241 | Bacteria | 2399 |
| 370 | Ga0373924_0032332 | 3300035410 | Unclassified | 2108 |
| 371 | Ga0373931_0038696 | 3300035691 | Bacteria | 2496 |
| 372 | Ga0373931_0040452 | 3300035691 | Bacteria | 2446 |
| 373 | Ga0373935_0070899 | 3300035692 | Bacteria | 2247 |
| 374 | Ga0373935_0080434 | 3300035692 | Bacteria | 2117 |
| 375 | Ga0373935_0189732 | 3300035692 | Bacteria | 1415 |
| 376 | Ga0373927_0030096 | 3300035695 | Bacteria | 3542 |
| 377 | Ga0373927_0034306 | 3300035695 | Bacteria | 3301 |
| 378 | Ga0373927_0241926 | 3300035695 | Bacteria | 1186 |
| 379 | Ga0373933_0010844 | 3300035724 | Bacteria | 5001 |
| 380 | Ga0373947_0009079 | 3300035725 | Bacteria | 5714 |
| 381 | Ga0373947_0009232 | 3300035725 | Bacteria | 5667 |
| 382 | Ga0373947_0010041 | 3300035725 | Bacteria | 5434 |
| 383 | Ga0373947_0097147 | 3300035725 | Bacteria | 1846 |
| 384 | Ga0373947_0143622 | 3300035725 | Bacteria | 1533 |
| 385 | Ga0373937_0008865 | 3300036401 | Bacteria | 8731 |
| 386 | Ga0373925_0006672 | 3300037068 | Bacteria | 8467 |
| 387 | Ga0373925_0013212 | 3300037068 | Bacteria | 5976 |
| 388 | Ga0373925_0028674 | 3300037068 | Bacteria | 4079 |
| 389 | Ga0373925_0159263 | 3300037068 | Bacteria | 1777 |
| 390 | Ga0373925_0196284 | 3300037068 | Bacteria | 1603 |
| 391 | Ga0395899_0059379 | 3300037312 | Bacteria | 2819 |
| 392 | Ga0395900_0001544 | 3300037418 | Bacteria | 27359 |
| 393 | Ga0395900_0355947 | 3300037418 | Bacteria | 1436 |
| 394 | Ga0395898_0108630 | 3300037466 | Bacteria | 2660 |
| 395 | Ga0395898_0153895 | 3300037466 | Unclassified | 2200 |
| 396 | Ga0395905_0084323 | 3300037471 | Bacteria | 2977 |
| 397 | Ga0395901_0062199 | 3300038443 | Bacteria | 3885 |
| 398 | Ga0395901_0131752 | 3300038443 | Unclassified | 2627 |
| 399 | Ga0436365_1202296 | 3300039437 | Bacteria | 2890 |
| 400 | Ga0436365_1429691 | 3300039437 | Bacteria | 1644 |
| 401 | Ga0439441_002703 | 3300042001 | Bacteria | 2525 |
| 402 | Ga0450913_000161 | 3300042117 | Bacteria | 2162 |
| 403 | Ga0439434_0069165 | 3300042435 | Bacteria | 1110 |
| 404 | Ga0439435_0029780 | 3300042436 | Bacteria | 1476 |
| 405 | Ga0450916_004176 | 3300042530 | Bacteria | 1619 |
| 406 | Ga0466965_0027491 | 3300044683 | Bacteria | 2762 |
| 407 | Ga0466957_0025397 | 3300044842 | Bacteria | 3511 |
| 408 | Ga0451576_0001715 | 3300045051 | Bacteria | 36181 |
| 409 | Ga0451576_0175914 | 3300045051 | Bacteria | 2234 |
| 410 | Ga0466967_0085674 | 3300045976 | Bacteria | 2853 |
| 411 | Ga0495592_0006561 | 3300046454 | Bacteria | 8670 |
| 412 | Ga0495603_0002544 | 3300046455 | Bacteria | 10740 |
| 413 | Ga0495603_0081454 | 3300046455 | Bacteria | 1896 |
| 414 | Ga0495629_0168046 | 3300046459 | Bacteria | 1523 |
| 415 | Ga0495651_0151781 | 3300046462 | Bacteria | 1669 |
| 416 | Ga0495651_0211473 | 3300046462 | Unclassified | 1349 |
| 417 | Ga0495580_0002354 | 3300046472 | Bacteria | 16499 |
| 418 | Ga0495582_0005948 | 3300046473 | Bacteria | 6804 |
| 419 | Ga0495605_0027976 | 3300046474 | Bacteria | 2915 |
| 420 | Ga0495639_0010766 | 3300046475 | Bacteria | 3937 |
| 421 | Ga0495639_0019927 | 3300046475 | Bacteria | 2929 |
| 422 | Ga0495662_0012546 | 3300046476 | Bacteria | 4134 |
| 423 | Ga0495662_0027363 | 3300046476 | Bacteria | 2755 |
| 424 | Ga0495662_0146171 | 3300046476 | Bacteria | 1164 |
| 425 | Ga0495584_0111959 | 3300046491 | Bacteria | 1381 |
| 426 | Ga0495594_0011426 | 3300046499 | Bacteria | 4615 |
| 427 | Ga0495608_0006443 | 3300046511 | Bacteria | 8335 |
| 428 | Ga0495608_0012778 | 3300046511 | Bacteria | 5826 |
| 429 | Ga0495616_0046790 | 3300046513 | Bacteria | 2182 |
| 430 | Ga0495618_0006638 | 3300046514 | Bacteria | 7011 |
| 431 | Ga0495628_0117528 | 3300046516 | Bacteria | 2042 |
| 432 | Ga0495630_0001728 | 3300046517 | Bacteria | 15247 |
| 433 | Ga0495630_0038696 | 3300046517 | Bacteria | 3568 |
| 434 | Ga0495637_0061251 | 3300046520 | Bacteria | 1543 |
| 435 | Ga0495644_0117334 | 3300046523 | Bacteria | 1011 |
| 436 | Ga0495666_0020549 | 3300046526 | Bacteria | 3270 |
| 437 | Ga0495666_0026411 | 3300046526 | Bacteria | 2862 |
| 438 | Ga0495666_0054783 | 3300046526 | Bacteria | 1912 |
| 439 | Ga0495665_0043776 | 3300046531 | Bacteria | 2380 |
| 440 | Ga0495665_0131528 | 3300046531 | Bacteria | 1310 |
| 441 | Ga0495640_0005587 | 3300046533 | Bacteria | 9999 |
| 442 | Ga0495640_0012886 | 3300046533 | Bacteria | 6377 |
| 443 | Ga0495586_0002567 | 3300046535 | Bacteria | 9824 |
| 444 | Ga0495586_0011166 | 3300046535 | Bacteria | 4774 |
| 445 | Ga0495586_0028388 | 3300046535 | Bacteria | 2994 |
| 446 | Ga0495587_0056143 | 3300046536 | Bacteria | 2317 |
| 447 | Ga0495621_0046506 | 3300046539 | Bacteria | 1540 |
| 448 | Ga0495645_0152758 | 3300046543 | Bacteria | 1602 |
| 449 | Ga0495667_0056892 | 3300046559 | Unclassified | 2571 |
| 450 | Ga0495656_0122916 | 3300046615 | Bacteria | 1227 |
| 451 | Ga0495668_0087449 | 3300046616 | Bacteria | 1709 |
| 452 | Ga0495635_0254181 | 3300046663 | Bacteria | 1184 |
| 453 | Ga0495659_0074229 | 3300046664 | Bacteria | 1279 |
| 454 | Ga0495588_0006249 | 3300046674 | Bacteria | 5354 |
| 455 | Ga0495588_0007187 | 3300046674 | Bacteria | 5053 |
| 456 | Ga0495657_0005797 | 3300046675 | Bacteria | 9729 |
| 457 | Ga0495599_0033235 | 3300046678 | Bacteria | 3240 |
| 458 | Ga0495623_0076879 | 3300046679 | Unclassified | 2071 |
| 459 | Ga0495647_0000058 | 3300046681 | Bacteria | 27582 |
| 460 | Ga0495647_0017269 | 3300046681 | Bacteria | 2551 |
| 461 | Ga0495658_0012479 | 3300046683 | Bacteria | 4306 |
| 462 | Ga0495658_0019833 | 3300046683 | Bacteria | 3515 |
| 463 | Ga0495658_0045853 | 3300046683 | Bacteria | 2455 |
| 464 | Ga0495658_0172039 | 3300046683 | Bacteria | 1341 |
| 465 | Ga0495669_0069244 | 3300046684 | Bacteria | 1606 |
| 466 | Ga0495613_0037577 | 3300046689 | Bacteria | 3589 |
| 467 | Ga0495624_0017642 | 3300046690 | Bacteria | 4786 |
| 468 | Ga0495624_0021757 | 3300046690 | Bacteria | 4249 |
| 469 | Ga0495624_0119936 | 3300046690 | Bacteria | 1615 |
| 470 | Ga0495624_0155810 | 3300046690 | Bacteria | 1396 |
| 471 | Ga0495670_0072521 | 3300046691 | Bacteria | 1744 |
| 472 | Ga0495600_0034149 | 3300046809 | Unclassified | 3302 |
| 473 | Ga0495604_0018716 | 3300047317 | Bacteria | 5547 |
| 474 | Ga0495604_0136344 | 3300047317 | Unclassified | 1758 |
| 475 | Ga0495674_0069160 | 3300047319 | Bacteria | 3054 |
| 476 | Ga0495676_0005390 | 3300047321 | Bacteria | 11725 |
| 477 | Ga0495676_0075192 | 3300047321 | Bacteria | 2584 |
| 478 | Ga0495680_0004705 | 3300047322 | Bacteria | 12987 |
| 479 | Ga0495680_0094765 | 3300047322 | Unclassified | 2233 |
| 480 | Ga0495675_0051153 | 3300047444 | Plasmid | 2625 |
| 481 | Ga0495684_0236197 | 3300047471 | Bacteria | 1335 |
| 482 | Ga0495602_0243566 | 3300048088 | Bacteria | 1344 |
| 483 | Ga0496100_0057950 | 3300048903 | Bacteria | 2540 |
| 484 | Ga0496100_0080966 | 3300048903 | Bacteria | 2193 |
| 485 | Ga0496100_0088744 | 3300048903 | Bacteria | 2105 |
| 486 | Ga0496101_0100903 | 3300048904 | Bacteria | 2160 |
| 487 | Ga0496101_0196323 | 3300048904 | Bacteria | 1559 |
| 488 | Ga0496104_0000775 | 3300048907 | Bacteria | 27328 |
| 489 | Ga0496104_0001327 | 3300048907 | Bacteria | 21357 |
| 490 | Ga0496104_0001388 | 3300048907 | Bacteria | 20943 |
| 491 | Ga0496105_0006927 | 3300048908 | Bacteria | 8730 |
| 492 | Ga0496105_0050843 | 3300048908 | Bacteria | 3424 |
| 493 | Ga0496106_0020742 | 3300048909 | Bacteria | 4877 |
