F467604

General Info

Members Datasets Scaffolds Average Seq Length
596 337 596 319

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0087567|Ga0501045_0087567_1139_2287
Length 382
Sequence VAREEAHLRLPAAVVAGELVDEDDRRSVAGLLVMKAGAVVRASVWHRFFAKRRPLSLHHILMGSPVRALIACFVLGFSSLVSAQAGYPNRPIRLIVTVPPGGAADFIARLVGGKVADALGQPVLVENRGGAGGTIAADAVAKAPADGYTLLQNSITTHGVGPHLYSKLPYDPVKDFAAVGGLALLPLVMAVNADLSAKTVDEVISLSKKTSLNFASSGNGGAPHMAAELFKSVTGAALTHVPYKGSGPAVADLVGGRVQIMFDAPPSLIQHIRGGKLRVLAAASAQRNRLLPEAPTFAELGYPQVAVSLWYGLLAPAGTPRPVIARLNAEVSRALQSSEVRDRLQAQGAEPMPGTPEAFAAFMREEMAKWAPVVKQAGVKLD

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
173 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
181 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
192 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
201 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
202 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
203 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
204 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
205 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
222 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
223 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
224 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
225 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
226 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
236 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
237 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
238 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
242 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
243 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
247 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
251 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
256 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
257 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
258 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
259 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
260 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
261 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
262 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
263 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
315 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
333 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
334 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
335 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.21
Nodule 0
Rhizoplane 4.7
Rhizosphere 88.42
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10009334 3300001991 Bacteria 1736
2 JGI24738J21930_10018815 3300002075 Unclassified 1443
3 JGI24744J21845_10013371 3300002077 Unclassified 1655
4 JGI24742J22300_10008724 3300002244 Unclassified 1671
5 JGI25153J46596_10002964 3300003215 Bacteria 9616
6 JGI25153J46596_10004430 3300003215 Bacteria 7576
7 Ga0065712_10076209 3300005290 Bacteria 3710
8 Ga0070683_100007986 3300005329 Bacteria 8978
9 Ga0070683_100080356 3300005329 Bacteria 3052
10 Ga0070690_100002470 3300005330 Bacteria 9938
11 Ga0070670_100046961 3300005331 Bacteria 3715
12 Ga0070677_10030825 3300005333 Bacteria 2044
13 Ga0068869_100063712 3300005334 Unclassified 2709
14 Ga0068869_100095903 3300005334 Bacteria 2238
15 Ga0068869_100309620 3300005334 Bacteria 1278
16 Ga0070666_10021763 3300005335 Bacteria 4156
17 Ga0070680_100013168 3300005336 Bacteria 6438
18 Ga0070680_100025401 3300005336 Bacteria 4735
19 Ga0070682_100122885 3300005337 Bacteria 1745
20 Ga0068868_100005853 3300005338 Bacteria 8669
21 Ga0068868_100006058 3300005338 Bacteria 8539
22 Ga0068868_100008082 3300005338 Bacteria 7525
23 Ga0070689_100013130 3300005340 Bacteria 5986
24 Ga0070691_10001532 3300005341 Bacteria 9941
25 Ga0070691_10133705 3300005341 Unclassified 1259
26 Ga0070687_100000563 3300005343 Bacteria 12391
27 Ga0070661_100006718 3300005344 Bacteria 7931
28 Ga0070661_100052899 3300005344 Bacteria 2971
29 Ga0070668_100157882 3300005347 Unclassified 1838
30 Ga0070669_100004794 3300005353 Bacteria 9761
31 Ga0070675_100000678 3300005354 Bacteria 23632
32 Ga0070675_100042286 3300005354 Bacteria 3723
33 Ga0070671_100000403 3300005355 Bacteria 29810
34 Ga0070671_100182696 3300005355 Bacteria 1776
35 Ga0070674_100010484 3300005356 Bacteria 5606
36 Ga0070673_100005786 3300005364 Bacteria 7963
37 Ga0070659_100243602 3300005366 Unclassified 1489
38 Ga0070667_100293096 3300005367 Bacteria 1464
39 Ga0070667_100336110 3300005367 Bacteria 1365
40 Ga0070703_10051590 3300005406 Bacteria 1317
41 Ga0070714_100026265 3300005435 Bacteria 4811
42 Ga0070713_100103250 3300005436 Bacteria 2473
43 Ga0070713_100485481 3300005436 Unclassified 1164
44 Ga0070701_10000846 3300005438 Bacteria 10972
45 Ga0070705_100007263 3300005440 Bacteria 5449
46 Ga0070705_100011771 3300005440 Bacteria 4426
47 Ga0070700_100027753 3300005441 Bacteria 3360
48 Ga0070694_100004374 3300005444 Bacteria 8500
49 Ga0070694_100036957 3300005444 Bacteria 3237
50 Ga0070694_100095538 3300005444 Bacteria 2093
51 Ga0070678_100004377 3300005456 Bacteria 8000
52 Ga0070662_100048244 3300005457 Bacteria 3067
53 Ga0070681_10004036 3300005458 Bacteria 13848
54 Ga0070681_10085487 3300005458 Bacteria 3106
55 Ga0068867_100001052 3300005459 Bacteria 18822
56 Ga0068867_100027859 3300005459 Bacteria 4064
57 Ga0068867_100191118 3300005459 Unclassified 1634
58 Ga0070685_10137947 3300005466 Unclassified 1532
59 Ga0070706_100038959 3300005467 Bacteria 4387
60 Ga0070707_100066222 3300005468 Bacteria 3471
61 Ga0070698_100084696 3300005471 Bacteria 3158
62 Ga0070698_100265190 3300005471 Bacteria 1649
63 Ga0070699_100003640 3300005518 Bacteria 13637
64 Ga0070699_100019712 3300005518 Bacteria 5812
65 Ga0070699_100115561 3300005518 Bacteria 2358
66 Ga0070699_100149460 3300005518 Bacteria 2065
67 Ga0070679_100040873 3300005530 Bacteria 4614
68 Ga0070679_100211279 3300005530 Bacteria 1904
69 Ga0070679_100332290 3300005530 Bacteria 1468
70 Ga0070684_100009449 3300005535 Bacteria 7680
71 Ga0070684_100018260 3300005535 Bacteria 5776
72 Ga0070684_100337857 3300005535 Unclassified 1384
73 Ga0070697_100040276 3300005536 Bacteria 3779
74 Ga0070697_100128533 3300005536 Bacteria 2123
75 Ga0068853_100357414 3300005539 Bacteria 1360
76 Ga0070672_100004172 3300005543 Bacteria 9433
77 Ga0070672_100058929 3300005543 Bacteria 3020
78 Ga0070672_100077266 3300005543 Bacteria 2662
79 Ga0070686_100004643 3300005544 Bacteria 7575
80 Ga0070695_100013642 3300005545 Bacteria 4884
81 Ga0070696_100000286 3300005546 Bacteria 30468
82 Ga0070696_100005387 3300005546 Bacteria 8533
83 Ga0070696_100009006 3300005546 Bacteria 6682
84 Ga0070693_100000272 3300005547 Bacteria 24379
85 Ga0070693_100024057 3300005547 Bacteria 3263
86 Ga0070704_100000332 3300005549 Bacteria 21391
87 Ga0070704_100258769 3300005549 Bacteria 1433
88 Ga0068855_100056798 3300005563 Bacteria 4590
89 Ga0068855_100331863 3300005563 Bacteria 1679
90 Ga0068855_100626910 3300005563 Bacteria 1157
91 Ga0070664_100000715 3300005564 Bacteria 25421
92 Ga0068857_100147192 3300005577 Bacteria 2132
93 Ga0068854_100013961 3300005578 Bacteria 5284
94 Ga0068854_100017041 3300005578 Bacteria 4856
95 Ga0068854_100155115 3300005578 Unclassified 1769
96 Ga0068856_100123154 3300005614 Bacteria 2595
97 Ga0068856_100172592 3300005614 Bacteria 2174
98 Ga0070702_100002099 3300005615 Bacteria 8457
99 Ga0070702_100136354 3300005615 Unclassified 1557
100 Ga0068852_100012610 3300005616 Bacteria 6425
101 Ga0068852_100268956 3300005616 Unclassified 1639
102 Ga0068859_100326350 3300005617 Unclassified 1629
103 Ga0068864_100000855 3300005618 Bacteria 25703
104 Ga0068864_100007948 3300005618 Bacteria 8742
105 Ga0068866_10000268 3300005718 Bacteria 24645
106 Ga0068866_10043756 3300005718 Unclassified 2236
107 Ga0068861_100000494 3300005719 Bacteria 22919
108 Ga0068861_100003214 3300005719 Bacteria 10812
109 Ga0068861_100078036 3300005719 Bacteria 2585
110 Ga0068851_10006680 3300005834 Bacteria 5278
111 Ga0068870_10013548 3300005840 Bacteria 3835
112 Ga0068870_10048226 3300005840 Bacteria 2242
113 Ga0068863_100021690 3300005841 Bacteria 6127
114 Ga0068863_100171565 3300005841 Bacteria 2080
115 Ga0068858_100094887 3300005842 Bacteria 2779
116 Ga0068858_100163526 3300005842 Bacteria 2096
117 Ga0068860_100001071 3300005843 Bacteria 30156
118 Ga0068862_100005771 3300005844 Bacteria 10322
119 Ga0068862_100146254 3300005844 Bacteria 2101
120 Ga0081455_10003936 3300005937 Bacteria 16884
121 Ga0081455_10014656 3300005937 Bacteria 7666
122 Ga0081455_10048635 3300005937 Bacteria 3662
123 Ga0081455_10050038 3300005937 Bacteria 3597
124 Ga0081455_10180659 3300005937 Bacteria 1598
125 Ga0081540_1000026 3300005983 Bacteria 155402
126 Ga0081539_10008045 3300005985 Bacteria 9340
127 Ga0081539_10033748 3300005985 Bacteria 3109
128 Ga0070717_10159162 3300006028 Bacteria 1958
129 Ga0075365_10012874 3300006038 Bacteria 4985
130 Ga0075365_10038691 3300006038 Bacteria 3102
131 Ga0075365_10059819 3300006038 Bacteria 2540
132 Ga0075365_10181074 3300006038 Bacteria 1473
133 Ga0075368_10004530 3300006042 Bacteria 4722
134 Ga0075368_10050465 3300006042 Bacteria 1652
135 Ga0075363_100000486 3300006048 Bacteria 12590
136 Ga0075363_100045905 3300006048 Bacteria 2317
137 Ga0075364_10058077 3300006051 Bacteria 2535
138 Ga0075364_10086138 3300006051 Bacteria 2081
139 Ga0070716_100027556 3300006173 Bacteria 3054
140 Ga0070716_100271943 3300006173 Bacteria 1165
141 Ga0070712_100018198 3300006175 Bacteria 4560
142 Ga0075367_10075989 3300006178 Bacteria 2026
143 Ga0075367_10120661 3300006178 Bacteria 1615
144 Ga0075369_10013341 3300006186 Bacteria 3260
145 Ga0075369_10025096 3300006186 Bacteria 2476
146 Ga0075369_10065295 3300006186 Bacteria 1595
147 Ga0075366_10053412 3300006195 Bacteria 2400
148 Ga0097621_100002822 3300006237 Bacteria 11907
149 Ga0097621_100003412 3300006237 Bacteria 10943
150 Ga0097621_100050446 3300006237 Bacteria 3384
151 Ga0075370_10021086 3300006353 Bacteria 3568
152 Ga0068871_100002838 3300006358 Bacteria 11867
153 Ga0068871_100003826 3300006358 Bacteria 10375
154 Ga0068871_100460242 3300006358 Archaea 1142
155 Ga0075428_100011372 3300006844 Bacteria 9899
156 Ga0075428_100011770 3300006844 Bacteria 9740
157 Ga0075428_100429266 3300006844 Bacteria 1416
158 Ga0075430_100003725 3300006846 Bacteria 12810
159 Ga0075430_100026920 3300006846 Bacteria 4890
160 Ga0075430_100036267 3300006846 Bacteria 4181
161 Ga0075430_100163239 3300006846 Bacteria 1854
162 Ga0075431_100030894 3300006847 Bacteria 5517
163 Ga0075431_100044305 3300006847 Bacteria 4589
164 Ga0075431_100492529 3300006847 Bacteria 1218
165 Ga0075433_10001763 3300006852 Bacteria 16187
166 Ga0075433_10516578 3300006852 Bacteria 1051
167 Ga0075434_100000033 3300006871 Bacteria 63711
168 Ga0075434_100000318 3300006871 Bacteria 34363
169 Ga0075434_100001207 3300006871 Bacteria 21477
170 Ga0075434_100124510 3300006871 Bacteria 2595
171 Ga0075429_100000191 3300006880 Bacteria 40312
172 Ga0075429_100004031 3300006880 Bacteria 12579
173 Ga0075429_100004103 3300006880 Bacteria 12459
174 Ga0075429_100054026 3300006880 Bacteria 3495
175 Ga0068865_100005516 3300006881 Bacteria 7677
176 Ga0068865_100007719 3300006881 Bacteria 6631
177 Ga0075436_100001263 3300006914 Bacteria 17167
178 Ga0075436_100001365 3300006914 Bacteria 16615
179 Ga0075436_100018853 3300006914 Bacteria 4724
180 Ga0075436_100065802 3300006914 Bacteria 2505
181 Ga0075436_100166024 3300006914 Bacteria 1558
182 Ga0097620_100326361 3300006931 Unclassified 1629
183 Ga0075435_100000095 3300007076 Bacteria 47869
184 Ga0075435_100086020 3300007076 Bacteria 2588
185 Ga0075435_100100107 3300007076 Bacteria 2401
186 Ga0075435_100141893 3300007076 Bacteria 2016
187 Ga0075435_100377384 3300007076 Bacteria 1218
188 Ga0099794_10005841 3300007265 Bacteria 4963
189 Ga0099794_10032073 3300007265 Bacteria 2464
190 Ga0099794_10040210 3300007265 Bacteria 2222
191 Ga0099795_10008852 3300007788 Bacteria 2895
192 Ga0111539_10027400 3300009094 Bacteria 6960
193 Ga0111539_10030515 3300009094 Bacteria 6551
194 Ga0111539_10031451 3300009094 Bacteria 6446
195 Ga0111539_10056838 3300009094 Bacteria 4649
196 Ga0111539_10074451 3300009094 Bacteria 4001
197 Ga0111539_10370177 3300009094 Unclassified 1668
198 Ga0111539_10528040 3300009094 Bacteria 1375
199 Ga0105245_10000900 3300009098 Bacteria 27069
200 Ga0114129_10027395 3300009147 Bacteria 8068
201 Ga0114129_10155472 3300009147 Bacteria 3128
202 Ga0114129_10225554 3300009147 Bacteria 2526
203 Ga0114129_10258851 3300009147 Bacteria 2333
204 Ga0114129_10320129 3300009147 Bacteria 2062
205 Ga0114129_10415902 3300009147 Bacteria 1769
206 Ga0114129_10495655 3300009147 Bacteria 1596
207 Ga0114129_10557743 3300009147 Bacteria 1489
208 Ga0105243_10002495 3300009148 Bacteria 15365
209 Ga0105243_10012365 3300009148 Bacteria 6452
210 Ga0105241_10013546 3300009174 Bacteria 5976
211 Ga0105242_10000570 3300009176 Bacteria 29133
212 Ga0105248_10029884 3300009177 Bacteria 6081
213 Ga0105248_10046301 3300009177 Bacteria 4874
214 Ga0105248_10292651 3300009177 Bacteria 1834
215 Ga0105248_10590393 3300009177 Bacteria 1253
216 Ga0105237_10021363 3300009545 Bacteria 6655
217 Ga0105238_10001829 3300009551 Bacteria 21323
218 Ga0105249_10004906 3300009553 Bacteria 11546
219 Ga0105249_10011144 3300009553 Bacteria 7899
220 Ga0105239_10710452 3300010375 Bacteria 1149
221 Ga0105246_10107443 3300011119 Bacteria 2044
222 Ga0157374_10013274 3300013296 Bacteria 7187
223 Ga0157378_10013586 3300013297 Bacteria 7122
224 Ga0163162_10074780 3300013306 Bacteria 3447
225 Ga0157372_10200194 3300013307 Bacteria 2313
226 Ga0157375_10014357 3300013308 Bacteria 7062
227 Ga0157375_10224640 3300013308 Bacteria 2037
228 Ga0157380_10072009 3300014326 Bacteria 2798
229 Ga0157380_10119946 3300014326 Bacteria 2226
230 Ga0157376_10025461 3300014969 Bacteria 4660
231 Ga0157376_10049805 3300014969 Bacteria 3471
232 Ga0209758_1000351 3300025297 Bacteria 83626
233 Ga0209758_1001016 3300025297 Bacteria 37152
234 Ga0209758_1049604 3300025297 Bacteria 1480
235 Ga0207697_10102463 3300025315 Bacteria 1221
236 Ga0207656_10004859 3300025321 Bacteria 4716
237 Ga0207653_10030736 3300025885 Bacteria 1733
238 Ga0207682_10041450 3300025893 Bacteria 1879
239 Ga0207682_10075587 3300025893 Bacteria 1434
240 Ga0207642_10028763 3300025899 Bacteria 2293
241 Ga0207642_10095869 3300025899 Bacteria 1477
242 Ga0207710_10051865 3300025900 Unclassified 1843
243 Ga0207680_10012474 3300025903 Bacteria 4328
244 Ga0207647_10060267 3300025904 Bacteria 2320
245 Ga0207645_10039261 3300025907 Bacteria 3034
246 Ga0207643_10002306 3300025908 Bacteria 10379
247 Ga0207643_10007262 3300025908 Bacteria 5945
248 Ga0207654_10050354 3300025911 Bacteria 2393
249 Ga0207707_10023586 3300025912 Bacteria 5382
250 Ga0207707_10132004 3300025912 Bacteria 2184
251 Ga0207693_10184674 3300025915 Bacteria 1641
252 Ga0207660_10003686 3300025917 Bacteria 9985
253 Ga0207662_10000255 3300025918 Bacteria 24688
254 Ga0207649_10011853 3300025920 Bacteria 4822
255 Ga0207652_10063374 3300025921 Bacteria 3197
256 Ga0207650_10008372 3300025925 Bacteria 7060
257 Ga0207659_10005784 3300025926 Bacteria 7533
258 Ga0207659_10008600 3300025926 Bacteria 6349
259 Ga0207659_10017688 3300025926 Bacteria 4659
260 Ga0207687_10008703 3300025927 Bacteria 6630
261 Ga0207687_10060966 3300025927 Bacteria 2663
262 Ga0207700_10122738 3300025928 Bacteria 2109
263 Ga0207700_10194097 3300025928 Bacteria 1708
264 Ga0207644_10022367 3300025931 Bacteria 4319
265 Ga0207644_10206479 3300025931 Unclassified 1551
266 Ga0207706_10012014 3300025933 Bacteria 7889
267 Ga0207706_10090481 3300025933 Bacteria 2691
268 Ga0207686_10013086 3300025934 Bacteria 4582
269 Ga0207709_10012837 3300025935 Bacteria 4619
270 Ga0207709_10201511 3300025935 Bacteria 1422
271 Ga0207709_10214755 3300025935 Unclassified 1383
272 Ga0207670_10009101 3300025936 Bacteria 5643
273 Ga0207670_10064336 3300025936 Bacteria 2513
274 Ga0207669_10004046 3300025937 Bacteria 6417
275 Ga0207669_10131893 3300025937 Unclassified 1718
276 Ga0207704_10001889 3300025938 Bacteria 9375
277 Ga0207704_10006023 3300025938 Bacteria 5622
278 Ga0207665_10187817 3300025939 Bacteria 1500
279 Ga0207691_10000553 3300025940 Bacteria 37406
280 Ga0207711_10042867 3300025941 Bacteria 3857
281 Ga0207711_10044549 3300025941 Bacteria 3788
282 Ga0207711_10090988 3300025941 Bacteria 2683
283 Ga0207689_10007381 3300025942 Bacteria 9639
284 Ga0207689_10011317 3300025942 Bacteria 7654
285 Ga0207661_10003659 3300025944 Bacteria 10710
286 Ga0207661_10263640 3300025944 Bacteria 1536
287 Ga0207679_10008461 3300025945 Bacteria 6552
288 Ga0207667_10046208 3300025949 Bacteria 4610
289 Ga0207651_10193691 3300025960 Unclassified 1623
290 Ga0207651_10316624 3300025960 Bacteria 1303
291 Ga0207712_10050627 3300025961 Bacteria 2901
292 Ga0207712_10125394 3300025961 Bacteria 1949
293 Ga0207712_10166362 3300025961 Bacteria 1719
294 Ga0207712_10200625 3300025961 Unclassified 1582
295 Ga0207668_10189061 3300025972 Bacteria 1630
296 Ga0207640_10009859 3300025981 Bacteria 5361
297 Ga0207640_10028180 3300025981 Bacteria 3431
298 Ga0207658_10070530 3300025986 Bacteria 2644
299 Ga0207677_10003501 3300026023 Bacteria 8321
300 Ga0207677_10074232 3300026023 Bacteria 2412
301 Ga0207677_10171145 3300026023 Unclassified 1698
302 Ga0207703_10026263 3300026035 Bacteria 4582
303 Ga0207703_10315216 3300026035 Bacteria 1431
304 Ga0207639_10230104 3300026041 Bacteria 1606
305 Ga0207678_10050216 3300026067 Bacteria 3604