| 494 | Ga0496106_0066402 | 3300048909 | Unclassified | 2747 |
| 495 | Ga0496107_0076871 | 3300048910 | Bacteria | 2432 |
| 496 | Ga0496108_0020494 | 3300048911 | Bacteria | 5436 |
| 497 | Ga0496109_0025531 | 3300048912 | Bacteria | 5266 |
| 498 | Ga0496109_0129696 | 3300048912 | Bacteria | 2352 |
| 499 | Ga0496109_0277292 | 3300048912 | Bacteria | 1580 |
| 500 | Ga0496109_0470447 | 3300048912 | Bacteria | 1187 |
| 501 | Ga0496110_0008245 | 3300048913 | Bacteria | 8376 |
| 502 | Ga0496110_0050957 | 3300048913 | Bacteria | 3637 |
| 503 | Ga0496110_0197369 | 3300048913 | Bacteria | 1828 |
| 504 | Ga0496111_0017425 | 3300048914 | Bacteria | 4967 |
| 505 | Ga0496111_0194545 | 3300048914 | Unclassified | 1507 |
| 506 | Ga0496113_0065521 | 3300048916 | Bacteria | 2750 |
| 507 | Ga0496114_0021652 | 3300048917 | Bacteria | 5232 |
| 508 | Ga0496115_0013314 | 3300048918 | Bacteria | 6221 |
| 509 | Ga0496115_0059102 | 3300048918 | Bacteria | 3087 |
| 510 | Ga0496115_0096465 | 3300048918 | Bacteria | 2421 |
| 511 | Ga0501032_0010690 | 3300049569 | Bacteria | 6606 |
| 512 | Ga0501034_0121088 | 3300049571 | Bacteria | 2603 |
| 513 | Ga0501036_0197957 | 3300049572 | Bacteria | 1690 |
| 514 | Ga0501037_0009409 | 3300049573 | Bacteria | 7172 |
| 515 | Ga0501038_0010065 | 3300049574 | Bacteria | 8658 |
| 516 | Ga0501040_0003088 | 3300049576 | Bacteria | 10800 |
| 517 | Ga0501041_0005947 | 3300049577 | Bacteria | 7137 |
| 518 | Ga0501041_0064912 | 3300049577 | Bacteria | 2236 |
| 519 | Ga0501042_0016022 | 3300049578 | Bacteria | 5142 |
| 520 | Ga0501042_0526524 | 3300049578 | Bacteria | 859 |
| 521 | Ga0501043_0000386 | 3300049579 | Bacteria | 39806 |
| 522 | Ga0501043_0077251 | 3300049579 | Bacteria | 2616 |
| 523 | Ga0501046_0000491 | 3300049580 | Bacteria | 39431 |
| 524 | Ga0501046_0001179 | 3300049580 | Bacteria | 25420 |
| 525 | Ga0501047_0000021 | 3300049581 | Bacteria | 254841 |
| 526 | Ga0501048_0009095 | 3300049582 | Bacteria | 7477 |
| 527 | Ga0501068_0005838 | 3300049584 | Bacteria | 6754 |
| 528 | Ga0501070_0019933 | 3300049586 | Bacteria | 5623 |
| 529 | Ga0501072_0029111 | 3300049588 | Bacteria | 4312 |
| 530 | Ga0501073_0004780 | 3300049589 | Bacteria | 10164 |
| 531 | Ga0501075_0129546 | 3300049591 | Bacteria | 1922 |
| 532 | Ga0501080_0164832 | 3300049742 | Bacteria | 2045 |
| 533 | Ga0501083_0148170 | 3300049744 | Bacteria | 1537 |
| 534 | Ga0501035_0283568 | 3300049822 | Bacteria | 1399 |
| 535 | Ga0501044_0000411 | 3300049823 | Bacteria | 52862 |
| 536 | Ga0501045_0004535 | 3300049824 | Bacteria | 9594 |
| 537 | Ga0501045_0087567 | 3300049824 | Bacteria | 2300 |
| 538 | nmdc:mga03683_9684_c1 | 3300050489 | Bacteria | 3437 |
| 539 | nmdc:mga00v17_142261_c1 | 3300050491 | Bacteria | 1539 |
| 540 | nmdc:mga0yw44_55814_c1 | 3300050492 | Bacteria | 2404 |
| 541 | nmdc:mga0yw44_8602_c1 | 3300050492 | Bacteria | 5096 |
| 542 | nmdc:mga0yw44_91123_c1 | 3300050492 | Bacteria | 1927 |
| 543 | nmdc:mga0k408_145512_c1 | 3300050493 | Bacteria | 1411 |
| 544 | nmdc:mga0k408_17331_c1 | 3300050493 | Bacteria | 4012 |
| 545 | nmdc:mga0k408_20124_c1 | 3300050493 | Bacteria | 3735 |
| 546 | nmdc:mga06z11_42449_c1 | 3300050494 | Bacteria | 2282 |
| 547 | nmdc:mga07m45_8286_c2 | 3300050496 | Bacteria | 4987 |
| 548 | nmdc:mga05p37_248908_c1 | 3300050507 | Bacteria | 2132 |
| 549 | nmdc:mga05p37_331333_c1 | 3300050507 | Bacteria | 1798 |
| 550 | nmdc:mga05p37_351125_c1 | 3300050507 | Bacteria | 1736 |
| 551 | nmdc:mga05p37_351536_c1 | 3300050507 | Bacteria | 1735 |
| 552 | nmdc:mga05p37_40918_c1 | 3300050507 | Bacteria | 5691 |
| 553 | nmdc:mga05p37_587703_c1 | 3300050507 | Bacteria | 1260 |
| 554 | nmdc:mga09592_22871_c1 | 3300050508 | Bacteria | 5157 |
| 555 | nmdc:mga09592_256552_c1 | 3300050508 | Bacteria | 1516 |
| 556 | nmdc:mga09592_272_c1 | 3300050508 | Bacteria | 37407 |
| 557 | nmdc:mga09592_62107_c1 | 3300050508 | Bacteria | 3161 |
| 558 | nmdc:mga0qj67_40253_c1 | 3300050509 | Bacteria | 3674 |
| 559 | nmdc:mga0qj67_56393_c1 | 3300050509 | Bacteria | 3114 |
| 560 | nmdc:mga0qj67_90618_c1 | 3300050509 | Bacteria | 2457 |
| 561 | nmdc:mga06r32_103739_c1 | 3300050510 | Bacteria | 2792 |
| 562 | nmdc:mga06r32_15134_c1 | 3300050510 | Bacteria | 7006 |
| 563 | nmdc:mga06r32_338998_c1 | 3300050510 | Bacteria | 1488 |
| 564 | nmdc:mga08y16_245273_c1 | 3300050511 | Bacteria | 1851 |
| 565 | nmdc:mga08y16_29377_c1 | 3300050511 | Bacteria | 5793 |
| 566 | nmdc:mga08y16_33586_c1 | 3300050511 | Bacteria | 5388 |
| 567 | nmdc:mga08y16_40016_c1 | 3300050511 | Bacteria | 4916 |
| 568 | nmdc:mga08y16_418836_c1 | 3300050511 | Bacteria | 1369 |
| 569 | nmdc:mga0n895_159_c1 | 3300050512 | Bacteria | 41448 |
| 570 | nmdc:mga0n895_189894_c1 | 3300050512 | Bacteria | 2085 |
| 571 | nmdc:mga0n895_436_c1 | 3300050512 | Bacteria | 28097 |
| 572 | nmdc:mga0n895_441517_c1 | 3300050512 | Bacteria | 1314 |
| 573 | nmdc:mga0n895_620694_c1 | 3300050512 | Bacteria | 1082 |
| 574 | nmdc:mga0n895_80639_c1 | 3300050512 | Bacteria | 3242 |
| 575 | nmdc:mga0n895_8305_c1 | 3300050512 | Bacteria | 8982 |
| 576 | nmdc:mga0rr50_10116_c1 | 3300050513 | Bacteria | 5969 |
| 577 | nmdc:mga0rr50_127362_c1 | 3300050513 | Bacteria | 2035 |
| 578 | nmdc:mga0rr50_76070_c1 | 3300050513 | Bacteria | 2576 |
| 579 | nmdc:mga08x19_37558_c1 | 3300050514 | Bacteria | 3074 |
| 580 | nmdc:mga08x19_54324_c1 | 3300050514 | Bacteria | 2578 |
| 581 | nmdc:mga08x19_6451_c1 | 3300050514 | Bacteria | 6947 |
| 582 | nmdc:mga08x19_833_c1 | 3300050514 | Bacteria | 19578 |
| 583 | nmdc:mga0a205_175_c1 | 3300050515 | Bacteria | 43324 |
| 584 | nmdc:mga0a205_316644_c1 | 3300050515 | Bacteria | 1431 |
| 585 | nmdc:mga0a205_540403_c1 | 3300050515 | Bacteria | 1021 |
| 586 | Ga0495601_0011258 | 3300053077 | Bacteria | 5345 |
| 587 | Ga0495601_0133707 | 3300053077 | Bacteria | 1616 |
| 588 | Ga0495612_0082234 | 3300053078 | Bacteria | 1354 |
| 589 | Ga0495595_0005633 | 3300053084 | Bacteria | 5066 |
| 590 | Ga0495619_0107214 | 3300053085 | Bacteria | 1906 |
| 591 | Ga0500646_0003926 | 3300053090 | Bacteria | 3781 |
| 592 | Ga0500583_0028138 | 3300053092 | Bacteria | 2434 |
| 593 | Ga0500590_034114 | 3300053148 | Bacteria | 2635 |
| 594 | Ga0500604_0000597 | 3300053151 | Bacteria | 9895 |
| 595 | Ga0500616_0046553 | 3300053153 | Bacteria | 2305 |
| 596 | Ga0501084_0009132 | 3300054114 | Bacteria | 8202 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049578 | Ga0501042_0526524 | Ga0501042_0526524_18_845 | 260 |
| 2 | 3300050493 | nmdc:mga0k408_20124_c1 | nmdc:mga0k408_20124_c1_2890_3717 | 275 |
| 3 | 3300006038 | Ga0075365_10038691 | Ga0075365_100386911 | 279 |
| 4 | 3300037312 | Ga0395899_0059379 | Ga0395899_0059379_1056_2024 | 284 |
| 5 | 3300037418 | Ga0395900_0001544 | Ga0395900_0001544_21364_22332 | 284 |
| 6 | 3300038443 | Ga0395901_0062199 | Ga0395901_0062199_2113_3081 | 284 |
| 7 | 3300031251 | Ga0265327_10006312 | Ga0265327_100063125 | 289 |
| 8 | 3300005937 | Ga0081455_10048635 | Ga0081455_100486355 | 294 |
| 9 | 3300042435 | Ga0439434_0069165 | Ga0439434_0069165_16_966 | 294 |
| 10 | 3300007265 | Ga0099794_10005841 | Ga0099794_100058414 | 295 |
| 11 | 3300009147 | Ga0114129_10415902 | Ga0114129_104159022 | 295 |
| 12 | 3300031901 | Ga0307406_10084017 | Ga0307406_100840172 | 295 |
| 13 | 3300031911 | Ga0307412_10126580 | Ga0307412_101265802 | 295 |
| 14 | 3300032004 | Ga0307414_10066108 | Ga0307414_100661082 | 295 |