306 Ga0207708_10008564 3300026075 Bacteria 7568
307 Ga0207708_10104799 3300026075 Unclassified 2191
308 Ga0207702_10288799 3300026078 Unclassified 1553
309 Ga0207641_10200765 3300026088 Bacteria 1838
310 Ga0207648_10000276 3300026089 Bacteria 55713
311 Ga0207648_10042769 3300026089 Bacteria 3978
312 Ga0207676_10003972 3300026095 Bacteria 10433
313 Ga0207676_10049583 3300026095 Bacteria 3267
314 Ga0207674_10301308 3300026116 Unclassified 1552
315 Ga0207674_10426547 3300026116 Bacteria 1281
316 Ga0207675_100006484 3300026118 Bacteria 11072
317 Ga0207675_100007574 3300026118 Bacteria 10257
318 Ga0207675_100008557 3300026118 Bacteria 9626
319 Ga0207675_100467109 3300026118 Bacteria 1252
320 Ga0207683_10009572 3300026121 Bacteria 8263
321 Ga0207698_10006445 3300026142 Bacteria 7328
322 Ga0207698_10091400 3300026142 Bacteria 2491
323 Ga0207698_10513135 3300026142 Bacteria 1168
324 Ga0207428_10000726 3300027907 Bacteria 38071
325 Ga0207428_10059832 3300027907 Bacteria 3019
326 Ga0207428_10103966 3300027907 Bacteria 2192
327 Ga0268266_10097245 3300028379 Bacteria 2589
328 Ga0268264_10017841 3300028381 Bacteria 5810
329 Ga0268264_10247930 3300028381 Bacteria 1653
330 Ga0307511_10000019 3300030521 Bacteria 117947
331 Ga0307511_10010947 3300030521 Bacteria 8962
332 Ga0265332_10000812 3300031238 Bacteria 18981
333 Ga0265325_10078596 3300031241 Bacteria 1643
334 Ga0265340_10002068 3300031247 Bacteria 11503
335 Ga0265339_10000669 3300031249 Bacteria 26471
336 Ga0265339_10094900 3300031249 Bacteria 1559
337 Ga0265331_10006261 3300031250 Bacteria 7055
338 Ga0265327_10006312 3300031251 Bacteria 9532
339 Ga0265314_10031514 3300031711 Bacteria 3912
340 Ga0265342_10000856 3300031712 Bacteria 30377
341 Ga0307405_10260539 3300031731 Bacteria 1295
342 Ga0307406_10084017 3300031901 Bacteria 2125
343 Ga0307412_10126580 3300031911 Bacteria 1849
344 Ga0307414_10066108 3300032004 Bacteria 2583
345 Ga0307411_10217152 3300032005 Bacteria 1481
346 Ga0373938_0021153 3300034957 Bacteria 1317
347 Ga0373926_0002688 3300035083 Bacteria 5664
348 Ga0373929_0015766 3300035085 Bacteria 1473
349 Ga0373929_0022292 3300035085 Bacteria 1292
350 Ga0373934_0015905 3300035086 Bacteria 2858
351 Ga0373940_0046871 3300035088 Bacteria 1204
352 Ga0373949_0033982 3300035090 Bacteria 1227
353 Ga0373952_0021674 3300035092 Bacteria 1358
354 Ga0373936_0025285 3300035113 Bacteria 2322
355 Ga0373939_0002731 3300035114 Bacteria 4141
356 Ga0373939_0084887 3300035114 Bacteria 1059
357 Ga0373941_0005939 3300035115 Bacteria 2910
358 Ga0373941_0012975 3300035115 Bacteria 2192
359 Ga0373945_0003146 3300035116 Bacteria 5181
360 Ga0373945_0004289 3300035116 Bacteria 4526
361 Ga0373956_0090421 3300035119 Unclassified 1412
362 Ga0373957_0008394 3300035120 Unclassified 3343
363 Ga0373960_0014342 3300035121 Bacteria 2006
364 Ga0373943_0004208 3300035170 Bacteria 6525
365 Ga0373943_0048192 3300035170 Bacteria 2086
366 Ga0373943_0216507 3300035170 Bacteria 1065
367 Ga0373946_0019871 3300035171 Bacteria 2591
368 Ga0373955_0007789 3300035172 Unclassified 4937
369 Ga0373961_0009342 3300035241 Bacteria 2399
370 Ga0373924_0032332 3300035410 Unclassified 2108
371 Ga0373931_0038696 3300035691 Bacteria 2496
372 Ga0373931_0040452 3300035691 Bacteria 2446
373 Ga0373935_0070899 3300035692 Bacteria 2247
374 Ga0373935_0080434 3300035692 Bacteria 2117
375 Ga0373935_0189732 3300035692 Bacteria 1415
376 Ga0373927_0030096 3300035695 Bacteria 3542
377 Ga0373927_0034306 3300035695 Bacteria 3301
378 Ga0373927_0241926 3300035695 Bacteria 1186
379 Ga0373933_0010844 3300035724 Bacteria 5001
380 Ga0373947_0009079 3300035725 Bacteria 5714
381 Ga0373947_0009232 3300035725 Bacteria 5667
382 Ga0373947_0010041 3300035725 Bacteria 5434
383 Ga0373947_0097147 3300035725 Bacteria 1846
384 Ga0373947_0143622 3300035725 Bacteria 1533
385 Ga0373937_0008865 3300036401 Bacteria 8731
386 Ga0373925_0006672 3300037068 Bacteria 8467
387 Ga0373925_0013212 3300037068 Bacteria 5976
388 Ga0373925_0028674 3300037068 Bacteria 4079
389 Ga0373925_0159263 3300037068 Bacteria 1777
390 Ga0373925_0196284 3300037068 Bacteria 1603
391 Ga0395899_0059379 3300037312 Bacteria 2819
392 Ga0395900_0001544 3300037418 Bacteria 27359
393 Ga0395900_0355947 3300037418 Bacteria 1436
394 Ga0395898_0108630 3300037466 Bacteria 2660
395 Ga0395898_0153895 3300037466 Unclassified 2200
396 Ga0395905_0084323 3300037471 Bacteria 2977
397 Ga0395901_0062199 3300038443 Bacteria 3885
398 Ga0395901_0131752 3300038443 Unclassified 2627
399 Ga0436365_1202296 3300039437 Bacteria 2890
400 Ga0436365_1429691 3300039437 Bacteria 1644
401 Ga0439441_002703 3300042001 Bacteria 2525
402 Ga0450913_000161 3300042117 Bacteria 2162
403 Ga0439434_0069165 3300042435 Bacteria 1110
404 Ga0439435_0029780 3300042436 Bacteria 1476
405 Ga0450916_004176 3300042530 Bacteria 1619
406 Ga0466965_0027491 3300044683 Bacteria 2762
407 Ga0466957_0025397 3300044842 Bacteria 3511
408 Ga0451576_0001715 3300045051 Bacteria 36181
409 Ga0451576_0175914 3300045051 Bacteria 2234
410 Ga0466967_0085674 3300045976 Bacteria 2853
411 Ga0495592_0006561 3300046454 Bacteria 8670
412 Ga0495603_0002544 3300046455 Bacteria 10740
413 Ga0495603_0081454 3300046455 Bacteria 1896
414 Ga0495629_0168046 3300046459 Bacteria 1523
415 Ga0495651_0151781 3300046462 Bacteria 1669
416 Ga0495651_0211473 3300046462 Unclassified 1349
417 Ga0495580_0002354 3300046472 Bacteria 16499
418 Ga0495582_0005948 3300046473 Bacteria 6804
419 Ga0495605_0027976 3300046474 Bacteria 2915
420 Ga0495639_0010766 3300046475 Bacteria 3937
421 Ga0495639_0019927 3300046475 Bacteria 2929
422 Ga0495662_0012546 3300046476 Bacteria 4134
423 Ga0495662_0027363 3300046476 Bacteria 2755
424 Ga0495662_0146171 3300046476 Bacteria 1164
425 Ga0495584_0111959 3300046491 Bacteria 1381
426 Ga0495594_0011426 3300046499 Bacteria 4615
427 Ga0495608_0006443 3300046511 Bacteria 8335
428 Ga0495608_0012778 3300046511 Bacteria 5826
429 Ga0495616_0046790 3300046513 Bacteria 2182
430 Ga0495618_0006638 3300046514 Bacteria 7011
431 Ga0495628_0117528 3300046516 Bacteria 2042
432 Ga0495630_0001728 3300046517 Bacteria 15247
433 Ga0495630_0038696 3300046517 Bacteria 3568
434 Ga0495637_0061251 3300046520 Bacteria 1543
435 Ga0495644_0117334 3300046523 Bacteria 1011
436 Ga0495666_0020549 3300046526 Bacteria 3270
437 Ga0495666_0026411 3300046526 Bacteria 2862
438 Ga0495666_0054783 3300046526 Bacteria 1912
439 Ga0495665_0043776 3300046531 Bacteria 2380
440 Ga0495665_0131528 3300046531 Bacteria 1310
441 Ga0495640_0005587 3300046533 Bacteria 9999
442 Ga0495640_0012886 3300046533 Bacteria 6377
443 Ga0495586_0002567 3300046535 Bacteria 9824
444 Ga0495586_0011166 3300046535 Bacteria 4774
445 Ga0495586_0028388 3300046535 Bacteria 2994
446 Ga0495587_0056143 3300046536 Bacteria 2317
447 Ga0495621_0046506 3300046539 Bacteria 1540
448 Ga0495645_0152758 3300046543 Bacteria 1602
449 Ga0495667_0056892 3300046559 Unclassified 2571
450 Ga0495656_0122916 3300046615 Bacteria 1227
451 Ga0495668_0087449 3300046616 Bacteria 1709
452 Ga0495635_0254181 3300046663 Bacteria 1184
453 Ga0495659_0074229 3300046664 Bacteria 1279
454 Ga0495588_0006249 3300046674 Bacteria 5354
455 Ga0495588_0007187 3300046674 Bacteria 5053
456 Ga0495657_0005797 3300046675 Bacteria 9729
457 Ga0495599_0033235 3300046678 Bacteria 3240
458 Ga0495623_0076879 3300046679 Unclassified 2071
459 Ga0495647_0000058 3300046681 Bacteria 27582
460 Ga0495647_0017269 3300046681 Bacteria 2551
461 Ga0495658_0012479 3300046683 Bacteria 4306
462 Ga0495658_0019833 3300046683 Bacteria 3515
463 Ga0495658_0045853 3300046683 Bacteria 2455
464 Ga0495658_0172039 3300046683 Bacteria 1341
465 Ga0495669_0069244 3300046684 Bacteria 1606
466 Ga0495613_0037577 3300046689 Bacteria 3589
467 Ga0495624_0017642 3300046690 Bacteria 4786
468 Ga0495624_0021757 3300046690 Bacteria 4249
469 Ga0495624_0119936 3300046690 Bacteria 1615
470 Ga0495624_0155810 3300046690 Bacteria 1396
471 Ga0495670_0072521 3300046691 Bacteria 1744
472 Ga0495600_0034149 3300046809 Unclassified 3302
473 Ga0495604_0018716 3300047317 Bacteria 5547
474 Ga0495604_0136344 3300047317 Unclassified 1758
475 Ga0495674_0069160 3300047319 Bacteria 3054
476 Ga0495676_0005390 3300047321 Bacteria 11725
477 Ga0495676_0075192 3300047321 Bacteria 2584
478 Ga0495680_0004705 3300047322 Bacteria 12987
479 Ga0495680_0094765 3300047322 Unclassified 2233
480 Ga0495675_0051153 3300047444 Plasmid 2625
481 Ga0495684_0236197 3300047471 Bacteria 1335
482 Ga0495602_0243566 3300048088 Bacteria 1344
483 Ga0496100_0057950 3300048903 Bacteria 2540
484 Ga0496100_0080966 3300048903 Bacteria 2193
485 Ga0496100_0088744 3300048903 Bacteria 2105
486 Ga0496101_0100903 3300048904 Bacteria 2160
487 Ga0496101_0196323 3300048904 Bacteria 1559
488 Ga0496104_0000775 3300048907 Bacteria 27328