| 15 | 3300039437 | Ga0436365_1202296 | Ga0436365_1202296_894_1856 | 295 |
| 16 | 3300050507 | nmdc:mga05p37_351125_c1 | nmdc:mga05p37_351125_c1_264_1208 | 295 |
| 17 | 3300050510 | nmdc:mga06r32_338998_c1 | nmdc:mga06r32_338998_c1_122_1075 | 295 |
| 18 | 3300009147 | Ga0114129_10557743 | Ga0114129_105577431 | 296 |
| 19 | 3300045976 | Ga0466967_0085674 | Ga0466967_0085674_109_1077 | 296 |
| 20 | 3300005329 | Ga0070683_100080356 | Ga0070683_1000803563 | 298 |
| 21 | 3300005330 | Ga0070690_100002470 | Ga0070690_1000024706 | 298 |
| 22 | 3300005535 | Ga0070684_100009449 | Ga0070684_1000094495 | 298 |
| 23 | 3300005549 | Ga0070704_100000332 | Ga0070704_1000003322 | 298 |
| 24 | 3300006846 | Ga0075430_100036267 | Ga0075430_1000362671 | 298 |
| 25 | 3300006847 | Ga0075431_100044305 | Ga0075431_1000443054 | 298 |
| 26 | 3300006880 | Ga0075429_100004031 | Ga0075429_1000040314 | 298 |
| 27 | 3300009147 | Ga0114129_10225554 | Ga0114129_102255542 | 298 |
| 28 | 3300009551 | Ga0105238_10001829 | Ga0105238_1000182913 | 298 |
| 29 | 3300013307 | Ga0157372_10200194 | Ga0157372_102001942 | 298 |
| 30 | 3300035114 | Ga0373939_0002731 | Ga0373939_0002731_13_942 | 298 |
| 31 | 3300035691 | Ga0373931_0040452 | Ga0373931_0040452_493_1422 | 298 |
| 32 | 3300047471 | Ga0495684_0236197 | Ga0495684_0236197_30_968 | 298 |
| 33 | 3300048918 | Ga0496115_0096465 | Ga0496115_0096465_891_1880 | 298 |
| 34 | 3300050507 | nmdc:mga05p37_587703_c1 | nmdc:mga05p37_587703_c1_263_1189 | 298 |
| 35 | 3300050508 | nmdc:mga09592_22871_c1 | nmdc:mga09592_22871_c1_453_1379 | 298 |
| 36 | 3300050509 | nmdc:mga0qj67_90618_c1 | nmdc:mga0qj67_90618_c1_386_1312 | 298 |
| 37 | 3300005471 | Ga0070698_100084696 | Ga0070698_1000846962 | 299 |
| 38 | 3300046681 | Ga0495647_0017269 | Ga0495647_0017269_310_1266 | 299 |
| 39 | 3300048903 | Ga0496100_0080966 | Ga0496100_0080966_80_1054 | 299 |
| 40 | 3300048904 | Ga0496101_0196323 | Ga0496101_0196323_211_1185 | 299 |
| 41 | 3300048917 | Ga0496114_0021652 | Ga0496114_0021652_183_1157 | 299 |
| 42 | 3300050493 | nmdc:mga0k408_145512_c1 | nmdc:mga0k408_145512_c1_76_1026 | 299 |
| 43 | 3300050507 | nmdc:mga05p37_351536_c1 | nmdc:mga05p37_351536_c1_205_1140 | 299 |
| 44 | 3300005436 | Ga0070713_100485481 | Ga0070713_1004854811 | 300 |
| 45 | 3300005471 | Ga0070698_100265190 | Ga0070698_1002651902 | 300 |
| 46 | 3300005518 | Ga0070699_100149460 | Ga0070699_1001494602 | 300 |
| 47 | 3300005937 | Ga0081455_10014656 | Ga0081455_100146565 | 300 |
| 48 | 3300006028 | Ga0070717_10159162 | Ga0070717_101591623 | 300 |
| 49 | 3300006038 | Ga0075365_10059819 | Ga0075365_100598193 | 300 |
| 50 | 3300006175 | Ga0070712_100018198 | Ga0070712_1000181982 | 300 |
| 51 | 3300009094 | Ga0111539_10030515 | Ga0111539_100305152 | 300 |
| 52 | 3300025928 | Ga0207700_10122738 | Ga0207700_101227383 | 300 |
| 53 | 3300030521 | Ga0307511_10000019 | Ga0307511_1000001972 | 300 |
| 54 | 3300035695 | Ga0373927_0030096 | Ga0373927_0030096_866_1861 | 300 |
| 55 | 3300046475 | Ga0495639_0019927 | Ga0495639_0019927_1777_2772 | 300 |
| 56 | 3300046476 | Ga0495662_0146171 | Ga0495662_0146171_125_1120 | 300 |
| 57 | 3300046664 | Ga0495659_0074229 | Ga0495659_0074229_300_1253 | 300 |
| 58 | 3300046683 | Ga0495658_0172039 | Ga0495658_0172039_199_1194 | 300 |
| 59 | 3300046690 | Ga0495624_0021757 | Ga0495624_0021757_1571_2566 | 300 |
| 60 | 3300047321 | Ga0495676_0075192 | Ga0495676_0075192_1226_2221 | 300 |
| 61 | 3300048907 | Ga0496104_0001327 | Ga0496104_0001327_9643_10587 | 300 |
| 62 | 3300048908 | Ga0496105_0050843 | Ga0496105_0050843_10_954 | 300 |
| 63 | 3300048910 | Ga0496107_0076871 | Ga0496107_0076871_189_1133 | 300 |
| 64 | 3300048913 | Ga0496110_0050957 | Ga0496110_0050957_1408_2370 | 300 |
| 65 | 3300048918 | Ga0496115_0059102 | Ga0496115_0059102_420_1364 | 300 |
| 66 | 3300050492 | nmdc:mga0yw44_55814_c1 | nmdc:mga0yw44_55814_c1_1212_2204 | 300 |
| 67 | 3300050511 | nmdc:mga08y16_418836_c1 | nmdc:mga08y16_418836_c1_389_1351 | 300 |
| 68 | 3300050515 | nmdc:mga0a205_540403_c1 | nmdc:mga0a205_540403_c1_43_1005 | 300 |
| 69 | 3300053092 | Ga0500583_0028138 | Ga0500583_0028138_1082_2056 | 300 |
| 70 | 3300005444 | Ga0070694_100036957 | Ga0070694_1000369572 | 301 |
| 71 | 3300005937 | Ga0081455_10050038 | Ga0081455_100500381 | 301 |
| 72 | 3300005937 | Ga0081455_10180659 | Ga0081455_101806592 | 301 |
| 73 | 3300006847 | Ga0075431_100030894 | Ga0075431_1000308942 | 301 |
| 74 | 3300006880 | Ga0075429_100054026 | Ga0075429_1000540263 | 301 |
| 75 | 3300007076 | Ga0075435_100141893 | Ga0075435_1001418932 | 301 |
| 76 | 3300009094 | Ga0111539_10370177 | Ga0111539_103701771 | 301 |
| 77 | 3300046499 | Ga0495594_0011426 | Ga0495594_0011426_915_1865 | 301 |
| 78 | 3300046513 | Ga0495616_0046790 | Ga0495616_0046790_868_1818 | 301 |
| 79 | 3300046517 | Ga0495630_0038696 | Ga0495630_0038696_2212_3159 | 301 |
| 80 | 3300046520 | Ga0495637_0061251 | Ga0495637_0061251_486_1421 | 301 |
| 81 | 3300046523 | Ga0495644_0117334 | Ga0495644_0117334_33_968 | 301 |
| 82 | 3300046533 | Ga0495640_0012886 | Ga0495640_0012886_2110_3057 | 301 |
| 83 | 3300046535 | Ga0495586_0028388 | Ga0495586_0028388_1587_2534 | 301 |
| 84 | 3300046663 | Ga0495635_0254181 | Ga0495635_0254181_152_1099 | 301 |
| 85 | 3300046690 | Ga0495624_0017642 | Ga0495624_0017642_712_1659 | 301 |
| 86 | 3300046691 | Ga0495670_0072521 | Ga0495670_0072521_58_1008 | 301 |
| 87 | 3300048914 | Ga0496111_0194545 | Ga0496111_0194545_54_989 | 301 |
| 88 | 3300005530 | Ga0070679_100332290 | Ga0070679_1003322901 | 302 |
| 89 | 3300009147 | Ga0114129_10258851 | Ga0114129_102588512 | 302 |
| 90 | 3300009147 | Ga0114129_10320129 | Ga0114129_103201292 | 302 |
| 91 | 3300035088 | Ga0373940_0046871 | Ga0373940_0046871_128_1078 | 302 |
| 92 | 3300035114 | Ga0373939_0084887 | Ga0373939_0084887_35_985 | 302 |
| 93 | 3300035115 | Ga0373941_0005939 | Ga0373941_0005939_1440_2390 | 302 |
| 94 | 3300042117 | Ga0450913_000161 | Ga0450913_000161_310_1257 | 302 |
| 95 | 3300042530 | Ga0450916_004176 | Ga0450916_004176_381_1328 | 302 |
| 96 | 3300050508 | nmdc:mga09592_62107_c1 | nmdc:mga09592_62107_c1_721_1668 | 302 |
| 97 | 3300050510 | nmdc:mga06r32_15134_c1 | nmdc:mga06r32_15134_c1_2288_3235 | 302 |
| 98 | 3300053153 | Ga0500616_0046553 | Ga0500616_0046553_584_1552 | 302 |
| 99 | 3300005290 | Ga0065712_10076209 | Ga0065712_100762092 | 303 |
| 100 | 3300005329 | Ga0070683_100007986 | Ga0070683_1000079867 | 303 |
| 101 | 3300005331 | Ga0070670_100046961 | Ga0070670_1000469612 | 303 |
| 102 | 3300005333 | Ga0070677_10030825 | Ga0070677_100308251 | 303 |
| 103 | 3300005334 | Ga0068869_100095903 | Ga0068869_1000959032 | 303 |
| 104 | 3300005334 | Ga0068869_100309620 | Ga0068869_1003096201 | 303 |
| 105 | 3300005335 | Ga0070666_10021763 | Ga0070666_100217632 | 303 |
| 106 | 3300005336 | Ga0070680_100025401 | Ga0070680_1000254012 | 303 |
| 107 | 3300005337 | Ga0070682_100122885 | Ga0070682_1001228851 | 303 |
| 108 | 3300005338 | Ga0068868_100006058 | Ga0068868_10000605810 | 303 |
| 109 | 3300005338 | Ga0068868_100008082 | Ga0068868_1000080826 | 303 |
| 110 | 3300005340 | Ga0070689_100013130 | Ga0070689_1000131304 | 303 |
| 111 | 3300005341 | Ga0070691_10001532 | Ga0070691_100015322 | 303 |
| 112 | 3300005343 | Ga0070687_100000563 | Ga0070687_1000005635 | 303 |
| 113 | 3300005344 | Ga0070661_100006718 | Ga0070661_1000067187 | 303 |
| 114 | 3300005353 | Ga0070669_100004794 | Ga0070669_1000047945 | 303 |