489 Ga0496104_0001327 3300048907 Bacteria 21357
490 Ga0496104_0001388 3300048907 Bacteria 20943
491 Ga0496105_0006927 3300048908 Bacteria 8730
492 Ga0496105_0050843 3300048908 Bacteria 3424
493 Ga0496106_0020742 3300048909 Bacteria 4877
494 Ga0496106_0066402 3300048909 Unclassified 2747
495 Ga0496107_0076871 3300048910 Bacteria 2432
496 Ga0496108_0020494 3300048911 Bacteria 5436
497 Ga0496109_0025531 3300048912 Bacteria 5266
498 Ga0496109_0129696 3300048912 Bacteria 2352
499 Ga0496109_0277292 3300048912 Bacteria 1580
500 Ga0496109_0470447 3300048912 Bacteria 1187
501 Ga0496110_0008245 3300048913 Bacteria 8376
502 Ga0496110_0050957 3300048913 Bacteria 3637
503 Ga0496110_0197369 3300048913 Bacteria 1828
504 Ga0496111_0017425 3300048914 Bacteria 4967
505 Ga0496111_0194545 3300048914 Unclassified 1507
506 Ga0496113_0065521 3300048916 Bacteria 2750
507 Ga0496114_0021652 3300048917 Bacteria 5232
508 Ga0496115_0013314 3300048918 Bacteria 6221
509 Ga0496115_0059102 3300048918 Bacteria 3087
510 Ga0496115_0096465 3300048918 Bacteria 2421
511 Ga0501032_0010690 3300049569 Bacteria 6606
512 Ga0501034_0121088 3300049571 Bacteria 2603
513 Ga0501036_0197957 3300049572 Bacteria 1690
514 Ga0501037_0009409 3300049573 Bacteria 7172
515 Ga0501038_0010065 3300049574 Bacteria 8658
516 Ga0501040_0003088 3300049576 Bacteria 10800
517 Ga0501041_0005947 3300049577 Bacteria 7137
518 Ga0501041_0064912 3300049577 Bacteria 2236
519 Ga0501042_0016022 3300049578 Bacteria 5142
520 Ga0501042_0526524 3300049578 Bacteria 859
521 Ga0501043_0000386 3300049579 Bacteria 39806
522 Ga0501043_0077251 3300049579 Bacteria 2616
523 Ga0501046_0000491 3300049580 Bacteria 39431
524 Ga0501046_0001179 3300049580 Bacteria 25420
525 Ga0501047_0000021 3300049581 Bacteria 254841
526 Ga0501048_0009095 3300049582 Bacteria 7477
527 Ga0501068_0005838 3300049584 Bacteria 6754
528 Ga0501070_0019933 3300049586 Bacteria 5623
529 Ga0501072_0029111 3300049588 Bacteria 4312
530 Ga0501073_0004780 3300049589 Bacteria 10164
531 Ga0501075_0129546 3300049591 Bacteria 1922
532 Ga0501080_0164832 3300049742 Bacteria 2045
533 Ga0501083_0148170 3300049744 Bacteria 1537
534 Ga0501035_0283568 3300049822 Bacteria 1399
535 Ga0501044_0000411 3300049823 Bacteria 52862
536 Ga0501045_0004535 3300049824 Bacteria 9594
537 Ga0501045_0087567 3300049824 Bacteria 2300
538 nmdc:mga03683_9684_c1 3300050489 Bacteria 3437
539 nmdc:mga00v17_142261_c1 3300050491 Bacteria 1539
540 nmdc:mga0yw44_55814_c1 3300050492 Bacteria 2404
541 nmdc:mga0yw44_8602_c1 3300050492 Bacteria 5096
542 nmdc:mga0yw44_91123_c1 3300050492 Bacteria 1927
543 nmdc:mga0k408_145512_c1 3300050493 Bacteria 1411
544 nmdc:mga0k408_17331_c1 3300050493 Bacteria 4012
545 nmdc:mga0k408_20124_c1 3300050493 Bacteria 3735
546 nmdc:mga06z11_42449_c1 3300050494 Bacteria 2282
547 nmdc:mga07m45_8286_c2 3300050496 Bacteria 4987
548 nmdc:mga05p37_248908_c1 3300050507 Bacteria 2132
549 nmdc:mga05p37_331333_c1 3300050507 Bacteria 1798
550 nmdc:mga05p37_351125_c1 3300050507 Bacteria 1736
551 nmdc:mga05p37_351536_c1 3300050507 Bacteria 1735
552 nmdc:mga05p37_40918_c1 3300050507 Bacteria 5691
553 nmdc:mga05p37_587703_c1 3300050507 Bacteria 1260
554 nmdc:mga09592_22871_c1 3300050508 Bacteria 5157
555 nmdc:mga09592_256552_c1 3300050508 Bacteria 1516
556 nmdc:mga09592_272_c1 3300050508 Bacteria 37407
557 nmdc:mga09592_62107_c1 3300050508 Bacteria 3161
558 nmdc:mga0qj67_40253_c1 3300050509 Bacteria 3674
559 nmdc:mga0qj67_56393_c1 3300050509 Bacteria 3114
560 nmdc:mga0qj67_90618_c1 3300050509 Bacteria 2457
561 nmdc:mga06r32_103739_c1 3300050510 Bacteria 2792
562 nmdc:mga06r32_15134_c1 3300050510 Bacteria 7006
563 nmdc:mga06r32_338998_c1 3300050510 Bacteria 1488
564 nmdc:mga08y16_245273_c1 3300050511 Bacteria 1851
565 nmdc:mga08y16_29377_c1 3300050511 Bacteria 5793
566 nmdc:mga08y16_33586_c1 3300050511 Bacteria 5388
567 nmdc:mga08y16_40016_c1 3300050511 Bacteria 4916
568 nmdc:mga08y16_418836_c1 3300050511 Bacteria 1369
569 nmdc:mga0n895_159_c1 3300050512 Bacteria 41448
570 nmdc:mga0n895_189894_c1 3300050512 Bacteria 2085
571 nmdc:mga0n895_436_c1 3300050512 Bacteria 28097
572 nmdc:mga0n895_441517_c1 3300050512 Bacteria 1314
573 nmdc:mga0n895_620694_c1 3300050512 Bacteria 1082
574 nmdc:mga0n895_80639_c1 3300050512 Bacteria 3242
575 nmdc:mga0n895_8305_c1 3300050512 Bacteria 8982
576 nmdc:mga0rr50_10116_c1 3300050513 Bacteria 5969
577 nmdc:mga0rr50_127362_c1 3300050513 Bacteria 2035
578 nmdc:mga0rr50_76070_c1 3300050513 Bacteria 2576
579 nmdc:mga08x19_37558_c1 3300050514 Bacteria 3074
580 nmdc:mga08x19_54324_c1 3300050514 Bacteria 2578
581 nmdc:mga08x19_6451_c1 3300050514 Bacteria 6947
582 nmdc:mga08x19_833_c1 3300050514 Bacteria 19578
583 nmdc:mga0a205_175_c1 3300050515 Bacteria 43324
584 nmdc:mga0a205_316644_c1 3300050515 Bacteria 1431
585 nmdc:mga0a205_540403_c1 3300050515 Bacteria 1021
586 Ga0495601_0011258 3300053077 Bacteria 5345
587 Ga0495601_0133707 3300053077 Bacteria 1616
588 Ga0495612_0082234 3300053078 Bacteria 1354
589 Ga0495595_0005633 3300053084 Bacteria 5066
590 Ga0495619_0107214 3300053085 Bacteria 1906
591 Ga0500646_0003926 3300053090 Bacteria 3781
592 Ga0500583_0028138 3300053092 Bacteria 2434
593 Ga0500590_034114 3300053148 Bacteria 2635
594 Ga0500604_0000597 3300053151 Bacteria 9895
595 Ga0500616_0046553 3300053153 Bacteria 2305
596 Ga0501084_0009132 3300054114 Bacteria 8202

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049578 Ga0501042_0526524 Ga0501042_0526524_18_845 260
2 3300050493 nmdc:mga0k408_20124_c1 nmdc:mga0k408_20124_c1_2890_3717 275
3 3300006038 Ga0075365_10038691 Ga0075365_100386911 279
4 3300037312 Ga0395899_0059379 Ga0395899_0059379_1056_2024 284
5 3300037418 Ga0395900_0001544 Ga0395900_0001544_21364_22332 284
6 3300038443 Ga0395901_0062199 Ga0395901_0062199_2113_3081 284
7 3300031251 Ga0265327_10006312 Ga0265327_100063125 289
8 3300005937 Ga0081455_10048635 Ga0081455_100486355 294
9 3300042435 Ga0439434_0069165 Ga0439434_0069165_16_966 294
10 3300007265 Ga0099794_10005841 Ga0099794_100058414 295
11 3300009147 Ga0114129_10415902 Ga0114129_104159022 295
12 3300031901 Ga0307406_10084017 Ga0307406_100840172 295
13 3300031911 Ga0307412_10126580 Ga0307412_101265802 295
14 3300032004 Ga0307414_10066108 Ga0307414_100661082 295
15 3300039437 Ga0436365_1202296 Ga0436365_1202296_894_1856 295
16 3300050507 nmdc:mga05p37_351125_c1 nmdc:mga05p37_351125_c1_264_1208 295
17 3300050510 nmdc:mga06r32_338998_c1 nmdc:mga06r32_338998_c1_122_1075 295
18 3300009147 Ga0114129_10557743 Ga0114129_105577431 296
19 3300045976 Ga0466967_0085674 Ga0466967_0085674_109_1077 296
20 3300005329 Ga0070683_100080356 Ga0070683_1000803563 298
21 3300005330 Ga0070690_100002470 Ga0070690_1000024706 298
22 3300005535 Ga0070684_100009449 Ga0070684_1000094495 298
23 3300005549 Ga0070704_100000332 Ga0070704_1000003322 298
24 3300006846 Ga0075430_100036267 Ga0075430_1000362671 298
25 3300006847 Ga0075431_100044305 Ga0075431_1000443054 298
26 3300006880 Ga0075429_100004031 Ga0075429_1000040314 298
27 3300009147 Ga0114129_10225554 Ga0114129_102255542 298
28 3300009551 Ga0105238_10001829 Ga0105238_1000182913 298
29 3300013307 Ga0157372_10200194 Ga0157372_102001942 298
30 3300035114 Ga0373939_0002731 Ga0373939_0002731_13_942 298
31 3300035691 Ga0373931_0040452 Ga0373931_0040452_493_1422 298
32 3300047471 Ga0495684_0236197 Ga0495684_0236197_30_968 298
33 3300048918 Ga0496115_0096465 Ga0496115_0096465_891_1880 298
34 3300050507 nmdc:mga05p37_587703_c1 nmdc:mga05p37_587703_c1_263_1189 298
35 3300050508 nmdc:mga09592_22871_c1 nmdc:mga09592_22871_c1_453_1379 298
36 3300050509 nmdc:mga0qj67_90618_c1 nmdc:mga0qj67_90618_c1_386_1312 298
37 3300005471 Ga0070698_100084696 Ga0070698_1000846962 299
38 3300046681 Ga0495647_0017269 Ga0495647_0017269_310_1266 299
39 3300048903 Ga0496100_0080966 Ga0496100_0080966_80_1054 299
40 3300048904 Ga0496101_0196323 Ga0496101_0196323_211_1185 299
41 3300048917 Ga0496114_0021652 Ga0496114_0021652_183_1157 299
42 3300050493 nmdc:mga0k408_145512_c1 nmdc:mga0k408_145512_c1_76_1026 299
43 3300050507 nmdc:mga05p37_351536_c1 nmdc:mga05p37_351536_c1_205_1140 299
44 3300005436 Ga0070713_100485481 Ga0070713_1004854811 300
45 3300005471 Ga0070698_100265190 Ga0070698_1002651902 300
46 3300005518 Ga0070699_100149460 Ga0070699_1001494602 300
47 3300005937 Ga0081455_10014656 Ga0081455_100146565 300
48 3300006028 Ga0070717_10159162 Ga0070717_101591623 300
49 3300006038 Ga0075365_10059819 Ga0075365_100598193 300
50 3300006175 Ga0070712_100018198 Ga0070712_1000181982 300
51 3300009094 Ga0111539_10030515 Ga0111539_100305152 300
52 3300025928 Ga0207700_10122738 Ga0207700_101227383 300
53 3300030521 Ga0307511_10000019 Ga0307511_1000001972 300
54 3300035695 Ga0373927_0030096 Ga0373927_0030096_866_1861 300