| 115 | 3300005354 | Ga0070675_100000678 | Ga0070675_10000067820 | 303 |
| 116 | 3300005355 | Ga0070671_100000403 | Ga0070671_1000004038 | 303 |
| 117 | 3300005356 | Ga0070674_100010484 | Ga0070674_1000104846 | 303 |
| 118 | 3300005364 | Ga0070673_100005786 | Ga0070673_1000057866 | 303 |
| 119 | 3300005367 | Ga0070667_100336110 | Ga0070667_1003361102 | 303 |
| 120 | 3300005406 | Ga0070703_10051590 | Ga0070703_100515901 | 303 |
| 121 | 3300005435 | Ga0070714_100026265 | Ga0070714_1000262655 | 303 |
| 122 | 3300005436 | Ga0070713_100103250 | Ga0070713_1001032501 | 303 |
| 123 | 3300005438 | Ga0070701_10000846 | Ga0070701_100008462 | 303 |
| 124 | 3300005440 | Ga0070705_100007263 | Ga0070705_1000072634 | 303 |
| 125 | 3300005440 | Ga0070705_100011771 | Ga0070705_1000117712 | 303 |
| 126 | 3300005444 | Ga0070694_100004374 | Ga0070694_10000437410 | 303 |
| 127 | 3300005444 | Ga0070694_100095538 | Ga0070694_1000955382 | 303 |
| 128 | 3300005456 | Ga0070678_100004377 | Ga0070678_1000043773 | 303 |
| 129 | 3300005457 | Ga0070662_100048244 | Ga0070662_1000482442 | 303 |
| 130 | 3300005458 | Ga0070681_10004036 | Ga0070681_100040369 | 303 |
| 131 | 3300005459 | Ga0068867_100001052 | Ga0068867_1000010524 | 303 |
| 132 | 3300005459 | Ga0068867_100027859 | Ga0068867_1000278592 | 303 |
| 133 | 3300005467 | Ga0070706_100038959 | Ga0070706_1000389592 | 303 |
| 134 | 3300005468 | Ga0070707_100066222 | Ga0070707_1000662222 | 303 |
| 135 | 3300005518 | Ga0070699_100003640 | Ga0070699_10000364014 | 303 |
| 136 | 3300005518 | Ga0070699_100019712 | Ga0070699_1000197125 | 303 |
| 137 | 3300005518 | Ga0070699_100115561 | Ga0070699_1001155612 | 303 |
| 138 | 3300005530 | Ga0070679_100040873 | Ga0070679_1000408734 | 303 |
| 139 | 3300005535 | Ga0070684_100018260 | Ga0070684_1000182604 | 303 |
| 140 | 3300005536 | Ga0070697_100040276 | Ga0070697_1000402764 | 303 |
| 141 | 3300005536 | Ga0070697_100128533 | Ga0070697_1001285332 | 303 |
| 142 | 3300005543 | Ga0070672_100004172 | Ga0070672_1000041723 | 303 |
| 143 | 3300005543 | Ga0070672_100077266 | Ga0070672_1000772662 | 303 |
| 144 | 3300005544 | Ga0070686_100004643 | Ga0070686_10000464310 | 303 |
| 145 | 3300005545 | Ga0070695_100013642 | Ga0070695_1000136426 | 303 |
| 146 | 3300005546 | Ga0070696_100000286 | Ga0070696_1000002866 | 303 |
| 147 | 3300005546 | Ga0070696_100005387 | Ga0070696_1000053872 | 303 |
| 148 | 3300005546 | Ga0070696_100009006 | Ga0070696_1000090064 | 303 |
| 149 | 3300005547 | Ga0070693_100000272 | Ga0070693_1000002722 | 303 |
| 150 | 3300005549 | Ga0070704_100258769 | Ga0070704_1002587692 | 303 |
| 151 | 3300005563 | Ga0068855_100056798 | Ga0068855_1000567982 | 303 |
| 152 | 3300005563 | Ga0068855_100331863 | Ga0068855_1003318631 | 303 |
| 153 | 3300005564 | Ga0070664_100000715 | Ga0070664_1000007157 | 303 |
| 154 | 3300005578 | Ga0068854_100013961 | Ga0068854_1000139613 | 303 |
| 155 | 3300005578 | Ga0068854_100017041 | Ga0068854_1000170417 | 303 |
| 156 | 3300005614 | Ga0068856_100172592 | Ga0068856_1001725922 | 303 |
| 157 | 3300005615 | Ga0070702_100002099 | Ga0070702_1000020994 | 303 |
| 158 | 3300005616 | Ga0068852_100012610 | Ga0068852_1000126104 | 303 |
| 159 | 3300005618 | Ga0068864_100000855 | Ga0068864_1000008556 | 303 |
| 160 | 3300005718 | Ga0068866_10000268 | Ga0068866_1000026812 | 303 |
| 161 | 3300005719 | Ga0068861_100000494 | Ga0068861_1000004945 | 303 |
| 162 | 3300005719 | Ga0068861_100003214 | Ga0068861_1000032145 | 303 |
| 163 | 3300005834 | Ga0068851_10006680 | Ga0068851_100066803 | 303 |
| 164 | 3300005840 | Ga0068870_10013548 | Ga0068870_100135485 | 303 |
| 165 | 3300005841 | Ga0068863_100021690 | Ga0068863_1000216906 | 303 |
| 166 | 3300005842 | Ga0068858_100163526 | Ga0068858_1001635262 | 303 |
| 167 | 3300005843 | Ga0068860_100001071 | Ga0068860_10000107128 | 303 |
| 168 | 3300005844 | Ga0068862_100005771 | Ga0068862_1000057717 | 303 |
| 169 | 3300005844 | Ga0068862_100146254 | Ga0068862_1001462542 | 303 |
| 170 | 3300006038 | Ga0075365_10012874 | Ga0075365_100128742 | 303 |
| 171 | 3300006042 | Ga0075368_10050465 | Ga0075368_100504651 | 303 |
| 172 | 3300006048 | Ga0075363_100045905 | Ga0075363_1000459052 | 303 |
| 173 | 3300006051 | Ga0075364_10086138 | Ga0075364_100861382 | 303 |
| 174 | 3300006173 | Ga0070716_100027556 | Ga0070716_1000275562 | 303 |
| 175 | 3300006173 | Ga0070716_100271943 | Ga0070716_1002719432 | 303 |
| 176 | 3300006237 | Ga0097621_100002822 | Ga0097621_1000028228 | 303 |
| 177 | 3300006237 | Ga0097621_100003412 | Ga0097621_10000341213 | 303 |
| 178 | 3300006358 | Ga0068871_100002838 | Ga0068871_1000028385 | 303 |
| 179 | 3300006358 | Ga0068871_100003826 | Ga0068871_1000038264 | 303 |
| 180 | 3300006844 | Ga0075428_100011770 | Ga0075428_1000117705 | 303 |
| 181 | 3300006844 | Ga0075428_100429266 | Ga0075428_1004292662 | 303 |
| 182 | 3300006846 | Ga0075430_100003725 | Ga0075430_1000037258 | 303 |
| 183 | 3300006846 | Ga0075430_100026920 | Ga0075430_1000269204 | 303 |
| 184 | 3300006846 | Ga0075430_100163239 | Ga0075430_1001632392 | 303 |
| 185 | 3300006847 | Ga0075431_100492529 | Ga0075431_1004925292 | 303 |
| 186 | 3300006852 | Ga0075433_10001763 | Ga0075433_100017632 | 303 |
| 187 | 3300006852 | Ga0075433_10516578 | Ga0075433_105165782 | 303 |
| 188 | 3300006871 | Ga0075434_100000033 | Ga0075434_10000003333 | 303 |
| 189 | 3300006871 | Ga0075434_100000318 | Ga0075434_10000031843 | 303 |
| 190 | 3300006871 | Ga0075434_100124510 | Ga0075434_1001245103 | 303 |
| 191 | 3300006880 | Ga0075429_100000191 | Ga0075429_10000019138 | 303 |
| 192 | 3300006881 | Ga0068865_100005516 | Ga0068865_1000055168 | 303 |
| 193 | 3300006881 | Ga0068865_100007719 | Ga0068865_1000077192 | 303 |
| 194 | 3300006914 | Ga0075436_100001263 | Ga0075436_1000012636 | 303 |
| 195 | 3300006914 | Ga0075436_100001365 | Ga0075436_10000136514 | 303 |
| 196 | 3300006914 | Ga0075436_100018853 | Ga0075436_1000188534 | 303 |
| 197 | 3300006914 | Ga0075436_100065802 | Ga0075436_1000658021 | 303 |
| 198 | 3300006914 | Ga0075436_100166024 | Ga0075436_1001660242 | 303 |
| 199 | 3300007076 | Ga0075435_100000095 | Ga0075435_10000009533 | 303 |
| 200 | 3300007076 | Ga0075435_100086020 | Ga0075435_1000860202 | 303 |
| 201 | 3300007076 | Ga0075435_100100107 | Ga0075435_1001001072 | 303 |
| 202 | 3300007076 | Ga0075435_100377384 | Ga0075435_1003773842 | 303 |
| 203 | 3300007265 | Ga0099794_10032073 | Ga0099794_100320732 | 303 |
| 204 | 3300007265 | Ga0099794_10040210 | Ga0099794_100402101 | 303 |
| 205 | 3300009094 | Ga0111539_10027400 | Ga0111539_100274003 | 303 |
| 206 | 3300009094 | Ga0111539_10031451 | Ga0111539_100314518 | 303 |
| 207 | 3300009094 | Ga0111539_10056838 | Ga0111539_100568384 | 303 |
| 208 | 3300009094 | Ga0111539_10528040 | Ga0111539_105280401 | 303 |
| 209 | 3300009098 | Ga0105245_10000900 | Ga0105245_1000090023 | 303 |
| 210 | 3300009147 | Ga0114129_10027395 | Ga0114129_100273954 | 303 |
| 211 | 3300009147 | Ga0114129_10495655 | Ga0114129_104956552 | 303 |
| 212 | 3300009148 | Ga0105243_10002495 | Ga0105243_1000249517 | 303 |
| 213 | 3300009148 | Ga0105243_10012365 | Ga0105243_100123654 | 303 |
| 214 | 3300009174 | Ga0105241_10013546 | Ga0105241_100135465 | 303 |
| 215 | 3300009176 | Ga0105242_10000570 | Ga0105242_1000057028 | 303 |
| 216 | 3300009177 | Ga0105248_10046301 | Ga0105248_100463012 | 303 |
| 217 | 3300009177 | Ga0105248_10292651 | Ga0105248_102926511 | 303 |