55 3300046475 Ga0495639_0019927 Ga0495639_0019927_1777_2772 300
56 3300046476 Ga0495662_0146171 Ga0495662_0146171_125_1120 300
57 3300046664 Ga0495659_0074229 Ga0495659_0074229_300_1253 300
58 3300046683 Ga0495658_0172039 Ga0495658_0172039_199_1194 300
59 3300046690 Ga0495624_0021757 Ga0495624_0021757_1571_2566 300
60 3300047321 Ga0495676_0075192 Ga0495676_0075192_1226_2221 300
61 3300048907 Ga0496104_0001327 Ga0496104_0001327_9643_10587 300
62 3300048908 Ga0496105_0050843 Ga0496105_0050843_10_954 300
63 3300048910 Ga0496107_0076871 Ga0496107_0076871_189_1133 300
64 3300048913 Ga0496110_0050957 Ga0496110_0050957_1408_2370 300
65 3300048918 Ga0496115_0059102 Ga0496115_0059102_420_1364 300
66 3300050492 nmdc:mga0yw44_55814_c1 nmdc:mga0yw44_55814_c1_1212_2204 300
67 3300050511 nmdc:mga08y16_418836_c1 nmdc:mga08y16_418836_c1_389_1351 300
68 3300050515 nmdc:mga0a205_540403_c1 nmdc:mga0a205_540403_c1_43_1005 300
69 3300053092 Ga0500583_0028138 Ga0500583_0028138_1082_2056 300
70 3300005444 Ga0070694_100036957 Ga0070694_1000369572 301
71 3300005937 Ga0081455_10050038 Ga0081455_100500381 301
72 3300005937 Ga0081455_10180659 Ga0081455_101806592 301
73 3300006847 Ga0075431_100030894 Ga0075431_1000308942 301
74 3300006880 Ga0075429_100054026 Ga0075429_1000540263 301
75 3300007076 Ga0075435_100141893 Ga0075435_1001418932 301
76 3300009094 Ga0111539_10370177 Ga0111539_103701771 301
77 3300046499 Ga0495594_0011426 Ga0495594_0011426_915_1865 301
78 3300046513 Ga0495616_0046790 Ga0495616_0046790_868_1818 301
79 3300046517 Ga0495630_0038696 Ga0495630_0038696_2212_3159 301
80 3300046520 Ga0495637_0061251 Ga0495637_0061251_486_1421 301
81 3300046523 Ga0495644_0117334 Ga0495644_0117334_33_968 301
82 3300046533 Ga0495640_0012886 Ga0495640_0012886_2110_3057 301
83 3300046535 Ga0495586_0028388 Ga0495586_0028388_1587_2534 301
84 3300046663 Ga0495635_0254181 Ga0495635_0254181_152_1099 301
85 3300046690 Ga0495624_0017642 Ga0495624_0017642_712_1659 301
86 3300046691 Ga0495670_0072521 Ga0495670_0072521_58_1008 301
87 3300048914 Ga0496111_0194545 Ga0496111_0194545_54_989 301
88 3300005530 Ga0070679_100332290 Ga0070679_1003322901 302
89 3300009147 Ga0114129_10258851 Ga0114129_102588512 302
90 3300009147 Ga0114129_10320129 Ga0114129_103201292 302
91 3300035088 Ga0373940_0046871 Ga0373940_0046871_128_1078 302
92 3300035114 Ga0373939_0084887 Ga0373939_0084887_35_985 302
93 3300035115 Ga0373941_0005939 Ga0373941_0005939_1440_2390 302
94 3300042117 Ga0450913_000161 Ga0450913_000161_310_1257 302
95 3300042530 Ga0450916_004176 Ga0450916_004176_381_1328 302
96 3300050508 nmdc:mga09592_62107_c1 nmdc:mga09592_62107_c1_721_1668 302
97 3300050510 nmdc:mga06r32_15134_c1 nmdc:mga06r32_15134_c1_2288_3235 302
98 3300053153 Ga0500616_0046553 Ga0500616_0046553_584_1552 302
99 3300005290 Ga0065712_10076209 Ga0065712_100762092 303
100 3300005329 Ga0070683_100007986 Ga0070683_1000079867 303
101 3300005331 Ga0070670_100046961 Ga0070670_1000469612 303
102 3300005333 Ga0070677_10030825 Ga0070677_100308251 303
103 3300005334 Ga0068869_100095903 Ga0068869_1000959032 303
104 3300005334 Ga0068869_100309620 Ga0068869_1003096201 303
105 3300005335 Ga0070666_10021763 Ga0070666_100217632 303
106 3300005336 Ga0070680_100025401 Ga0070680_1000254012 303
107 3300005337 Ga0070682_100122885 Ga0070682_1001228851 303
108 3300005338 Ga0068868_100006058 Ga0068868_10000605810 303
109 3300005338 Ga0068868_100008082 Ga0068868_1000080826 303
110 3300005340 Ga0070689_100013130 Ga0070689_1000131304 303
111 3300005341 Ga0070691_10001532 Ga0070691_100015322 303
112 3300005343 Ga0070687_100000563 Ga0070687_1000005635 303
113 3300005344 Ga0070661_100006718 Ga0070661_1000067187 303
114 3300005353 Ga0070669_100004794 Ga0070669_1000047945 303
115 3300005354 Ga0070675_100000678 Ga0070675_10000067820 303
116 3300005355 Ga0070671_100000403 Ga0070671_1000004038 303
117 3300005356 Ga0070674_100010484 Ga0070674_1000104846 303
118 3300005364 Ga0070673_100005786 Ga0070673_1000057866 303
119 3300005367 Ga0070667_100336110 Ga0070667_1003361102 303
120 3300005406 Ga0070703_10051590 Ga0070703_100515901 303
121 3300005435 Ga0070714_100026265 Ga0070714_1000262655 303
122 3300005436 Ga0070713_100103250 Ga0070713_1001032501 303
123 3300005438 Ga0070701_10000846 Ga0070701_100008462 303
124 3300005440 Ga0070705_100007263 Ga0070705_1000072634 303
125 3300005440 Ga0070705_100011771 Ga0070705_1000117712 303
126 3300005444 Ga0070694_100004374 Ga0070694_10000437410 303
127 3300005444 Ga0070694_100095538 Ga0070694_1000955382 303
128 3300005456 Ga0070678_100004377 Ga0070678_1000043773 303
129 3300005457 Ga0070662_100048244 Ga0070662_1000482442 303
130 3300005458 Ga0070681_10004036 Ga0070681_100040369 303
131 3300005459 Ga0068867_100001052 Ga0068867_1000010524 303
132 3300005459 Ga0068867_100027859 Ga0068867_1000278592 303
133 3300005467 Ga0070706_100038959 Ga0070706_1000389592 303
134 3300005468 Ga0070707_100066222 Ga0070707_1000662222 303
135 3300005518 Ga0070699_100003640 Ga0070699_10000364014 303
136 3300005518 Ga0070699_100019712 Ga0070699_1000197125 303
137 3300005518 Ga0070699_100115561 Ga0070699_1001155612 303
138 3300005530 Ga0070679_100040873 Ga0070679_1000408734 303
139 3300005535 Ga0070684_100018260 Ga0070684_1000182604 303
140 3300005536 Ga0070697_100040276 Ga0070697_1000402764 303
141 3300005536 Ga0070697_100128533 Ga0070697_1001285332 303
142 3300005543 Ga0070672_100004172 Ga0070672_1000041723 303
143 3300005543 Ga0070672_100077266 Ga0070672_1000772662 303
144 3300005544 Ga0070686_100004643 Ga0070686_10000464310 303
145 3300005545 Ga0070695_100013642 Ga0070695_1000136426 303
146 3300005546 Ga0070696_100000286 Ga0070696_1000002866 303
147 3300005546 Ga0070696_100005387 Ga0070696_1000053872 303
148 3300005546 Ga0070696_100009006 Ga0070696_1000090064 303
149 3300005547 Ga0070693_100000272 Ga0070693_1000002722 303
150 3300005549 Ga0070704_100258769 Ga0070704_1002587692 303
151 3300005563 Ga0068855_100056798 Ga0068855_1000567982 303
152 3300005563 Ga0068855_100331863 Ga0068855_1003318631 303
153 3300005564 Ga0070664_100000715 Ga0070664_1000007157 303
154 3300005578 Ga0068854_100013961 Ga0068854_1000139613 303
155 3300005578 Ga0068854_100017041 Ga0068854_1000170417 303
156 3300005614 Ga0068856_100172592 Ga0068856_1001725922 303
157 3300005615 Ga0070702_100002099 Ga0070702_1000020994 303
158 3300005616 Ga0068852_100012610 Ga0068852_1000126104 303
159 3300005618 Ga0068864_100000855 Ga0068864_1000008556 303
160 3300005718 Ga0068866_10000268 Ga0068866_1000026812 303
161 3300005719 Ga0068861_100000494 Ga0068861_1000004945 303
162 3300005719 Ga0068861_100003214 Ga0068861_1000032145 303
163 3300005834 Ga0068851_10006680 Ga0068851_100066803 303
164 3300005840 Ga0068870_10013548 Ga0068870_100135485 303
165 3300005841 Ga0068863_100021690 Ga0068863_1000216906 303
166 3300005842 Ga0068858_100163526 Ga0068858_1001635262 303
167 3300005843 Ga0068860_100001071 Ga0068860_10000107128 303
168 3300005844 Ga0068862_100005771 Ga0068862_1000057717 303
169 3300005844 Ga0068862_100146254 Ga0068862_1001462542 303
170 3300006038 Ga0075365_10012874 Ga0075365_100128742 303
171 3300006042 Ga0075368_10050465 Ga0075368_100504651 303
172 3300006048 Ga0075363_100045905 Ga0075363_1000459052 303
173 3300006051 Ga0075364_10086138 Ga0075364_100861382 303
174 3300006173 Ga0070716_100027556 Ga0070716_1000275562 303
175 3300006173 Ga0070716_100271943 Ga0070716_1002719432 303
176 3300006237 Ga0097621_100002822 Ga0097621_1000028228 303
177 3300006237 Ga0097621_100003412 Ga0097621_10000341213 303
178 3300006358 Ga0068871_100002838 Ga0068871_1000028385 303
179 3300006358 Ga0068871_100003826 Ga0068871_1000038264 303
180 3300006844 Ga0075428_100011770 Ga0075428_1000117705 303
181 3300006844 Ga0075428_100429266 Ga0075428_1004292662 303
182 3300006846 Ga0075430_100003725 Ga0075430_1000037258 303
183 3300006846 Ga0075430_100026920 Ga0075430_1000269204 303
184 3300006846 Ga0075430_100163239 Ga0075430_1001632392 303
185 3300006847 Ga0075431_100492529 Ga0075431_1004925292 303
186 3300006852 Ga0075433_10001763 Ga0075433_100017632 303
187 3300006852 Ga0075433_10516578 Ga0075433_105165782 303
188 3300006871 Ga0075434_100000033 Ga0075434_10000003333 303
189 3300006871 Ga0075434_100000318 Ga0075434_10000031843 303
190 3300006871 Ga0075434_100124510 Ga0075434_1001245103 303
191 3300006880 Ga0075429_100000191 Ga0075429_10000019138 303
192 3300006881 Ga0068865_100005516 Ga0068865_1000055168 303
193 3300006881 Ga0068865_100007719 Ga0068865_1000077192 303
194 3300006914 Ga0075436_100001263 Ga0075436_1000012636 303
195 3300006914 Ga0075436_100001365 Ga0075436_10000136514 303
196 3300006914 Ga0075436_100018853 Ga0075436_1000188534 303
197 3300006914 Ga0075436_100065802 Ga0075436_1000658021 303