| 218 | 3300009553 | Ga0105249_10004906 | Ga0105249_100049067 | 303 |
| 219 | 3300009553 | Ga0105249_10011144 | Ga0105249_100111449 | 303 |
| 220 | 3300010375 | Ga0105239_10710452 | Ga0105239_107104522 | 303 |
| 221 | 3300011119 | Ga0105246_10107443 | Ga0105246_101074431 | 303 |
| 222 | 3300013296 | Ga0157374_10013274 | Ga0157374_100132746 | 303 |
| 223 | 3300013297 | Ga0157378_10013586 | Ga0157378_100135865 | 303 |
| 224 | 3300013306 | Ga0163162_10074780 | Ga0163162_100747802 | 303 |
| 225 | 3300013308 | Ga0157375_10014357 | Ga0157375_100143573 | 303 |
| 226 | 3300013308 | Ga0157375_10224640 | Ga0157375_102246402 | 303 |
| 227 | 3300014326 | Ga0157380_10072009 | Ga0157380_100720092 | 303 |
| 228 | 3300014326 | Ga0157380_10119946 | Ga0157380_101199462 | 303 |
| 229 | 3300014969 | Ga0157376_10025461 | Ga0157376_100254613 | 303 |
| 230 | 3300014969 | Ga0157376_10049805 | Ga0157376_100498053 | 303 |
| 231 | 3300025315 | Ga0207697_10102463 | Ga0207697_101024632 | 303 |
| 232 | 3300025321 | Ga0207656_10004859 | Ga0207656_100048592 | 303 |
| 233 | 3300025885 | Ga0207653_10030736 | Ga0207653_100307361 | 303 |
| 234 | 3300025893 | Ga0207682_10041450 | Ga0207682_100414502 | 303 |
| 235 | 3300025893 | Ga0207682_10075587 | Ga0207682_100755872 | 303 |
| 236 | 3300025899 | Ga0207642_10095869 | Ga0207642_100958692 | 303 |
| 237 | 3300025903 | Ga0207680_10012474 | Ga0207680_100124742 | 303 |
| 238 | 3300025904 | Ga0207647_10060267 | Ga0207647_100602672 | 303 |
| 239 | 3300025908 | Ga0207643_10007262 | Ga0207643_100072627 | 303 |
| 240 | 3300025911 | Ga0207654_10050354 | Ga0207654_100503542 | 303 |
| 241 | 3300025912 | Ga0207707_10023586 | Ga0207707_100235862 | 303 |
| 242 | 3300025912 | Ga0207707_10132004 | Ga0207707_101320042 | 303 |
| 243 | 3300025915 | Ga0207693_10184674 | Ga0207693_101846741 | 303 |
| 244 | 3300025917 | Ga0207660_10003686 | Ga0207660_100036862 | 303 |
| 245 | 3300025918 | Ga0207662_10000255 | Ga0207662_1000025522 | 303 |
| 246 | 3300025920 | Ga0207649_10011853 | Ga0207649_100118532 | 303 |
| 247 | 3300025921 | Ga0207652_10063374 | Ga0207652_100633742 | 303 |
| 248 | 3300025925 | Ga0207650_10008372 | Ga0207650_100083724 | 303 |
| 249 | 3300025926 | Ga0207659_10005784 | Ga0207659_100057842 | 303 |
| 250 | 3300025926 | Ga0207659_10017688 | Ga0207659_100176882 | 303 |
| 251 | 3300025927 | Ga0207687_10060966 | Ga0207687_100609662 | 303 |
| 252 | 3300025928 | Ga0207700_10194097 | Ga0207700_101940971 | 303 |
| 253 | 3300025931 | Ga0207644_10022367 | Ga0207644_100223672 | 303 |
| 254 | 3300025933 | Ga0207706_10090481 | Ga0207706_100904812 | 303 |
| 255 | 3300025934 | Ga0207686_10013086 | Ga0207686_100130864 | 303 |
| 256 | 3300025935 | Ga0207709_10012837 | Ga0207709_100128373 | 303 |
| 257 | 3300025935 | Ga0207709_10201511 | Ga0207709_102015112 | 303 |
| 258 | 3300025936 | Ga0207670_10009101 | Ga0207670_100091012 | 303 |
| 259 | 3300025936 | Ga0207670_10064336 | Ga0207670_100643362 | 303 |
| 260 | 3300025937 | Ga0207669_10004046 | Ga0207669_100040462 | 303 |
| 261 | 3300025938 | Ga0207704_10001889 | Ga0207704_1000188910 | 303 |
| 262 | 3300025938 | Ga0207704_10006023 | Ga0207704_100060232 | 303 |
| 263 | 3300025939 | Ga0207665_10187817 | Ga0207665_101878171 | 303 |
| 264 | 3300025940 | Ga0207691_10000553 | Ga0207691_100005538 | 303 |
| 265 | 3300025941 | Ga0207711_10042867 | Ga0207711_100428671 | 303 |
| 266 | 3300025942 | Ga0207689_10011317 | Ga0207689_100113175 | 303 |
| 267 | 3300025944 | Ga0207661_10003659 | Ga0207661_100036598 | 303 |
| 268 | 3300025945 | Ga0207679_10008461 | Ga0207679_100084613 | 303 |
| 269 | 3300025949 | Ga0207667_10046208 | Ga0207667_100462082 | 303 |
| 270 | 3300025960 | Ga0207651_10316624 | Ga0207651_103166242 | 303 |
| 271 | 3300025961 | Ga0207712_10050627 | Ga0207712_100506272 | 303 |
| 272 | 3300025961 | Ga0207712_10125394 | Ga0207712_101253942 | 303 |
| 273 | 3300025972 | Ga0207668_10189061 | Ga0207668_101890612 | 303 |
| 274 | 3300025981 | Ga0207640_10009859 | Ga0207640_100098593 | 303 |
| 275 | 3300025981 | Ga0207640_10028180 | Ga0207640_100281802 | 303 |
| 276 | 3300026023 | Ga0207677_10003501 | Ga0207677_100035014 | 303 |
| 277 | 3300026023 | Ga0207677_10074232 | Ga0207677_100742322 | 303 |
| 278 | 3300026035 | Ga0207703_10026263 | Ga0207703_100262633 | 303 |
| 279 | 3300026035 | Ga0207703_10315216 | Ga0207703_103152162 | 303 |
| 280 | 3300026075 | Ga0207708_10008564 | Ga0207708_100085644 | 303 |
| 281 | 3300026089 | Ga0207648_10000276 | Ga0207648_1000027616 | 303 |
| 282 | 3300026095 | Ga0207676_10003972 | Ga0207676_100039724 | 303 |
| 283 | 3300026116 | Ga0207674_10426547 | Ga0207674_104265472 | 303 |
| 284 | 3300026118 | Ga0207675_100006484 | Ga0207675_1000064847 | 303 |
| 285 | 3300026118 | Ga0207675_100007574 | Ga0207675_1000075748 | 303 |
| 286 | 3300026121 | Ga0207683_10009572 | Ga0207683_100095723 | 303 |
| 287 | 3300026142 | Ga0207698_10006445 | Ga0207698_100064456 | 303 |
| 288 | 3300027907 | Ga0207428_10000726 | Ga0207428_1000072637 | 303 |
| 289 | 3300027907 | Ga0207428_10059832 | Ga0207428_100598322 | 303 |
| 290 | 3300027907 | Ga0207428_10103966 | Ga0207428_101039662 | 303 |
| 291 | 3300028379 | Ga0268266_10097245 | Ga0268266_100972452 | 303 |
| 292 | 3300028381 | Ga0268264_10017841 | Ga0268264_100178414 | 303 |
| 293 | 3300028381 | Ga0268264_10247930 | Ga0268264_102479302 | 303 |
| 294 | 3300031731 | Ga0307405_10260539 | Ga0307405_102605392 | 303 |
| 295 | 3300032005 | Ga0307411_10217152 | Ga0307411_102171522 | 303 |
| 296 | 3300034957 | Ga0373938_0021153 | Ga0373938_0021153_205_1158 | 303 |
| 297 | 3300035083 | Ga0373926_0002688 | Ga0373926_0002688_2723_3676 | 303 |
| 298 | 3300035085 | Ga0373929_0015766 | Ga0373929_0015766_397_1350 | 303 |
| 299 | 3300035085 | Ga0373929_0022292 | Ga0373929_0022292_223_1176 | 303 |
| 300 | 3300035086 | Ga0373934_0015905 | Ga0373934_0015905_1572_2531 | 303 |
| 301 | 3300035090 | Ga0373949_0033982 | Ga0373949_0033982_219_1172 | 303 |
| 302 | 3300035092 | Ga0373952_0021674 | Ga0373952_0021674_124_1077 | 303 |
| 303 | 3300035115 | Ga0373941_0012975 | Ga0373941_0012975_604_1557 | 303 |
| 304 | 3300035116 | Ga0373945_0004289 | Ga0373945_0004289_2008_2961 | 303 |
| 305 | 3300035170 | Ga0373943_0004208 | Ga0373943_0004208_2096_3049 | 303 |
| 306 | 3300035170 | Ga0373943_0048192 | Ga0373943_0048192_353_1306 | 303 |
| 307 | 3300035691 | Ga0373931_0038696 | Ga0373931_0038696_1167_2120 | 303 |
| 308 | 3300035692 | Ga0373935_0070899 | Ga0373935_0070899_1170_2123 | 303 |
| 309 | 3300035725 | Ga0373947_0009232 | Ga0373947_0009232_2295_3248 | 303 |
| 310 | 3300035725 | Ga0373947_0010041 | Ga0373947_0010041_1584_2537 | 303 |
| 311 | 3300037068 | Ga0373925_0013212 | Ga0373925_0013212_2520_3473 | 303 |
| 312 | 3300037068 | Ga0373925_0196284 | Ga0373925_0196284_166_1119 | 303 |
| 313 | 3300037471 | Ga0395905_0084323 | Ga0395905_0084323_1421_2395 | 303 |
| 314 | 3300042001 | Ga0439441_002703 | Ga0439441_002703_737_1711 | 303 |
| 315 | 3300042436 | Ga0439435_0029780 | Ga0439435_0029780_331_1305 | 303 |
| 316 | 3300045051 | Ga0451576_0001715 | Ga0451576_0001715_11107_12060 | 303 |
| 317 | 3300045051 | Ga0451576_0175914 | Ga0451576_0175914_934_1890 | 303 |
| 318 | 3300046454 | Ga0495592_0006561 | Ga0495592_0006561_7323_8276 | 303 |
| 319 | 3300046455 | Ga0495603_0002544 | Ga0495603_0002544_5982_6935 | 303 |
| 320 | 3300046459 | Ga0495629_0168046 | Ga0495629_0168046_442_1395 | 303 |
| 321 | 3300046472 | Ga0495580_0002354 | Ga0495580_0002354_1226_2179 | 303 |