198 3300006914 Ga0075436_100166024 Ga0075436_1001660242 303
199 3300007076 Ga0075435_100000095 Ga0075435_10000009533 303
200 3300007076 Ga0075435_100086020 Ga0075435_1000860202 303
201 3300007076 Ga0075435_100100107 Ga0075435_1001001072 303
202 3300007076 Ga0075435_100377384 Ga0075435_1003773842 303
203 3300007265 Ga0099794_10032073 Ga0099794_100320732 303
204 3300007265 Ga0099794_10040210 Ga0099794_100402101 303
205 3300009094 Ga0111539_10027400 Ga0111539_100274003 303
206 3300009094 Ga0111539_10031451 Ga0111539_100314518 303
207 3300009094 Ga0111539_10056838 Ga0111539_100568384 303
208 3300009094 Ga0111539_10528040 Ga0111539_105280401 303
209 3300009098 Ga0105245_10000900 Ga0105245_1000090023 303
210 3300009147 Ga0114129_10027395 Ga0114129_100273954 303
211 3300009147 Ga0114129_10495655 Ga0114129_104956552 303
212 3300009148 Ga0105243_10002495 Ga0105243_1000249517 303
213 3300009148 Ga0105243_10012365 Ga0105243_100123654 303
214 3300009174 Ga0105241_10013546 Ga0105241_100135465 303
215 3300009176 Ga0105242_10000570 Ga0105242_1000057028 303
216 3300009177 Ga0105248_10046301 Ga0105248_100463012 303
217 3300009177 Ga0105248_10292651 Ga0105248_102926511 303
218 3300009553 Ga0105249_10004906 Ga0105249_100049067 303
219 3300009553 Ga0105249_10011144 Ga0105249_100111449 303
220 3300010375 Ga0105239_10710452 Ga0105239_107104522 303
221 3300011119 Ga0105246_10107443 Ga0105246_101074431 303
222 3300013296 Ga0157374_10013274 Ga0157374_100132746 303
223 3300013297 Ga0157378_10013586 Ga0157378_100135865 303
224 3300013306 Ga0163162_10074780 Ga0163162_100747802 303
225 3300013308 Ga0157375_10014357 Ga0157375_100143573 303
226 3300013308 Ga0157375_10224640 Ga0157375_102246402 303
227 3300014326 Ga0157380_10072009 Ga0157380_100720092 303
228 3300014326 Ga0157380_10119946 Ga0157380_101199462 303
229 3300014969 Ga0157376_10025461 Ga0157376_100254613 303
230 3300014969 Ga0157376_10049805 Ga0157376_100498053 303
231 3300025315 Ga0207697_10102463 Ga0207697_101024632 303
232 3300025321 Ga0207656_10004859 Ga0207656_100048592 303
233 3300025885 Ga0207653_10030736 Ga0207653_100307361 303
234 3300025893 Ga0207682_10041450 Ga0207682_100414502 303
235 3300025893 Ga0207682_10075587 Ga0207682_100755872 303
236 3300025899 Ga0207642_10095869 Ga0207642_100958692 303
237 3300025903 Ga0207680_10012474 Ga0207680_100124742 303
238 3300025904 Ga0207647_10060267 Ga0207647_100602672 303
239 3300025908 Ga0207643_10007262 Ga0207643_100072627 303
240 3300025911 Ga0207654_10050354 Ga0207654_100503542 303
241 3300025912 Ga0207707_10023586 Ga0207707_100235862 303
242 3300025912 Ga0207707_10132004 Ga0207707_101320042 303
243 3300025915 Ga0207693_10184674 Ga0207693_101846741 303
244 3300025917 Ga0207660_10003686 Ga0207660_100036862 303
245 3300025918 Ga0207662_10000255 Ga0207662_1000025522 303
246 3300025920 Ga0207649_10011853 Ga0207649_100118532 303
247 3300025921 Ga0207652_10063374 Ga0207652_100633742 303
248 3300025925 Ga0207650_10008372 Ga0207650_100083724 303
249 3300025926 Ga0207659_10005784 Ga0207659_100057842 303
250 3300025926 Ga0207659_10017688 Ga0207659_100176882 303
251 3300025927 Ga0207687_10060966 Ga0207687_100609662 303
252 3300025928 Ga0207700_10194097 Ga0207700_101940971 303
253 3300025931 Ga0207644_10022367 Ga0207644_100223672 303
254 3300025933 Ga0207706_10090481 Ga0207706_100904812 303
255 3300025934 Ga0207686_10013086 Ga0207686_100130864 303
256 3300025935 Ga0207709_10012837 Ga0207709_100128373 303
257 3300025935 Ga0207709_10201511 Ga0207709_102015112 303
258 3300025936 Ga0207670_10009101 Ga0207670_100091012 303
259 3300025936 Ga0207670_10064336 Ga0207670_100643362 303
260 3300025937 Ga0207669_10004046 Ga0207669_100040462 303
261 3300025938 Ga0207704_10001889 Ga0207704_1000188910 303
262 3300025938 Ga0207704_10006023 Ga0207704_100060232 303
263 3300025939 Ga0207665_10187817 Ga0207665_101878171 303
264 3300025940 Ga0207691_10000553 Ga0207691_100005538 303
265 3300025941 Ga0207711_10042867 Ga0207711_100428671 303
266 3300025942 Ga0207689_10011317 Ga0207689_100113175 303
267 3300025944 Ga0207661_10003659 Ga0207661_100036598 303
268 3300025945 Ga0207679_10008461 Ga0207679_100084613 303
269 3300025949 Ga0207667_10046208 Ga0207667_100462082 303
270 3300025960 Ga0207651_10316624 Ga0207651_103166242 303
271 3300025961 Ga0207712_10050627 Ga0207712_100506272 303
272 3300025961 Ga0207712_10125394 Ga0207712_101253942 303
273 3300025972 Ga0207668_10189061 Ga0207668_101890612 303
274 3300025981 Ga0207640_10009859 Ga0207640_100098593 303
275 3300025981 Ga0207640_10028180 Ga0207640_100281802 303
276 3300026023 Ga0207677_10003501 Ga0207677_100035014 303
277 3300026023 Ga0207677_10074232 Ga0207677_100742322 303
278 3300026035 Ga0207703_10026263 Ga0207703_100262633 303
279 3300026035 Ga0207703_10315216 Ga0207703_103152162 303
280 3300026075 Ga0207708_10008564 Ga0207708_100085644 303
281 3300026089 Ga0207648_10000276 Ga0207648_1000027616 303
282 3300026095 Ga0207676_10003972 Ga0207676_100039724 303
283 3300026116 Ga0207674_10426547 Ga0207674_104265472 303
284 3300026118 Ga0207675_100006484 Ga0207675_1000064847 303
285 3300026118 Ga0207675_100007574 Ga0207675_1000075748 303
286 3300026121 Ga0207683_10009572 Ga0207683_100095723 303
287 3300026142 Ga0207698_10006445 Ga0207698_100064456 303
288 3300027907 Ga0207428_10000726 Ga0207428_1000072637 303
289 3300027907 Ga0207428_10059832 Ga0207428_100598322 303
290 3300027907 Ga0207428_10103966 Ga0207428_101039662 303
291 3300028379 Ga0268266_10097245 Ga0268266_100972452 303
292 3300028381 Ga0268264_10017841 Ga0268264_100178414 303
293 3300028381 Ga0268264_10247930 Ga0268264_102479302 303
294 3300031731 Ga0307405_10260539 Ga0307405_102605392 303
295 3300032005 Ga0307411_10217152 Ga0307411_102171522 303
296 3300034957 Ga0373938_0021153 Ga0373938_0021153_205_1158 303
297 3300035083 Ga0373926_0002688 Ga0373926_0002688_2723_3676 303
298 3300035085 Ga0373929_0015766 Ga0373929_0015766_397_1350 303
299 3300035085 Ga0373929_0022292 Ga0373929_0022292_223_1176 303
300 3300035086 Ga0373934_0015905 Ga0373934_0015905_1572_2531 303
301 3300035090 Ga0373949_0033982 Ga0373949_0033982_219_1172 303
302 3300035092 Ga0373952_0021674 Ga0373952_0021674_124_1077 303
303 3300035115 Ga0373941_0012975 Ga0373941_0012975_604_1557 303
304 3300035116 Ga0373945_0004289 Ga0373945_0004289_2008_2961 303
305 3300035170 Ga0373943_0004208 Ga0373943_0004208_2096_3049 303
306 3300035170 Ga0373943_0048192 Ga0373943_0048192_353_1306 303
307 3300035691 Ga0373931_0038696 Ga0373931_0038696_1167_2120 303
308 3300035692 Ga0373935_0070899 Ga0373935_0070899_1170_2123 303
309 3300035725 Ga0373947_0009232 Ga0373947_0009232_2295_3248 303
310 3300035725 Ga0373947_0010041 Ga0373947_0010041_1584_2537 303
311 3300037068 Ga0373925_0013212 Ga0373925_0013212_2520_3473 303
312 3300037068 Ga0373925_0196284 Ga0373925_0196284_166_1119 303
313 3300037471 Ga0395905_0084323 Ga0395905_0084323_1421_2395 303
314 3300042001 Ga0439441_002703 Ga0439441_002703_737_1711 303
315 3300042436 Ga0439435_0029780 Ga0439435_0029780_331_1305 303
316 3300045051 Ga0451576_0001715 Ga0451576_0001715_11107_12060 303
317 3300045051 Ga0451576_0175914 Ga0451576_0175914_934_1890 303
318 3300046454 Ga0495592_0006561 Ga0495592_0006561_7323_8276 303
319 3300046455 Ga0495603_0002544 Ga0495603_0002544_5982_6935 303
320 3300046459 Ga0495629_0168046 Ga0495629_0168046_442_1395 303
321 3300046472 Ga0495580_0002354 Ga0495580_0002354_1226_2179 303
322 3300046475 Ga0495639_0010766 Ga0495639_0010766_850_1803 303
323 3300046476 Ga0495662_0012546 Ga0495662_0012546_2258_3211 303
324 3300046476 Ga0495662_0027363 Ga0495662_0027363_1152_2102 303
325 3300046511 Ga0495608_0012778 Ga0495608_0012778_4820_5773 303
326 3300046514 Ga0495618_0006638 Ga0495618_0006638_5861_6814 303
327 3300046516 Ga0495628_0117528 Ga0495628_0117528_355_1305 303
328 3300046517 Ga0495630_0001728 Ga0495630_0001728_5502_6455 303
329 3300046526 Ga0495666_0020549 Ga0495666_0020549_1652_2605 303
330 3300046526 Ga0495666_0026411 Ga0495666_0026411_1419_2372 303
331 3300046531 Ga0495665_0043776 Ga0495665_0043776_538_1491 303
332 3300046533 Ga0495640_0005587 Ga0495640_0005587_8875_9828 303
333 3300046535 Ga0495586_0002567 Ga0495586_0002567_8107_9060 303
334 3300046535 Ga0495586_0011166 Ga0495586_0011166_3792_4745 303
335 3300046536 Ga0495587_0056143 Ga0495587_0056143_1052_2005 303
336 3300046543 Ga0495645_0152758 Ga0495645_0152758_248_1201 303
337 3300046674 Ga0495588_0006249 Ga0495588_0006249_1727_2680 303
338 3300046678 Ga0495599_0033235 Ga0495599_0033235_642_1595 303
339 3300046681 Ga0495647_0000058 Ga0495647_0000058_13511_14464 303
340 3300046683 Ga0495658_0012479 Ga0495658_0012479_2570_3523 303
341 3300046683 Ga0495658_0019833 Ga0495658_0019833_58_1011 303
342 3300046690 Ga0495624_0155810 Ga0495624_0155810_321_1271 303
343 3300047317 Ga0495604_0018716 Ga0495604_0018716_1874_2827 303
344 3300047319 Ga0495674_0069160 Ga0495674_0069160_1902_2855 303
345 3300047322 Ga0495680_0004705 Ga0495680_0004705_7702_8655 303
346 3300048903 Ga0496100_0088744 Ga0496100_0088744_301_1263 303
347 3300048904 Ga0496101_0100903 Ga0496101_0100903_117_1079 303
348 3300048911 Ga0496108_0020494 Ga0496108_0020494_1172_2134 303
349 3300048912 Ga0496109_0025531 Ga0496109_0025531_1888_2850 303
350 3300048913 Ga0496110_0008245 Ga0496110_0008245_5340_6302 303
351 3300048913 Ga0496110_0197369 Ga0496110_0197369_190_1158 303
352 3300048914 Ga0496111_0017425 Ga0496111_0017425_2053_3015 303
353 3300048916 Ga0496113_0065521 Ga0496113_0065521_632_1594 303
354 3300049572 Ga0501036_0197957 Ga0501036_0197957_19_984 303
355 3300049576 Ga0501040_0003088 Ga0501040_0003088_6247_7212 303
356 3300049577 Ga0501041_0005947 Ga0501041_0005947_4752_5717 303
357 3300049577 Ga0501041_0064912 Ga0501041_0064912_1119_2072 303
358 3300049578 Ga0501042_0016022 Ga0501042_0016022_3809_4774 303
359 3300049579 Ga0501043_0077251 Ga0501043_0077251_1476_2441 303
360 3300049588 Ga0501072_0029111 Ga0501072_0029111_1693_2658 303
361 3300049591 Ga0501075_0129546 Ga0501075_0129546_273_1226 303
362 3300049824 Ga0501045_0087567 Ga0501045_0087567_1139_2287 303
363 3300050492 nmdc:mga0yw44_8602_c1 nmdc:mga0yw44_8602_c1_1965_2963 303
364 3300050507 nmdc:mga05p37_40918_c1 nmdc:mga05p37_40918_c1_2893_3846 303
365 3300050508 nmdc:mga09592_272_c1 nmdc:mga09592_272_c1_31206_32159 303
366 3300050509 nmdc:mga0qj67_40253_c1 nmdc:mga0qj67_40253_c1_966_1916 303
367 3300050511 nmdc:mga08y16_29377_c1 nmdc:mga08y16_29377_c1_1123_2073 303
368 3300050511 nmdc:mga08y16_33586_c1 nmdc:mga08y16_33586_c1_1718_2671 303
369 3300050511 nmdc:mga08y16_40016_c1 nmdc:mga08y16_40016_c1_447_1400 303
370 3300050512 nmdc:mga0n895_159_c1 nmdc:mga0n895_159_c1_21083_22036 303
371 3300050512 nmdc:mga0n895_189894_c1 nmdc:mga0n895_189894_c1_34_1074 303
372 3300050512 nmdc:mga0n895_441517_c1 nmdc:mga0n895_441517_c1_226_1179 303
373 3300050512 nmdc:mga0n895_620694_c1 nmdc:mga0n895_620694_c1_71_1021 303
374 3300050512 nmdc:mga0n895_80639_c1 nmdc:mga0n895_80639_c1_1553_2521 303
375 3300050512 nmdc:mga0n895_8305_c1 nmdc:mga0n895_8305_c1_7283_8236 303
376 3300050513 nmdc:mga0rr50_10116_c1 nmdc:mga0rr50_10116_c1_1936_2889 303
377 3300050513 nmdc:mga0rr50_127362_c1 nmdc:mga0rr50_127362_c1_458_1408 303
378 3300050513 nmdc:mga0rr50_76070_c1 nmdc:mga0rr50_76070_c1_992_1945 303
379 3300050514 nmdc:mga08x19_37558_c1 nmdc:mga08x19_37558_c1_2011_2961 303
380 3300050514 nmdc:mga08x19_54324_c1 nmdc:mga08x19_54324_c1_1202_2155 303
381 3300050514 nmdc:mga08x19_6451_c1 nmdc:mga08x19_6451_c1_5553_6506 303
382 3300050514 nmdc:mga08x19_833_c1 nmdc:mga08x19_833_c1_6429_7382 303
383 3300050515 nmdc:mga0a205_175_c1 nmdc:mga0a205_175_c1_30238_31191 303
384 3300050515 nmdc:mga0a205_316644_c1 nmdc:mga0a205_316644_c1_179_1147 303
385 3300053085 Ga0495619_0107214 Ga0495619_0107214_228_1181 303
386 3300003215 JGI25153J46596_10002964 JGI25153J46596_100029642 304
387 3300003215 JGI25153J46596_10004430 JGI25153J46596_100044303 304
388 3300005547 Ga0070693_100024057 Ga0070693_1000240572 304
389 3300006195 Ga0075366_10053412 Ga0075366_100534122 304
390 3300009094 Ga0111539_10074451 Ga0111539_100744512 304
391 3300009177 Ga0105248_10590393 Ga0105248_105903932 304
392 3300025297 Ga0209758_1000351 Ga0209758_100035164 304
393 3300025297 Ga0209758_1001016 Ga0209758_100101610 304
394 3300025297 Ga0209758_1049604 Ga0209758_10496042 304
395 3300025944 Ga0207661_10263640 Ga0207661_102636402 304
396 3300025961 Ga0207712_10166362 Ga0207712_101663622 304
397 3300026118 Ga0207675_100467109 Ga0207675_1004671092 304
398 3300026142 Ga0207698_10513135 Ga0207698_105131351 304
399 3300035692 Ga0373935_0189732 Ga0373935_0189732_317_1291 304
400 3300037466 Ga0395898_0108630 Ga0395898_0108630_16_993 304
401 3300044683 Ga0466965_0027491 Ga0466965_0027491_947_1933 304
402 3300044842 Ga0466957_0025397 Ga0466957_0025397_1392_2378 304
403 3300046462 Ga0495651_0151781 Ga0495651_0151781_90_1058 304
404 3300046615 Ga0495656_0122916 Ga0495656_0122916_218_1192 304
405 3300048903 Ga0496100_0057950 Ga0496100_0057950_981_1979 304
406 3300048907 Ga0496104_0000775 Ga0496104_0000775_14405_15394 304
407 3300048907 Ga0496104_0001388 Ga0496104_0001388_4482_5459 304
408 3300048908 Ga0496105_0006927 Ga0496105_0006927_4499_5476 304
409 3300048909 Ga0496106_0020742 Ga0496106_0020742_2466_3455 304
410 3300048912 Ga0496109_0129696 Ga0496109_0129696_872_1849 304
411 3300048912 Ga0496109_0277292 Ga0496109_0277292_197_1186 304
412 3300048912 Ga0496109_0470447 Ga0496109_0470447_67_1056 304
413 3300048918 Ga0496115_0013314 Ga0496115_0013314_3778_4755 304
414 3300049744 Ga0501083_0148170 Ga0501083_0148170_320_1453 304
415 3300050493 nmdc:mga0k408_17331_c1 nmdc:mga0k408_17331_c1_297_1289 304
416 3300050511 nmdc:mga08y16_245273_c1 nmdc:mga08y16_245273_c1_814_1803 304
417 3300053090 Ga0500646_0003926 Ga0500646_0003926_2598_3569 304
418 3300053151 Ga0500604_0000597 Ga0500604_0000597_1252_2223 304
419 3300005336 Ga0070680_100013168 Ga0070680_1000131683 305
420 3300005458 Ga0070681_10085487 Ga0070681_100854873 305
421 3300005530 Ga0070679_100211279 Ga0070679_1002112792 305
422 3300005539 Ga0068853_100357414 Ga0068853_1003574141 305
423 3300006038 Ga0075365_10181074 Ga0075365_101810741 305
424 3300006042 Ga0075368_10004530 Ga0075368_100045302 305
425 3300006048 Ga0075363_100000486 Ga0075363_1000004863 305
426 3300006051 Ga0075364_10058077 Ga0075364_100580772 305
427 3300006178 Ga0075367_10075989 Ga0075367_100759892 305
428 3300006186 Ga0075369_10013341 Ga0075369_100133413 305
429 3300006186 Ga0075369_10025096 Ga0075369_100250963 305
430 3300006186 Ga0075369_10065295 Ga0075369_100652952 305
431 3300006353 Ga0075370_10021086 Ga0075370_100210864 305
432 3300006844 Ga0075428_100011372 Ga0075428_1000113722 305
433 3300006880 Ga0075429_100004103 Ga0075429_10000410311 305
434 3300007788 Ga0099795_10008852 Ga0099795_100088522 305
435 3300026041 Ga0207639_10230104 Ga0207639_102301042 305
436 3300030521 Ga0307511_10010947 Ga0307511_100109477 305
437 3300031238 Ga0265332_10000812 Ga0265332_1000081221 305
438 3300031241 Ga0265325_10078596 Ga0265325_100785962 305
439 3300031247 Ga0265340_10002068 Ga0265340_1000206812 305
440 3300031249 Ga0265339_10000669 Ga0265339_1000066913 305
441 3300031249 Ga0265339_10094900 Ga0265339_100949002 305
442 3300031250 Ga0265331_10006261 Ga0265331_100062619 305
443 3300031711 Ga0265314_10031514 Ga0265314_100315142 305
444 3300031712 Ga0265342_10000856 Ga0265342_100008566 305
445 3300035119 Ga0373956_0090421 Ga0373956_0090421_280_1257 305
446 3300035120 Ga0373957_0008394 Ga0373957_0008394_156_1133 305
447 3300035121 Ga0373960_0014342 Ga0373960_0014342_202_1188 305
448 3300035170 Ga0373943_0216507 Ga0373943_0216507_47_1018 305
449 3300035172 Ga0373955_0007789 Ga0373955_0007789_2876_3853 305
450 3300035241 Ga0373961_0009342 Ga0373961_0009342_791_1777 305
451 3300035410 Ga0373924_0032332 Ga0373924_0032332_375_1352 305
452 3300035692 Ga0373935_0080434 Ga0373935_0080434_765_1736 305
453 3300035695 Ga0373927_0241926 Ga0373927_0241926_96_1067 305
454 3300035724 Ga0373933_0010844 Ga0373933_0010844_711_1688 305
455 3300035725 Ga0373947_0097147 Ga0373947_0097147_701_1672 305
456 3300035725 Ga0373947_0143622 Ga0373947_0143622_504_1475 305
457 3300036401 Ga0373937_0008865 Ga0373937_0008865_4290_5267 305
458 3300037068 Ga0373925_0028674 Ga0373925_0028674_2945_3982 305
459 3300037068 Ga0373925_0159263 Ga0373925_0159263_464_1435 305
460 3300037418 Ga0395900_0355947 Ga0395900_0355947_443_1423 305
461 3300037466 Ga0395898_0153895 Ga0395898_0153895_268_1248 305
462 3300038443 Ga0395901_0131752 Ga0395901_0131752_376_1356 305
463 3300039437 Ga0436365_1429691 Ga0436365_1429691_122_1099 305
464 3300046462 Ga0495651_0211473 Ga0495651_0211473_244_1221 305
465 3300046511 Ga0495608_0006443 Ga0495608_0006443_3284_4261 305
466 3300046559 Ga0495667_0056892 Ga0495667_0056892_961_1938 305
467 3300046675 Ga0495657_0005797 Ga0495657_0005797_3260_4237 305
468 3300046679 Ga0495623_0076879 Ga0495623_0076879_753_1730 305
469 3300046809 Ga0495600_0034149 Ga0495600_0034149_72_1049 305
470 3300047317 Ga0495604_0136344 Ga0495604_0136344_38_1015 305
471 3300047322 Ga0495680_0094765 Ga0495680_0094765_1234_2211 305
472 3300047444 Ga0495675_0051153 Ga0495675_0051153_310_1287 305
473 3300048088 Ga0495602_0243566 Ga0495602_0243566_118_1089 305
474 3300049569 Ga0501032_0010690 Ga0501032_0010690_2047_3027 305
475 3300049571 Ga0501034_0121088 Ga0501034_0121088_834_1817 305
476 3300049573 Ga0501037_0009409 Ga0501037_0009409_4512_5492 305