| 322 | 3300046475 | Ga0495639_0010766 | Ga0495639_0010766_850_1803 | 303 |
| 323 | 3300046476 | Ga0495662_0012546 | Ga0495662_0012546_2258_3211 | 303 |
| 324 | 3300046476 | Ga0495662_0027363 | Ga0495662_0027363_1152_2102 | 303 |
| 325 | 3300046511 | Ga0495608_0012778 | Ga0495608_0012778_4820_5773 | 303 |
| 326 | 3300046514 | Ga0495618_0006638 | Ga0495618_0006638_5861_6814 | 303 |
| 327 | 3300046516 | Ga0495628_0117528 | Ga0495628_0117528_355_1305 | 303 |
| 328 | 3300046517 | Ga0495630_0001728 | Ga0495630_0001728_5502_6455 | 303 |
| 329 | 3300046526 | Ga0495666_0020549 | Ga0495666_0020549_1652_2605 | 303 |
| 330 | 3300046526 | Ga0495666_0026411 | Ga0495666_0026411_1419_2372 | 303 |
| 331 | 3300046531 | Ga0495665_0043776 | Ga0495665_0043776_538_1491 | 303 |
| 332 | 3300046533 | Ga0495640_0005587 | Ga0495640_0005587_8875_9828 | 303 |
| 333 | 3300046535 | Ga0495586_0002567 | Ga0495586_0002567_8107_9060 | 303 |
| 334 | 3300046535 | Ga0495586_0011166 | Ga0495586_0011166_3792_4745 | 303 |
| 335 | 3300046536 | Ga0495587_0056143 | Ga0495587_0056143_1052_2005 | 303 |
| 336 | 3300046543 | Ga0495645_0152758 | Ga0495645_0152758_248_1201 | 303 |
| 337 | 3300046674 | Ga0495588_0006249 | Ga0495588_0006249_1727_2680 | 303 |
| 338 | 3300046678 | Ga0495599_0033235 | Ga0495599_0033235_642_1595 | 303 |
| 339 | 3300046681 | Ga0495647_0000058 | Ga0495647_0000058_13511_14464 | 303 |
| 340 | 3300046683 | Ga0495658_0012479 | Ga0495658_0012479_2570_3523 | 303 |
| 341 | 3300046683 | Ga0495658_0019833 | Ga0495658_0019833_58_1011 | 303 |
| 342 | 3300046690 | Ga0495624_0155810 | Ga0495624_0155810_321_1271 | 303 |
| 343 | 3300047317 | Ga0495604_0018716 | Ga0495604_0018716_1874_2827 | 303 |
| 344 | 3300047319 | Ga0495674_0069160 | Ga0495674_0069160_1902_2855 | 303 |
| 345 | 3300047322 | Ga0495680_0004705 | Ga0495680_0004705_7702_8655 | 303 |
| 346 | 3300048903 | Ga0496100_0088744 | Ga0496100_0088744_301_1263 | 303 |
| 347 | 3300048904 | Ga0496101_0100903 | Ga0496101_0100903_117_1079 | 303 |
| 348 | 3300048911 | Ga0496108_0020494 | Ga0496108_0020494_1172_2134 | 303 |
| 349 | 3300048912 | Ga0496109_0025531 | Ga0496109_0025531_1888_2850 | 303 |
| 350 | 3300048913 | Ga0496110_0008245 | Ga0496110_0008245_5340_6302 | 303 |
| 351 | 3300048913 | Ga0496110_0197369 | Ga0496110_0197369_190_1158 | 303 |
| 352 | 3300048914 | Ga0496111_0017425 | Ga0496111_0017425_2053_3015 | 303 |
| 353 | 3300048916 | Ga0496113_0065521 | Ga0496113_0065521_632_1594 | 303 |
| 354 | 3300049572 | Ga0501036_0197957 | Ga0501036_0197957_19_984 | 303 |
| 355 | 3300049576 | Ga0501040_0003088 | Ga0501040_0003088_6247_7212 | 303 |
| 356 | 3300049577 | Ga0501041_0005947 | Ga0501041_0005947_4752_5717 | 303 |
| 357 | 3300049577 | Ga0501041_0064912 | Ga0501041_0064912_1119_2072 | 303 |
| 358 | 3300049578 | Ga0501042_0016022 | Ga0501042_0016022_3809_4774 | 303 |
| 359 | 3300049579 | Ga0501043_0077251 | Ga0501043_0077251_1476_2441 | 303 |
| 360 | 3300049588 | Ga0501072_0029111 | Ga0501072_0029111_1693_2658 | 303 |
| 361 | 3300049591 | Ga0501075_0129546 | Ga0501075_0129546_273_1226 | 303 |
| 362 | 3300049824 | Ga0501045_0087567 | Ga0501045_0087567_1139_2287 | 303 |
| 363 | 3300050492 | nmdc:mga0yw44_8602_c1 | nmdc:mga0yw44_8602_c1_1965_2963 | 303 |
| 364 | 3300050507 | nmdc:mga05p37_40918_c1 | nmdc:mga05p37_40918_c1_2893_3846 | 303 |
| 365 | 3300050508 | nmdc:mga09592_272_c1 | nmdc:mga09592_272_c1_31206_32159 | 303 |
| 366 | 3300050509 | nmdc:mga0qj67_40253_c1 | nmdc:mga0qj67_40253_c1_966_1916 | 303 |
| 367 | 3300050511 | nmdc:mga08y16_29377_c1 | nmdc:mga08y16_29377_c1_1123_2073 | 303 |
| 368 | 3300050511 | nmdc:mga08y16_33586_c1 | nmdc:mga08y16_33586_c1_1718_2671 | 303 |
| 369 | 3300050511 | nmdc:mga08y16_40016_c1 | nmdc:mga08y16_40016_c1_447_1400 | 303 |
| 370 | 3300050512 | nmdc:mga0n895_159_c1 | nmdc:mga0n895_159_c1_21083_22036 | 303 |
| 371 | 3300050512 | nmdc:mga0n895_189894_c1 | nmdc:mga0n895_189894_c1_34_1074 | 303 |
| 372 | 3300050512 | nmdc:mga0n895_441517_c1 | nmdc:mga0n895_441517_c1_226_1179 | 303 |
| 373 | 3300050512 | nmdc:mga0n895_620694_c1 | nmdc:mga0n895_620694_c1_71_1021 | 303 |
| 374 | 3300050512 | nmdc:mga0n895_80639_c1 | nmdc:mga0n895_80639_c1_1553_2521 | 303 |
| 375 | 3300050512 | nmdc:mga0n895_8305_c1 | nmdc:mga0n895_8305_c1_7283_8236 | 303 |
| 376 | 3300050513 | nmdc:mga0rr50_10116_c1 | nmdc:mga0rr50_10116_c1_1936_2889 | 303 |
| 377 | 3300050513 | nmdc:mga0rr50_127362_c1 | nmdc:mga0rr50_127362_c1_458_1408 | 303 |
| 378 | 3300050513 | nmdc:mga0rr50_76070_c1 | nmdc:mga0rr50_76070_c1_992_1945 | 303 |
| 379 | 3300050514 | nmdc:mga08x19_37558_c1 | nmdc:mga08x19_37558_c1_2011_2961 | 303 |
| 380 | 3300050514 | nmdc:mga08x19_54324_c1 | nmdc:mga08x19_54324_c1_1202_2155 | 303 |
| 381 | 3300050514 | nmdc:mga08x19_6451_c1 | nmdc:mga08x19_6451_c1_5553_6506 | 303 |
| 382 | 3300050514 | nmdc:mga08x19_833_c1 | nmdc:mga08x19_833_c1_6429_7382 | 303 |
| 383 | 3300050515 | nmdc:mga0a205_175_c1 | nmdc:mga0a205_175_c1_30238_31191 | 303 |
| 384 | 3300050515 | nmdc:mga0a205_316644_c1 | nmdc:mga0a205_316644_c1_179_1147 | 303 |
| 385 | 3300053085 | Ga0495619_0107214 | Ga0495619_0107214_228_1181 | 303 |
| 386 | 3300003215 | JGI25153J46596_10002964 | JGI25153J46596_100029642 | 304 |
| 387 | 3300003215 | JGI25153J46596_10004430 | JGI25153J46596_100044303 | 304 |
| 388 | 3300005547 | Ga0070693_100024057 | Ga0070693_1000240572 | 304 |
| 389 | 3300006195 | Ga0075366_10053412 | Ga0075366_100534122 | 304 |
| 390 | 3300009094 | Ga0111539_10074451 | Ga0111539_100744512 | 304 |
| 391 | 3300009177 | Ga0105248_10590393 | Ga0105248_105903932 | 304 |
| 392 | 3300025297 | Ga0209758_1000351 | Ga0209758_100035164 | 304 |
| 393 | 3300025297 | Ga0209758_1001016 | Ga0209758_100101610 | 304 |
| 394 | 3300025297 | Ga0209758_1049604 | Ga0209758_10496042 | 304 |
| 395 | 3300025944 | Ga0207661_10263640 | Ga0207661_102636402 | 304 |
| 396 | 3300025961 | Ga0207712_10166362 | Ga0207712_101663622 | 304 |
| 397 | 3300026118 | Ga0207675_100467109 | Ga0207675_1004671092 | 304 |
| 398 | 3300026142 | Ga0207698_10513135 | Ga0207698_105131351 | 304 |
| 399 | 3300035692 | Ga0373935_0189732 | Ga0373935_0189732_317_1291 | 304 |
| 400 | 3300037466 | Ga0395898_0108630 | Ga0395898_0108630_16_993 | 304 |
| 401 | 3300044683 | Ga0466965_0027491 | Ga0466965_0027491_947_1933 | 304 |
| 402 | 3300044842 | Ga0466957_0025397 | Ga0466957_0025397_1392_2378 | 304 |
| 403 | 3300046462 | Ga0495651_0151781 | Ga0495651_0151781_90_1058 | 304 |
| 404 | 3300046615 | Ga0495656_0122916 | Ga0495656_0122916_218_1192 | 304 |
| 405 | 3300048903 | Ga0496100_0057950 | Ga0496100_0057950_981_1979 | 304 |
| 406 | 3300048907 | Ga0496104_0000775 | Ga0496104_0000775_14405_15394 | 304 |
| 407 | 3300048907 | Ga0496104_0001388 | Ga0496104_0001388_4482_5459 | 304 |
| 408 | 3300048908 | Ga0496105_0006927 | Ga0496105_0006927_4499_5476 | 304 |
| 409 | 3300048909 | Ga0496106_0020742 | Ga0496106_0020742_2466_3455 | 304 |
| 410 | 3300048912 | Ga0496109_0129696 | Ga0496109_0129696_872_1849 | 304 |
| 411 | 3300048912 | Ga0496109_0277292 | Ga0496109_0277292_197_1186 | 304 |
| 412 | 3300048912 | Ga0496109_0470447 | Ga0496109_0470447_67_1056 | 304 |
| 413 | 3300048918 | Ga0496115_0013314 | Ga0496115_0013314_3778_4755 | 304 |
| 414 | 3300049744 | Ga0501083_0148170 | Ga0501083_0148170_320_1453 | 304 |
| 415 | 3300050493 | nmdc:mga0k408_17331_c1 | nmdc:mga0k408_17331_c1_297_1289 | 304 |