477 3300049574 Ga0501038_0010065 Ga0501038_0010065_5317_6297 305
478 3300049579 Ga0501043_0000386 Ga0501043_0000386_28263_29252 305
479 3300049580 Ga0501046_0000491 Ga0501046_0000491_10208_11197 305
480 3300049580 Ga0501046_0001179 Ga0501046_0001179_20861_21841 305
481 3300049581 Ga0501047_0000021 Ga0501047_0000021_225590_226579 305
482 3300049582 Ga0501048_0009095 Ga0501048_0009095_3216_4205 305
483 3300049584 Ga0501068_0005838 Ga0501068_0005838_748_1728 305
484 3300049586 Ga0501070_0019933 Ga0501070_0019933_4512_5492 305
485 3300049589 Ga0501073_0004780 Ga0501073_0004780_1196_2176 305
486 3300049742 Ga0501080_0164832 Ga0501080_0164832_561_1541 305
487 3300049822 Ga0501035_0283568 Ga0501035_0283568_393_1373 305
488 3300049823 Ga0501044_0000411 Ga0501044_0000411_28977_29960 305
489 3300049824 Ga0501045_0004535 Ga0501045_0004535_1072_2052 305
490 3300050489 nmdc:mga03683_9684_c1 nmdc:mga03683_9684_c1_1030_2004 305
491 3300050491 nmdc:mga00v17_142261_c1 nmdc:mga00v17_142261_c1_278_1252 305
492 3300050494 nmdc:mga06z11_42449_c1 nmdc:mga06z11_42449_c1_15_989 305
493 3300050496 nmdc:mga07m45_8286_c2 nmdc:mga07m45_8286_c2_958_1932 305
494 3300050508 nmdc:mga09592_256552_c1 nmdc:mga09592_256552_c1_248_1237 305
495 3300053077 Ga0495601_0011258 Ga0495601_0011258_2598_3575 305
496 3300053077 Ga0495601_0133707 Ga0495601_0133707_507_1478 305
497 3300053078 Ga0495612_0082234 Ga0495612_0082234_368_1339 305
498 3300053084 Ga0495595_0005633 Ga0495595_0005633_2824_3801 305
499 3300054114 Ga0501084_0009132 Ga0501084_0009132_4751_5731 305
500 3300001991 JGI24743J22301_10009334 JGI24743J22301_100093342 306
501 3300002075 JGI24738J21930_10018815 JGI24738J21930_100188152 306
502 3300002077 JGI24744J21845_10013371 JGI24744J21845_100133712 306
503 3300002244 JGI24742J22300_10008724 JGI24742J22300_100087242 306
504 3300005334 Ga0068869_100063712 Ga0068869_1000637122 306
505 3300005338 Ga0068868_100005853 Ga0068868_1000058533 306
506 3300005341 Ga0070691_10133705 Ga0070691_101337052 306
507 3300005344 Ga0070661_100052899 Ga0070661_1000528992 306
508 3300005347 Ga0070668_100157882 Ga0070668_1001578822 306
509 3300005354 Ga0070675_100042286 Ga0070675_1000422864 306
510 3300005355 Ga0070671_100182696 Ga0070671_1001826962 306
511 3300005366 Ga0070659_100243602 Ga0070659_1002436022 306
512 3300005367 Ga0070667_100293096 Ga0070667_1002930962 306
513 3300005441 Ga0070700_100027753 Ga0070700_1000277533 306
514 3300005459 Ga0068867_100191118 Ga0068867_1001911182 306
515 3300005466 Ga0070685_10137947 Ga0070685_101379471 306
516 3300005535 Ga0070684_100337857 Ga0070684_1003378572 306
517 3300005543 Ga0070672_100058929 Ga0070672_1000589293 306
518 3300005563 Ga0068855_100626910 Ga0068855_1006269101 306
519 3300005577 Ga0068857_100147192 Ga0068857_1001471922 306
520 3300005578 Ga0068854_100155115 Ga0068854_1001551152 306
521 3300005614 Ga0068856_100123154 Ga0068856_1001231542 306
522 3300005615 Ga0070702_100136354 Ga0070702_1001363542 306
523 3300005616 Ga0068852_100268956 Ga0068852_1002689562 306
524 3300005617 Ga0068859_100326350 Ga0068859_1003263502 306
525 3300005618 Ga0068864_100007948 Ga0068864_1000079489 306
526 3300005718 Ga0068866_10043756 Ga0068866_100437562 306
527 3300005719 Ga0068861_100078036 Ga0068861_1000780363 306
528 3300005840 Ga0068870_10048226 Ga0068870_100482262 306
529 3300005841 Ga0068863_100171565 Ga0068863_1001715652 306
530 3300005842 Ga0068858_100094887 Ga0068858_1000948872 306
531 3300005937 Ga0081455_10003936 Ga0081455_100039362 306
532 3300005983 Ga0081540_1000026 Ga0081540_100002649 306
533 3300005985 Ga0081539_10008045 Ga0081539_100080457 306
534 3300005985 Ga0081539_10033748 Ga0081539_100337482 306
535 3300006178 Ga0075367_10120661 Ga0075367_101206612 306
536 3300006237 Ga0097621_100050446 Ga0097621_1000504462 306
537 3300006358 Ga0068871_100460242 Ga0068871_1004602421 306
538 3300006871 Ga0075434_100001207 Ga0075434_1000012074 306
539 3300006931 Ga0097620_100326361 Ga0097620_1003263612 306
540 3300009147 Ga0114129_10155472 Ga0114129_101554722 306
541 3300009177 Ga0105248_10029884 Ga0105248_100298843 306
542 3300009545 Ga0105237_10021363 Ga0105237_100213631 306
543 3300025899 Ga0207642_10028763 Ga0207642_100287632 306
544 3300025900 Ga0207710_10051865 Ga0207710_100518652 306
545 3300025907 Ga0207645_10039261 Ga0207645_100392613 306
546 3300025908 Ga0207643_10002306 Ga0207643_100023064 306
547 3300025926 Ga0207659_10008600 Ga0207659_100086005 306
548 3300025927 Ga0207687_10008703 Ga0207687_100087033 306
549 3300025931 Ga0207644_10206479 Ga0207644_102064792 306
550 3300025933 Ga0207706_10012014 Ga0207706_100120142 306
551 3300025935 Ga0207709_10214755 Ga0207709_102147551 306
552 3300025937 Ga0207669_10131893 Ga0207669_101318932 306
553 3300025941 Ga0207711_10044549 Ga0207711_100445492 306
554 3300025941 Ga0207711_10090988 Ga0207711_100909882 306
555 3300025942 Ga0207689_10007381 Ga0207689_100073818 306
556 3300025960 Ga0207651_10193691 Ga0207651_101936911 306
557 3300025961 Ga0207712_10200625 Ga0207712_102006251 306
558 3300025986 Ga0207658_10070530 Ga0207658_100705303 306
559 3300026023 Ga0207677_10171145 Ga0207677_101711452 306
560 3300026067 Ga0207678_10050216 Ga0207678_100502162 306
561 3300026075 Ga0207708_10104799 Ga0207708_101047993 306
562 3300026078 Ga0207702_10288799 Ga0207702_102887991 306
563 3300026088 Ga0207641_10200765 Ga0207641_102007652 306
564 3300026089 Ga0207648_10042769 Ga0207648_100427694 306
565 3300026095 Ga0207676_10049583 Ga0207676_100495831 306
566 3300026116 Ga0207674_10301308 Ga0207674_103013081 306
567 3300026118 Ga0207675_100008557 Ga0207675_1000085572 306
568 3300026142 Ga0207698_10091400 Ga0207698_100914003 306
569 3300035113 Ga0373936_0025285 Ga0373936_0025285_353_1330 306
570 3300035116 Ga0373945_0003146 Ga0373945_0003146_2677_3681 306
571 3300035171 Ga0373946_0019871 Ga0373946_0019871_48_1052 306
572 3300035695 Ga0373927_0034306 Ga0373927_0034306_1210_2187 306
573 3300035725 Ga0373947_0009079 Ga0373947_0009079_1541_2545 306
574 3300037068 Ga0373925_0006672 Ga0373925_0006672_806_1810 306
575 3300046455 Ga0495603_0081454 Ga0495603_0081454_589_1566 306
576 3300046473 Ga0495582_0005948 Ga0495582_0005948_780_1784 306
577 3300046474 Ga0495605_0027976 Ga0495605_0027976_180_1169 306
578 3300046491 Ga0495584_0111959 Ga0495584_0111959_75_1052 306
579 3300046526 Ga0495666_0054783 Ga0495666_0054783_314_1318 306
580 3300046531 Ga0495665_0131528 Ga0495665_0131528_166_1143 306
581 3300046539 Ga0495621_0046506 Ga0495621_0046506_412_1389 306
582 3300046616 Ga0495668_0087449 Ga0495668_0087449_515_1522 306
583 3300046674 Ga0495588_0007187 Ga0495588_0007187_3186_4163 306
584 3300046683 Ga0495658_0045853 Ga0495658_0045853_491_1468 306
585 3300046684 Ga0495669_0069244 Ga0495669_0069244_520_1497 306
586 3300046689 Ga0495613_0037577 Ga0495613_0037577_854_1831 306
587 3300046690 Ga0495624_0119936 Ga0495624_0119936_196_1200 306
588 3300047321 Ga0495676_0005390 Ga0495676_0005390_224_1228 306
589 3300048909 Ga0496106_0066402 Ga0496106_0066402_1208_2215 306
590 3300050492 nmdc:mga0yw44_91123_c1 nmdc:mga0yw44_91123_c1_667_1674 306
591 3300050507 nmdc:mga05p37_248908_c1 nmdc:mga05p37_248908_c1_14_985 306
592 3300050507 nmdc:mga05p37_331333_c1 nmdc:mga05p37_331333_c1_310_1284 306
593 3300050509 nmdc:mga0qj67_56393_c1 nmdc:mga0qj67_56393_c1_369_1343 306
594 3300050510 nmdc:mga06r32_103739_c1 nmdc:mga06r32_103739_c1_885_1859 306
595 3300050512 nmdc:mga0n895_436_c1 nmdc:mga0n895_436_c1_3830_4831 306
596 3300053148 Ga0500590_034114 Ga0500590_034114_1510_2499 306

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

107

379

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9712 14 304
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9709 9 304
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9648 8 306
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9598 9 298
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9585 8 306
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9558 108 226 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.948 108 231 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9479 8 304 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9408 108 231 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9394 109 226 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A4Q1HI92-F1-model_v4 NADH:flavin oxidoreductase 0.9831 9 304 GO:0009056
GO:0010181
GO:0016491
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9827 17 304
AF-A0A4Q7NH98-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9824 9 306
AF-A0A5C8CF86-F1-model_v4 deleted 0.982 19 304
AF-A0A537BUX9-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9788 9 306

Feature Viewer

pLDDT pTM Quality
94.16 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map