| 416 | 3300050511 | nmdc:mga08y16_245273_c1 | nmdc:mga08y16_245273_c1_814_1803 | 304 |
| 417 | 3300053090 | Ga0500646_0003926 | Ga0500646_0003926_2598_3569 | 304 |
| 418 | 3300053151 | Ga0500604_0000597 | Ga0500604_0000597_1252_2223 | 304 |
| 419 | 3300005336 | Ga0070680_100013168 | Ga0070680_1000131683 | 305 |
| 420 | 3300005458 | Ga0070681_10085487 | Ga0070681_100854873 | 305 |
| 421 | 3300005530 | Ga0070679_100211279 | Ga0070679_1002112792 | 305 |
| 422 | 3300005539 | Ga0068853_100357414 | Ga0068853_1003574141 | 305 |
| 423 | 3300006038 | Ga0075365_10181074 | Ga0075365_101810741 | 305 |
| 424 | 3300006042 | Ga0075368_10004530 | Ga0075368_100045302 | 305 |
| 425 | 3300006048 | Ga0075363_100000486 | Ga0075363_1000004863 | 305 |
| 426 | 3300006051 | Ga0075364_10058077 | Ga0075364_100580772 | 305 |
| 427 | 3300006178 | Ga0075367_10075989 | Ga0075367_100759892 | 305 |
| 428 | 3300006186 | Ga0075369_10013341 | Ga0075369_100133413 | 305 |
| 429 | 3300006186 | Ga0075369_10025096 | Ga0075369_100250963 | 305 |
| 430 | 3300006186 | Ga0075369_10065295 | Ga0075369_100652952 | 305 |
| 431 | 3300006353 | Ga0075370_10021086 | Ga0075370_100210864 | 305 |
| 432 | 3300006844 | Ga0075428_100011372 | Ga0075428_1000113722 | 305 |
| 433 | 3300006880 | Ga0075429_100004103 | Ga0075429_10000410311 | 305 |
| 434 | 3300007788 | Ga0099795_10008852 | Ga0099795_100088522 | 305 |
| 435 | 3300026041 | Ga0207639_10230104 | Ga0207639_102301042 | 305 |
| 436 | 3300030521 | Ga0307511_10010947 | Ga0307511_100109477 | 305 |
| 437 | 3300031238 | Ga0265332_10000812 | Ga0265332_1000081221 | 305 |
| 438 | 3300031241 | Ga0265325_10078596 | Ga0265325_100785962 | 305 |
| 439 | 3300031247 | Ga0265340_10002068 | Ga0265340_1000206812 | 305 |
| 440 | 3300031249 | Ga0265339_10000669 | Ga0265339_1000066913 | 305 |
| 441 | 3300031249 | Ga0265339_10094900 | Ga0265339_100949002 | 305 |
| 442 | 3300031250 | Ga0265331_10006261 | Ga0265331_100062619 | 305 |
| 443 | 3300031711 | Ga0265314_10031514 | Ga0265314_100315142 | 305 |
| 444 | 3300031712 | Ga0265342_10000856 | Ga0265342_100008566 | 305 |
| 445 | 3300035119 | Ga0373956_0090421 | Ga0373956_0090421_280_1257 | 305 |
| 446 | 3300035120 | Ga0373957_0008394 | Ga0373957_0008394_156_1133 | 305 |
| 447 | 3300035121 | Ga0373960_0014342 | Ga0373960_0014342_202_1188 | 305 |
| 448 | 3300035170 | Ga0373943_0216507 | Ga0373943_0216507_47_1018 | 305 |
| 449 | 3300035172 | Ga0373955_0007789 | Ga0373955_0007789_2876_3853 | 305 |
| 450 | 3300035241 | Ga0373961_0009342 | Ga0373961_0009342_791_1777 | 305 |
| 451 | 3300035410 | Ga0373924_0032332 | Ga0373924_0032332_375_1352 | 305 |
| 452 | 3300035692 | Ga0373935_0080434 | Ga0373935_0080434_765_1736 | 305 |
| 453 | 3300035695 | Ga0373927_0241926 | Ga0373927_0241926_96_1067 | 305 |
| 454 | 3300035724 | Ga0373933_0010844 | Ga0373933_0010844_711_1688 | 305 |
| 455 | 3300035725 | Ga0373947_0097147 | Ga0373947_0097147_701_1672 | 305 |
| 456 | 3300035725 | Ga0373947_0143622 | Ga0373947_0143622_504_1475 | 305 |
| 457 | 3300036401 | Ga0373937_0008865 | Ga0373937_0008865_4290_5267 | 305 |
| 458 | 3300037068 | Ga0373925_0028674 | Ga0373925_0028674_2945_3982 | 305 |
| 459 | 3300037068 | Ga0373925_0159263 | Ga0373925_0159263_464_1435 | 305 |
| 460 | 3300037418 | Ga0395900_0355947 | Ga0395900_0355947_443_1423 | 305 |
| 461 | 3300037466 | Ga0395898_0153895 | Ga0395898_0153895_268_1248 | 305 |
| 462 | 3300038443 | Ga0395901_0131752 | Ga0395901_0131752_376_1356 | 305 |
| 463 | 3300039437 | Ga0436365_1429691 | Ga0436365_1429691_122_1099 | 305 |
| 464 | 3300046462 | Ga0495651_0211473 | Ga0495651_0211473_244_1221 | 305 |
| 465 | 3300046511 | Ga0495608_0006443 | Ga0495608_0006443_3284_4261 | 305 |
| 466 | 3300046559 | Ga0495667_0056892 | Ga0495667_0056892_961_1938 | 305 |
| 467 | 3300046675 | Ga0495657_0005797 | Ga0495657_0005797_3260_4237 | 305 |
| 468 | 3300046679 | Ga0495623_0076879 | Ga0495623_0076879_753_1730 | 305 |
| 469 | 3300046809 | Ga0495600_0034149 | Ga0495600_0034149_72_1049 | 305 |
| 470 | 3300047317 | Ga0495604_0136344 | Ga0495604_0136344_38_1015 | 305 |
| 471 | 3300047322 | Ga0495680_0094765 | Ga0495680_0094765_1234_2211 | 305 |
| 472 | 3300047444 | Ga0495675_0051153 | Ga0495675_0051153_310_1287 | 305 |
| 473 | 3300048088 | Ga0495602_0243566 | Ga0495602_0243566_118_1089 | 305 |
| 474 | 3300049569 | Ga0501032_0010690 | Ga0501032_0010690_2047_3027 | 305 |
| 475 | 3300049571 | Ga0501034_0121088 | Ga0501034_0121088_834_1817 | 305 |
| 476 | 3300049573 | Ga0501037_0009409 | Ga0501037_0009409_4512_5492 | 305 |
| 477 | 3300049574 | Ga0501038_0010065 | Ga0501038_0010065_5317_6297 | 305 |
| 478 | 3300049579 | Ga0501043_0000386 | Ga0501043_0000386_28263_29252 | 305 |
| 479 | 3300049580 | Ga0501046_0000491 | Ga0501046_0000491_10208_11197 | 305 |
| 480 | 3300049580 | Ga0501046_0001179 | Ga0501046_0001179_20861_21841 | 305 |
| 481 | 3300049581 | Ga0501047_0000021 | Ga0501047_0000021_225590_226579 | 305 |
| 482 | 3300049582 | Ga0501048_0009095 | Ga0501048_0009095_3216_4205 | 305 |
| 483 | 3300049584 | Ga0501068_0005838 | Ga0501068_0005838_748_1728 | 305 |
| 484 | 3300049586 | Ga0501070_0019933 | Ga0501070_0019933_4512_5492 | 305 |
| 485 | 3300049589 | Ga0501073_0004780 | Ga0501073_0004780_1196_2176 | 305 |
| 486 | 3300049742 | Ga0501080_0164832 | Ga0501080_0164832_561_1541 | 305 |
| 487 | 3300049822 | Ga0501035_0283568 | Ga0501035_0283568_393_1373 | 305 |
| 488 | 3300049823 | Ga0501044_0000411 | Ga0501044_0000411_28977_29960 | 305 |
| 489 | 3300049824 | Ga0501045_0004535 | Ga0501045_0004535_1072_2052 | 305 |
| 490 | 3300050489 | nmdc:mga03683_9684_c1 | nmdc:mga03683_9684_c1_1030_2004 | 305 |
| 491 | 3300050491 | nmdc:mga00v17_142261_c1 | nmdc:mga00v17_142261_c1_278_1252 | 305 |
| 492 | 3300050494 | nmdc:mga06z11_42449_c1 | nmdc:mga06z11_42449_c1_15_989 | 305 |
| 493 | 3300050496 | nmdc:mga07m45_8286_c2 | nmdc:mga07m45_8286_c2_958_1932 | 305 |
| 494 | 3300050508 | nmdc:mga09592_256552_c1 | nmdc:mga09592_256552_c1_248_1237 | 305 |
| 495 | 3300053077 | Ga0495601_0011258 | Ga0495601_0011258_2598_3575 | 305 |
| 496 | 3300053077 | Ga0495601_0133707 | Ga0495601_0133707_507_1478 | 305 |
| 497 | 3300053078 | Ga0495612_0082234 | Ga0495612_0082234_368_1339 | 305 |
| 498 | 3300053084 | Ga0495595_0005633 | Ga0495595_0005633_2824_3801 | 305 |
| 499 | 3300054114 | Ga0501084_0009132 | Ga0501084_0009132_4751_5731 | 305 |
| 500 | 3300001991 | JGI24743J22301_10009334 | JGI24743J22301_100093342 | 306 |
| 501 | 3300002075 | JGI24738J21930_10018815 | JGI24738J21930_100188152 | 306 |
| 502 | 3300002077 | JGI24744J21845_10013371 | JGI24744J21845_100133712 | 306 |
| 503 | 3300002244 | JGI24742J22300_10008724 | JGI24742J22300_100087242 | 306 |
| 504 | 3300005334 | Ga0068869_100063712 | Ga0068869_1000637122 | 306 |
| 505 | 3300005338 | Ga0068868_100005853 | Ga0068868_1000058533 | 306 |
| 506 | 3300005341 | Ga0070691_10133705 | Ga0070691_101337052 | 306 |
| 507 | 3300005344 | Ga0070661_100052899 | Ga0070661_1000528992 | 306 |
| 508 | 3300005347 | Ga0070668_100157882 | Ga0070668_1001578822 | 306 |
| 509 | 3300005354 | Ga0070675_100042286 | Ga0070675_1000422864 | 306 |
| 510 | 3300005355 | Ga0070671_100182696 | Ga0070671_1001826962 | 306 |
| 511 | 3300005366 | Ga0070659_100243602 | Ga0070659_1002436022 | 306 |
| 512 | 3300005367 | Ga0070667_100293096 | Ga0070667_1002930962 | 306 |
| 513 | 3300005441 | Ga0070700_100027753 | Ga0070700_1000277533 | 306 |
| 514 | 3300005459 | Ga0068867_100191118 | Ga0068867_1001911182 | 306 |
| 515 | 3300005466 | Ga0070685_10137947 | Ga0070685_101379471 | 306 |
| 516 | 3300005535 | Ga0070684_100337857 | Ga0070684_1003378572 | 306 |
| 517 | 3300005543 | Ga0070672_100058929 | Ga0070672_1000589293 | 306 |
| 518 | 3300005563 | Ga0068855_100626910 | Ga0068855_1006269101 | 306 |
| 519 | 3300005577 | Ga0068857_100147192 | Ga0068857_1001471922 | 306 |
| 520 | 3300005578 | Ga0068854_100155115 | Ga0068854_1001551152 | 306 |
| 521 | 3300005614 | Ga0068856_100123154 | Ga0068856_1001231542 | 306 |
| 522 | 3300005615 | Ga0070702_100136354 | Ga0070702_1001363542 | 306 |
| 523 | 3300005616 | Ga0068852_100268956 | Ga0068852_1002689562 | 306 |
| 524 | 3300005617 | Ga0068859_100326350 | Ga0068859_1003263502 | 306 |
| 525 | 3300005618 | Ga0068864_100007948 | Ga0068864_1000079489 | 306 |
| 526 | 3300005718 | Ga0068866_10043756 | Ga0068866_100437562 | 306 |
| 527 | 3300005719 | Ga0068861_100078036 | Ga0068861_1000780363 | 306 |
| 528 | 3300005840 | Ga0068870_10048226 | Ga0068870_100482262 | 306 |
| 529 | 3300005841 | Ga0068863_100171565 | Ga0068863_1001715652 | 306 |
| 530 | 3300005842 | Ga0068858_100094887 | Ga0068858_1000948872 | 306 |
| 531 | 3300005937 | Ga0081455_10003936 | Ga0081455_100039362 | 306 |
| 532 | 3300005983 | Ga0081540_1000026 | Ga0081540_100002649 | 306 |
| 533 | 3300005985 | Ga0081539_10008045 | Ga0081539_100080457 | 306 |
| 534 | 3300005985 | Ga0081539_10033748 | Ga0081539_100337482 | 306 |
| 535 | 3300006178 | Ga0075367_10120661 | Ga0075367_101206612 | 306 |
| 536 | 3300006237 | Ga0097621_100050446 | Ga0097621_1000504462 | 306 |
| 537 | 3300006358 | Ga0068871_100460242 | Ga0068871_1004602421 | 306 |
| 538 | 3300006871 | Ga0075434_100001207 | Ga0075434_1000012074 | 306 |
| 539 | 3300006931 | Ga0097620_100326361 | Ga0097620_1003263612 | 306 |
| 540 | 3300009147 | Ga0114129_10155472 | Ga0114129_101554722 | 306 |
| 541 | 3300009177 | Ga0105248_10029884 | Ga0105248_100298843 | 306 |
| 542 | 3300009545 | Ga0105237_10021363 | Ga0105237_100213631 | 306 |
| 543 | 3300025899 | Ga0207642_10028763 | Ga0207642_100287632 | 306 |
| 544 | 3300025900 | Ga0207710_10051865 | Ga0207710_100518652 | 306 |
| 545 | 3300025907 | Ga0207645_10039261 | Ga0207645_100392613 | 306 |
| 546 | 3300025908 | Ga0207643_10002306 | Ga0207643_100023064 | 306 |
| 547 | 3300025926 | Ga0207659_10008600 | Ga0207659_100086005 | 306 |
| 548 | 3300025927 | Ga0207687_10008703 | Ga0207687_100087033 | 306 |
| 549 | 3300025931 | Ga0207644_10206479 | Ga0207644_102064792 | 306 |
| 550 | 3300025933 | Ga0207706_10012014 | Ga0207706_100120142 | 306 |
| 551 | 3300025935 | Ga0207709_10214755 | Ga0207709_102147551 | 306 |
| 552 | 3300025937 | Ga0207669_10131893 | Ga0207669_101318932 | 306 |
| 553 | 3300025941 | Ga0207711_10044549 | Ga0207711_100445492 | 306 |
| 554 | 3300025941 | Ga0207711_10090988 | Ga0207711_100909882 | 306 |
| 555 | 3300025942 | Ga0207689_10007381 | Ga0207689_100073818 | 306 |
| 556 | 3300025960 | Ga0207651_10193691 | Ga0207651_101936911 | 306 |
| 557 | 3300025961 | Ga0207712_10200625 | Ga0207712_102006251 | 306 |
| 558 | 3300025986 | Ga0207658_10070530 | Ga0207658_100705303 | 306 |
| 559 | 3300026023 | Ga0207677_10171145 | Ga0207677_101711452 | 306 |
| 560 | 3300026067 | Ga0207678_10050216 | Ga0207678_100502162 | 306 |
| 561 | 3300026075 | Ga0207708_10104799 | Ga0207708_101047993 | 306 |
| 562 | 3300026078 | Ga0207702_10288799 | Ga0207702_102887991 | 306 |
| 563 | 3300026088 | Ga0207641_10200765 | Ga0207641_102007652 | 306 |
| 564 | 3300026089 | Ga0207648_10042769 | Ga0207648_100427694 | 306 |
| 565 | 3300026095 | Ga0207676_10049583 | Ga0207676_100495831 | 306 |
| 566 | 3300026116 | Ga0207674_10301308 | Ga0207674_103013081 | 306 |
| 567 | 3300026118 | Ga0207675_100008557 | Ga0207675_1000085572 | 306 |
| 568 | 3300026142 | Ga0207698_10091400 | Ga0207698_100914003 | 306 |
| 569 | 3300035113 | Ga0373936_0025285 | Ga0373936_0025285_353_1330 | 306 |
| 570 | 3300035116 | Ga0373945_0003146 | Ga0373945_0003146_2677_3681 | 306 |
| 571 | 3300035171 | Ga0373946_0019871 | Ga0373946_0019871_48_1052 | 306 |
| 572 | 3300035695 | Ga0373927_0034306 | Ga0373927_0034306_1210_2187 | 306 |
| 573 | 3300035725 | Ga0373947_0009079 | Ga0373947_0009079_1541_2545 | 306 |
| 574 | 3300037068 | Ga0373925_0006672 | Ga0373925_0006672_806_1810 | 306 |
| 575 | 3300046455 | Ga0495603_0081454 | Ga0495603_0081454_589_1566 | 306 |
| 576 | 3300046473 | Ga0495582_0005948 | Ga0495582_0005948_780_1784 | 306 |
| 577 | 3300046474 | Ga0495605_0027976 | Ga0495605_0027976_180_1169 | 306 |
| 578 | 3300046491 | Ga0495584_0111959 | Ga0495584_0111959_75_1052 | 306 |
| 579 | 3300046526 | Ga0495666_0054783 | Ga0495666_0054783_314_1318 | 306 |
| 580 | 3300046531 | Ga0495665_0131528 | Ga0495665_0131528_166_1143 | 306 |
| 581 | 3300046539 | Ga0495621_0046506 | Ga0495621_0046506_412_1389 | 306 |
| 582 | 3300046616 | Ga0495668_0087449 | Ga0495668_0087449_515_1522 | 306 |
| 583 | 3300046674 | Ga0495588_0007187 | Ga0495588_0007187_3186_4163 | 306 |
| 584 | 3300046683 | Ga0495658_0045853 | Ga0495658_0045853_491_1468 | 306 |
| 585 | 3300046684 | Ga0495669_0069244 | Ga0495669_0069244_520_1497 | 306 |
| 586 | 3300046689 | Ga0495613_0037577 | Ga0495613_0037577_854_1831 | 306 |
| 587 | 3300046690 | Ga0495624_0119936 | Ga0495624_0119936_196_1200 | 306 |
| 588 | 3300047321 | Ga0495676_0005390 | Ga0495676_0005390_224_1228 | 306 |
| 589 | 3300048909 | Ga0496106_0066402 | Ga0496106_0066402_1208_2215 | 306 |
| 590 | 3300050492 | nmdc:mga0yw44_91123_c1 | nmdc:mga0yw44_91123_c1_667_1674 | 306 |
| 591 | 3300050507 | nmdc:mga05p37_248908_c1 | nmdc:mga05p37_248908_c1_14_985 | 306 |
| 592 | 3300050507 | nmdc:mga05p37_331333_c1 | nmdc:mga05p37_331333_c1_310_1284 | 306 |
| 593 | 3300050509 | nmdc:mga0qj67_56393_c1 | nmdc:mga0qj67_56393_c1_369_1343 | 306 |
| 594 | 3300050510 | nmdc:mga06r32_103739_c1 | nmdc:mga06r32_103739_c1_885_1859 | 306 |
| 595 | 3300050512 | nmdc:mga0n895_436_c1 | nmdc:mga0n895_436_c1_3830_4831 | 306 |
| 596 | 3300053148 | Ga0500590_034114 | Ga0500590_034114_1510_2499 | 306 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9712 | 14 | 304 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9709 | 9 | 304 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9648 | 8 | 306 |
| 6hke-assembly1.cif.gz_A | matc (rpa3494) from rhodopseudomonas palustris with bound malate | 0.9598 | 9 | 298 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9585 | 8 | 306 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9558 | 108 | 226 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.948 | 108 | 231 | 3.40.190.10 |
| 2dvzA01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9479 | 8 | 304 | 3.40.190.150 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9408 | 108 | 231 | 3.40.190.10 |
| 2dvzA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9394 | 109 | 226 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q1HI92-F1-model_v4 | NADH:flavin oxidoreductase | 0.9831 | 9 | 304 |
GO:0009056
GO:0010181 GO:0016491 |
| AF-A0A537DML3-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9827 | 17 | 304 |
|
| AF-A0A4Q7NH98-F1-model_v4 | Tripartite-type tricarboxylate transporter receptor subunit TctC | 0.9824 | 9 | 306 |
|
| AF-A0A5C8CF86-F1-model_v4 | deleted | 0.982 | 19 | 304 |
|
| AF-A0A537BUX9-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9788 | 9 | 306 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar