F467590

General Info

Members Datasets Scaffolds Average Seq Length
596 419 1192 147

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0186326|Ga0495686_0186326_75_602
Length 175
Sequence VSGIEICCGVEGDRWRMVEPVPVPEVAFAKTPPAPLKLIALDADDLAVISAHVQDARVQASDIVWRQGEKRLVVGMSRLDWEQTLSGETASRRLVAALRFDRVLACKSRKINLEAPDVSLELLGIEFHQGEAPGGSALLLFSQGAALRLDVECLECELTDLGPDDLGAAAAGVGE

Samples

Sample ID Description Type Environment
1 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
60 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
86 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
87 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
88 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
138 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
139 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
140 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
154 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
161 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
162 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
167 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
168 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
171 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
172 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
173 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
174 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
175 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
187 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
195 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
196 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
197 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
233 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
234 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
239 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
240 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
241 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
245 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
246 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
254 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
255 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
263 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
264 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
265 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
266 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
267 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
268 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
269 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
270 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
271 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
272 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
273 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
274 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
275 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
276 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
277 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
278 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
279 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
280 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
281 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
282 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
283 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
284 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
285 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
286 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
287 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
288 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
289 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
290 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
291 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
292 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
293 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
294 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
295 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
296 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
297 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
298 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
299 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
300 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
301 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
302 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
303 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
304 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
305 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
306 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
307 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
308 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
309 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
310 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
311 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
312 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
313 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
314 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
315 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
316 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
317 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
318 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
319 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
320 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
321 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
322 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
323 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
324 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
325 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
326 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
327 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
328 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
329 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
330 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
331 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
332 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
333 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
334 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
335 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
336 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
337 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
338 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
339 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
340 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
341 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
342 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
343 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
344 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
345 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
346 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
347 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
348 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
349 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
350 2922368715
351 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
352 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
353 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
354 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
355 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
356 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
357 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
358 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
359 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
360 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
361 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
362 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
363 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
364 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
365 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
366 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
367 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
368 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
369 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
370 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
371 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
372 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
373 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
374 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
375 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
376 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
377 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
378 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
379 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
380 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
381 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
382 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
383 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
384 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
385 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
386 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
387 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
388 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
389 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
390 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
391 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
392 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
393 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
394 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
395 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
396 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
397 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
398 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
399 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
400 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
401 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
402 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
403 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
404 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
405 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
406 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
407 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
408 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
409 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
410 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
411 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
412 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
413 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
414 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
415 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
416 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
417 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
418 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
419 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 75.46
Metatranscriptomes 0.17
Isolates 24.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.74
Nodule 20.3
Rhizoplane 7.72
Rhizosphere 51.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495686_0186326 3300047472 Bacteria 1199
2 JGI25406J46586_10014653 3300003203 Bacteria 3330
3 JGI25153J46596_10003243 3300003215 Bacteria 9147
4 JGI25153J46596_10014093 3300003215 Bacteria 3343
5 JGI25153J46596_10033916 3300003215 Bacteria 1676
6 JGI25160J50197_1000710 3300003354 Bacteria 18324
7 JGI25160J50197_1003342 3300003354 Bacteria 7212
8 JGI25404J52841_10016797 3300003659 Bacteria 1588
9 Ga0055524_1047452 3300003775 Bacteria 1011
10 Ga0055531_10010089 3300003794 Bacteria 4742
11 Ga0065165_1011141 3300005262 Bacteria 3793
12 Ga0065165_1014445 3300005262 Bacteria 3064
13 Ga0065165_1020545 3300005262 Bacteria 2319
14 Ga0070658_10236618 3300005327 Bacteria 1547
15 Ga0070658_11440661 3300005327 Bacteria 597
16 Ga0070683_100178879 3300005329 Bacteria 2013
17 Ga0068869_100110506 3300005334 Bacteria 2090
18 Ga0070682_100554833 3300005337 Bacteria 900
19 Ga0070660_100169140 3300005339 Bacteria 1765
20 Ga0070660_100329791 3300005339 Bacteria 1255
21 Ga0070660_101849824 3300005339 Bacteria 515
22 Ga0070661_100106700 3300005344 Bacteria 2088
23 Ga0070668_100289439 3300005347 Bacteria 1371
24 Ga0070669_100461963 3300005353 Bacteria 1048
25 Ga0070675_100547605 3300005354 Bacteria 1046
26 Ga0070671_100221574 3300005355 Bacteria 1604
27 Ga0070671_100386762 3300005355 Bacteria 1196
28 Ga0070671_101386826 3300005355 Bacteria 621
29 Ga0070659_100390994 3300005366 Bacteria 1173
30 Ga0070667_100174992 3300005367 Bacteria 1896
31 Ga0070709_10016989 3300005434 Bacteria 4166
32 Ga0070713_100003270 3300005436 Bacteria 10685
33 Ga0070713_100062028 3300005436 Bacteria 3130
34 Ga0070713_101844626 3300005436 Bacteria 587
35 Ga0070711_100004274 3300005439 Bacteria 8401
36 Ga0070711_100060687 3300005439 Bacteria 2630
37 Ga0070700_100564627 3300005441 Bacteria 886
38 Ga0070663_100221884 3300005455 Bacteria 1484
39 Ga0070663_100296620 3300005455 Bacteria 1292
40 Ga0070663_100530242 3300005455 Bacteria 981
41 Ga0070678_101855013 3300005456 Bacteria 569
42 Ga0070662_100200894 3300005457 Bacteria 1582
43 Ga0070707_100706652 3300005468 Bacteria 971
44 Ga0070679_100023184 3300005530 Bacteria 6074
45 Ga0070679_100458427 3300005530 Bacteria 1219
46 Ga0070679_101711204 3300005530 Bacteria 577
47 Ga0070684_100078493 3300005535 Bacteria 2917
48 Ga0070684_100400860 3300005535 Bacteria 1265
49 Ga0070684_101109083 3300005535 Bacteria 744
50 Ga0070684_101297321 3300005535 Bacteria 685
51 Ga0068853_100446073 3300005539 Bacteria 1217
52 Ga0070696_100408084 3300005546 Bacteria 1064
53 Ga0070693_100156573 3300005547 Bacteria 1447
54 Ga0070665_100084075 3300005548 Bacteria 3187
55 Ga0070665_100146238 3300005548 Bacteria 2366
56 Ga0068855_100350702 3300005563 Bacteria 1626
57 Ga0070664_100299127 3300005564 Bacteria 1454
58 Ga0070664_100605852 3300005564 Bacteria 1016
59 Ga0070664_101621215 3300005564 Bacteria 613
60 Ga0070664_101780202 3300005564 Bacteria 584
61 Ga0068857_100202465 3300005577 Bacteria 1810
62 Ga0068856_100050482 3300005614 Bacteria 4101
63 Ga0070702_100345364 3300005615 Bacteria 1046
64 Ga0068852_101101123 3300005616 Bacteria 814
65 Ga0068864_100524719 3300005618 Bacteria 1142
66 Ga0068864_100560129 3300005618 Bacteria 1106
67 Ga0068858_100166775 3300005842 Bacteria 2076
68 Ga0068858_100286345 3300005842 Bacteria 1570
69 Ga0068858_100480415 3300005842 Bacteria 1199
70 Ga0081540_1003881 3300005983 Bacteria 11651
71 Ga0081540_1043218 3300005983 Bacteria 2315
72 Ga0081539_10002294 3300005985 Bacteria 27712
73 Ga0070717_10000676 3300006028 Bacteria 21973
74 Ga0070717_10042113 3300006028 Bacteria 3724
75 Ga0070717_10353301 3300006028 Bacteria 1314
76 Ga0070717_10480221 3300006028 Bacteria 1122
77 Ga0075365_10035412 3300006038 Bacteria 3229
78 Ga0075365_10114918 3300006038 Bacteria 1852
79 Ga0075368_10043115 3300006042 Bacteria 1777
80 Ga0075364_10109692 3300006051 Bacteria 1840
81 Ga0070715_10905178 3300006163 Bacteria 543
82 Ga0070716_100091818 3300006173 Bacteria 1839
83 Ga0070716_100600095 3300006173 Bacteria 828
84 Ga0070712_100201299 3300006175 Bacteria 1564
85 Ga0070712_101296313 3300006175 Bacteria 635
86 Ga0075367_10122921 3300006178 Bacteria 1600
87 Ga0075367_10339215 3300006178 Bacteria 948
88 Ga0075369_10113128 3300006186 Bacteria 1224
89 Ga0075369_10192722 3300006186 Bacteria 939
90 Ga0075366_10030959 3300006195 Bacteria 3147
91 Ga0097621_100258476 3300006237 Bacteria 1527
92 Ga0075370_10022209 3300006353 Bacteria 3482
93 Ga0075370_10061098 3300006353 Bacteria 2147
94 Ga0068871_100326379 3300006358 Bacteria 1353
95 Ga0068871_100455149 3300006358 Bacteria 1148
96 Ga0075434_100042126 3300006871 Bacteria 4526
97 Ga0099824_1021533 3300006942 Bacteria 4473
98 Ga0099823_1044816 3300006944 Bacteria 2981
99 Ga0075435_100106328 3300007076 Bacteria 2330
100 Ga0099794_10083744 3300007265 Bacteria 1576
101 Ga0099794_10125309 3300007265 Bacteria 1295
102 Ga0099795_10223070 3300007788 Bacteria 803
103 Ga0105240_10041109 3300009093 Bacteria 5905
104 Ga0105240_10117017 3300009093 Bacteria 3215
105 Ga0105240_12155304 3300009093 Bacteria 578
106 Ga0105245_10544358 3300009098 Bacteria 1182
107 Ga0105245_10851798 3300009098 Bacteria 951
108 Ga0105245_11378409 3300009098 Bacteria 755
109 Ga0105243_10093056 3300009148 Bacteria 2487
110 Ga0105243_10782311 3300009148 Bacteria 939
111 Ga0105241_10149816 3300009174 Bacteria 1908
112 Ga0105241_10675511 3300009174 Bacteria 940
113 Ga0105248_10225033 3300009177 Bacteria 2112
114 Ga0105248_12325051 3300009177 Bacteria 610
115 Ga0105237_10072073 3300009545 Bacteria 3449
116 Ga0105237_10288542 3300009545 Bacteria 1644
117 Ga0105237_10442758 3300009545 Bacteria 1305
118 Ga0105237_10542471 3300009545 Bacteria 1170
119 Ga0105238_10120004 3300009551 Bacteria 2609
120 Ga0105238_10530093 3300009551 Bacteria 1181
121 Ga0105238_11724297 3300009551 Bacteria 658
122 Ga0105249_10421569 3300009553 Bacteria 1368
123 Ga0105249_11274311 3300009553 Bacteria 806
124 Ga0105239_10165623 3300010375 Bacteria 2471
125 Ga0105239_10184367 3300010375 Bacteria 2335
126 Ga0105239_10209694 3300010375 Bacteria 2184
127 Ga0105239_10686841 3300010375 Bacteria 1170
128 Ga0105246_10079509 3300011119 Bacteria 2332
129 Ga0157339_1052946 3300012505 Bacteria 543
130 Ga0157370_10196521 3300013104 Bacteria 1872
131 Ga0157369_10577312 3300013105 Bacteria 1161
132 Ga0157378_10827088 3300013297 Bacteria 953
133 Ga0163162_10153868 3300013306 Bacteria 2418
134 Ga0163162_10437216 3300013306 Bacteria 1440
135 Ga0157375_10224578 3300013308 Bacteria 2037
136 Ga0157375_10245617 3300013308 Bacteria 1950
137 Ga0157375_10613130 3300013308 Bacteria 1247
138 Ga0163163_10013018 3300014325 Bacteria 7598
139 Ga0163163_10301689 3300014325 Bacteria 1654
140 Ga0163163_10824003 3300014325 Bacteria 991
141 Ga0157380_10873783 3300014326 Bacteria 923
142 Ga0182008_10327346 3300014497 Bacteria 808
143 Ga0182008_10661893 3300014497 Bacteria 592
144 Ga0157379_10464718 3300014968 Bacteria 1170
145 Ga0163161_10908332 3300017792 Bacteria 746
146 Ga0163161_11353919 3300017792 Bacteria 620
147 Ga0214544_1000007 3300021320 Bacteria 379989
148 Ga0214542_1000007 3300021321 Bacteria 291816
149 Ga0214542_1030436 3300021321 Bacteria 2101
150 Ga0214545_1000006 3300021324 Bacteria 291693
151 Ga0214545_1024842 3300021324 Bacteria 3597
152 Ga0214543_1000009 3300021327 Bacteria 384302
153 Ga0207425_1018154 3300025245 Bacteria 1532
154 Ga0209233_1040851 3300025261 Bacteria 1006
155 Ga0209564_1006671 3300025295 Bacteria 6152
156 Ga0209564_1014286 3300025295 Bacteria 3313
157 Ga0209758_1000015 3300025297 Bacteria 851943
158 Ga0209758_1000161 3300025297 Bacteria 154278
159 Ga0209758_1000673 3300025297 Bacteria 51032
160 Ga0209758_1001304 3300025297 Bacteria 30476
161 Ga0209758_1056532 3300025297 Bacteria 1325
162 Ga0209758_1085508 3300025297 Bacteria 939
163 Ga0209758_1133920 3300025297 Bacteria 651
164 Ga0209256_1004503 3300025299 Bacteria 8706
165 Ga0209256_1079282 3300025299 Bacteria 721
166 Ga0207426_1000186 3300025302 Bacteria 154130
167 Ga0207426_1001117 3300025302 Bacteria 24608
168 Ga0207426_1006768 3300025302 Bacteria 4910
169 Ga0207426_1022032 3300025302 Bacteria 2193
170 Ga0209257_1004161 3300025304 Bacteria 11487
171 Ga0209257_1008991 3300025304 Bacteria 5484
172 Ga0209257_1091835 3300025304 Bacteria 757
173 Ga0207697_10058944 3300025315 Bacteria 1595
174 Ga0207656_10351819 3300025321 Bacteria 735
175 Ga0207692_10219891 3300025898 Bacteria 1125
176 Ga0207710_10030298 3300025900 Bacteria 2360
177 Ga0207710_10351062 3300025900 Bacteria 751
178 Ga0207710_10587907 3300025900 Bacteria 581
179 Ga0207680_10246481 3300025903 Bacteria 1233
180 Ga0207647_10039349 3300025904 Bacteria 2984
181 Ga0207699_10044623 3300025906 Bacteria 2581
182 Ga0207699_10155386 3300025906 Bacteria 1518
183 Ga0207645_10129888 3300025907 Bacteria 1639
184 Ga0207705_10341179 3300025909 Bacteria 1153
185 Ga0207695_10367029 3300025913 Bacteria 1326
186 Ga0207671_10052014 3300025914 Bacteria 3035
187 Ga0207671_10520853 3300025914 Bacteria 948
188 Ga0207693_10005524 3300025915 Bacteria 10524
189 Ga0207693_10082082 3300025915 Bacteria 2524
190 Ga0207663_10007792 3300025916 Bacteria 5579
191 Ga0207663_10084693 3300025916 Bacteria 2085
192 Ga0207657_10086653 3300025919 Bacteria 2621
193 Ga0207652_10057479 3300025921 Bacteria 3350
194 Ga0207652_10981662 3300025921 Bacteria 743
195 Ga0207681_11274571 3300025923 Bacteria 617
196 Ga0207694_10149145 3300025924 Bacteria 1883
197 Ga0207694_10328510 3300025924 Bacteria 1263
198 Ga0207659_10785910 3300025926 Bacteria 817
199 Ga0207687_10901058 3300025927 Bacteria 757
200 Ga0207700_10040357 3300025928 Bacteria 3406
201 Ga0207700_10050981 3300025928 Bacteria 3086
202 Ga0207700_10202223 3300025928 Bacteria 1675
203 Ga0207700_10436695 3300025928 Bacteria 1152
204 Ga0207664_10108933 3300025929 Bacteria 2301
205 Ga0207644_10335954 3300025931 Bacteria 1224
206 Ga0207644_10344602 3300025931 Bacteria 1209
207 Ga0207644_11026343 3300025931 Bacteria 692
208 Ga0207690_10108033 3300025932 Bacteria 1999
209 Ga0207690_10245816 3300025932 Bacteria 1380
210 Ga0207706_10079551 3300025933 Bacteria 2882
211 Ga0207709_10075986 3300025935 Bacteria 2149
212 Ga0207709_10384737 3300025935 Bacteria 1068
213 Ga0207665_10030788 3300025939 Bacteria 3548
214 Ga0207665_10366596 3300025939 Bacteria 1090
215 Ga0207665_10763469 3300025939 Bacteria 763
216 Ga0207665_10915883 3300025939 Bacteria 696
217 Ga0207661_10000920 3300025944 Bacteria 19332
218 Ga0207661_10319884 3300025944 Bacteria 1395
219 Ga0207667_10225432 3300025949 Bacteria 1920
220 Ga0207651_10617313 3300025960 Bacteria 949
221 Ga0207668_10263536 3300025972 Bacteria 1405
222 Ga0207640_10820491 3300025981 Bacteria 807
223 Ga0207658_10305221 3300025986 Bacteria 1373
224 Ga0207703_10435153 3300026035 Bacteria 1223
225 Ga0207639_10436540 3300026041 Bacteria 1186
226 Ga0207678_10019372 3300026067 Bacteria 5978
227 Ga0207678_10243227 3300026067 Bacteria 1541
228 Ga0207678_10723933 3300026067 Bacteria 876
229 Ga0207702_10380019 3300026078 Bacteria 1358
230 Ga0207641_11228389 3300026088 Bacteria 749
231 Ga0207648_10382452 3300026089 Bacteria 1273
232 Ga0207676_10265981 3300026095 Bacteria 1551
233 Ga0207676_10294976 3300026095 Bacteria 1478
234 Ga0207676_10871711 3300026095 Bacteria 881
235 Ga0207674_10474894 3300026116 Bacteria 1209
236 Ga0207683_11016579 3300026121 Bacteria 769
237 Ga0209389_1000062 3300027296 Bacteria 102842
238 Ga0209389_1000440 3300027296 Bacteria 24698
239 Ga0209589_1014238 3300027357 Bacteria 10051
240 Ga0209489_100160 3300027361 Bacteria 102842
241 Ga0209489_104739 3300027361 Bacteria 24698
242 Ga0209700_102603 3300027363 Bacteria 36098
243 Ga0268266_10161611 3300028379 Bacteria 2027
244 Ga0268266_10471328 3300028379 Bacteria 1196
245 Ga0268264_10000051 3300028381 Bacteria 321565
246 Ga0268264_10941516 3300028381 Bacteria 869
247 Ga0307516_10137534 3300031730 Bacteria 2215
248 Ga0307415_100383962 3300032126 Bacteria 1194
249 Ga0316215_1009722 3300033544 Bacteria 948
250 Ga0373923_0131956 3300035111 Bacteria 1123
251 Ga0373946_0123916 3300035171 Bacteria 1182
252 Ga0373955_0001347 3300035172 Bacteria 10434
253 Ga0373931_0892369 3300035691 Bacteria 597
254 Ga0373935_0102679 3300035692 Bacteria 1887
255 Ga0373927_0019698 3300035695 Bacteria 4424
256 Ga0373927_0055877 3300035695 Bacteria 2552
257 Ga0373947_0095911 3300035725 Bacteria 1856
258 Ga0372808_005702 3300036459 Bacteria 1652
259 Ga0373925_0017912 3300037068 Bacteria 5142
260 Ga0373925_0219257 3300037068 Bacteria 1518
261 Ga0373925_1129164 3300037068 Bacteria 645
262 Ga0395899_0036461 3300037312 Bacteria 3689
263 Ga0395900_0001763 3300037418 Bacteria 24844
264 Ga0395900_0418049 3300037418 Bacteria 1302
265 Ga0395905_0001866 3300037471 Bacteria 24263
266 Ga0395905_0971736 3300037471 Bacteria 752
267 Ga0436364_1036798 3300037853 Bacteria 716
268 Ga0395901_0026318 3300038443 Bacteria 5973
269 Ga0395901_0169575 3300038443 Bacteria 2290
270 Ga0436365_1388237 3300039437 Bacteria 1154
271 Ga0436360_0446467 3300039438 Bacteria 1989
272 Ga0436360_0485190 3300039438 Bacteria 1704
273 Ga0436360_1196032 3300039438 Bacteria 1278
274 Ga0436360_1317105 3300039438 Bacteria 622
275 Ga0436361_0333264 3300039447 Bacteria 1807
276 Ga0436363_1308626 3300039450 Bacteria 4801
277 Ga0451793_1750901 3300041452 Bacteria 758
278 Ga0451795_1247655 3300041456 Bacteria 945
279 Ga0451800_1340289 3300041459 Bacteria 1310
280 Ga0451802_0817623 3300041460 Bacteria 1482
281 Ga0451804_0868802 3300041463 Bacteria 647
282 Ga0451807_1880128 3300041486 Bacteria 1477
283 Ga0451835_0930080 3300041492 Bacteria 817
284 Ga0451839_1302708 3300041496 Bacteria 753
285 Ga0451841_0439065 3300041498 Bacteria 645
286 Ga0451845_0394178 3300041501 Bacteria 507
287 Ga0451849_0789152 3300041505 Bacteria 1624
288 Ga0466972_0000136 3300044658 Bacteria 60410
289 Ga0466972_0005603 3300044658 Bacteria 6291
290 Ga0466965_0023854 3300044683 Bacteria 2956
291 Ga0466965_0106445 3300044683 Bacteria 1438
292 Ga0466966_0168226 3300044684 Bacteria 1333
293 Ga0466966_0680841 3300044684 Bacteria 620
294 Ga0466961_0000324 3300044693 Bacteria 31518
295 Ga0466961_0033314 3300044693 Bacteria 3311
296 Ga0466964_0112345 3300044706 Bacteria 1217
297 Ga0466968_0010844 3300044735 Bacteria 3541
298 Ga0466968_0087573 3300044735 Bacteria 1376
299 Ga0466968_0100775 3300044735 Bacteria 1289
300 Ga0466968_0658278 3300044735 Bacteria 532
301 Ga0466970_0159692 3300044765 Bacteria 1246
302 Ga0466957_0107227 3300044842 Bacteria 1768
303 Ga0466960_0008953 3300044901 Bacteria 4115
304 Ga0466960_0081677 3300044901 Bacteria 1630
305 Ga0466959_0006988 3300045049 Bacteria 7888
306 Ga0466959_0162773 3300045049 Bacteria 1568
307 Ga0466967_0026340 3300045976 Bacteria 4815
308 Ga0466967_0191905 3300045976 Bacteria 1931
309 Ga0466967_0293821 3300045976 Bacteria 1562
310 Ga0495603_0019598 3300046455 Bacteria 4095
311 Ga0495603_0053295 3300046455 Bacteria 2400
312 Ga0495653_0031682 3300046463 Bacteria 4201
313 Ga0495580_0641631 3300046472 Bacteria 699
314 Ga0495582_0251713 3300046473 Bacteria 1013
315 Ga0495605_0039213 3300046474 Bacteria 2374
316 Ga0495605_0233802 3300046474 Bacteria 791
317 Ga0495639_0047166 3300046475 Bacteria 1951
318 Ga0495639_0089062 3300046475 Bacteria 1446
319 Ga0495585_0458713 3300046492 Bacteria 609
320 Ga0495594_0247199 3300046499 Bacteria 1016
321 Ga0495594_0458531 3300046499 Bacteria 724
322 Ga0495607_0245529 3300046501 Bacteria 864
323 Ga0495606_0068369 3300046507 Bacteria 2248
324 Ga0495606_0264045 3300046507 Bacteria 949
325 Ga0495606_0313508 3300046507 Bacteria 845
326 Ga0495606_0319004 3300046507 Bacteria 836
327 Ga0495606_0329354 3300046507 Bacteria 817
328 Ga0495606_0533118 3300046507 Bacteria 587
329 Ga0495606_0539299 3300046507 Bacteria 582
330 Ga0495610_0148097 3300046512 Bacteria 1004
331 Ga0495610_0254210 3300046512 Bacteria 695
332 Ga0495616_0143121 3300046513 Bacteria 1087
333 Ga0495620_0151819 3300046515 Bacteria 903
334 Ga0495630_0818678 3300046517 Bacteria 711
335 Ga0495631_0117687 3300046518 Bacteria 1143
336 Ga0495631_0131158 3300046518 Bacteria 1077
337 Ga0495643_0091968 3300046522 Bacteria 1564
338 Ga0495648_0267692 3300046524 Bacteria 816
339 Ga0495663_0112114 3300046525 Bacteria 907
340 Ga0495652_0099577 3300046529 Bacteria 2360
341 Ga0495654_0327253 3300046530 Bacteria 620
342 Ga0495587_0074571 3300046536 Bacteria 1970
343 Ga0495622_0046636 3300046557 Bacteria 2013
344 Ga0495668_0119826 3300046616 Bacteria 1439
345 Ga0495625_0350250 3300046660 Bacteria 934
346 Ga0495661_0175022 3300046665 Bacteria 1141
347 Ga0495588_0002090 3300046674 Bacteria 8563
348 Ga0495657_0699046 3300046675 Bacteria 583
349 Ga0495599_0072682 3300046678 Bacteria 2147
350 Ga0495669_0091079 3300046684 Bacteria 1408
351 Ga0495624_0342776 3300046690 Bacteria 899
352 Ga0495624_0794571 3300046690 Bacteria 559
353 Ga0495670_0518164 3300046691 Bacteria 648
354 Ga0495670_0617559 3300046691 Bacteria 591
355 Ga0495649_0334194 3300046694 Bacteria 767
356 Ga0495636_0358732 3300047318 Bacteria 689
357 Ga0495674_0176915 3300047319 Bacteria 1778
358 Ga0495674_0367813 3300047319 Bacteria 1165
359 Ga0495676_0129035 3300047321 Bacteria 1828
360 Ga0495676_0228195 3300047321 Bacteria 1280
361 Ga0495683_0021070 3300047323 Bacteria 3360
362 Ga0495683_0209413 3300047323 Bacteria 875
363 Ga0495687_013995 3300047443 Bacteria 4152
364 Ga0495675_0856879 3300047444 Bacteria 500
365 Ga0495673_0093175 3300047469 Bacteria 1228
366 Ga0495686_0222122 3300047472 Bacteria 1074
367 Ga0495602_0472895 3300048088 Bacteria 881
368 Ga0495614_0144966 3300048089 Bacteria 1057
369 Ga0496100_0079574 3300048903 Bacteria 2209
370 Ga0496100_0431792 3300048903 Bacteria 1007
371 Ga0496101_0056176 3300048904 Bacteria 2846
372 Ga0496101_0101224 3300048904 Bacteria 2157
373 Ga0496101_0245145 3300048904 Bacteria 1395
374 Ga0496101_0323536 3300048904 Bacteria 1210
375 Ga0496102_0010925 3300048905 Bacteria 7821
376 Ga0496102_0810307 3300048905 Bacteria 859
377 Ga0496102_1781593 3300048905 Bacteria 533
378 Ga0496103_0022447 3300048906 Bacteria 3800
379 Ga0496104_0007603 3300048907 Bacteria 9595
380 Ga0496104_0013985 3300048907 Bacteria 7240
381 Ga0496104_0121739 3300048907 Bacteria 2505
382 Ga0496104_1590419 3300048907 Bacteria 556
383 Ga0496105_0023309 3300048908 Bacteria 5018
384 Ga0496105_0234515 3300048908 Bacteria 1490
385 Ga0496106_0052434 3300048909 Bacteria 3078
386 Ga0496106_0060199 3300048909 Bacteria 2878
387 Ga0496106_0198664 3300048909 Bacteria 1595
388 Ga0496107_0022524 3300048910 Bacteria 4452
389 Ga0496107_0518743 3300048910 Bacteria 883
390 Ga0496108_0032197 3300048911 Bacteria 4354
391 Ga0496108_0141849 3300048911 Bacteria 2070
392 Ga0496108_0180913 3300048911 Bacteria 1826
393 Ga0496108_0411636 3300048911 Bacteria 1181
394 Ga0496109_0020157 3300048912 Bacteria 5891
395 Ga0496110_0024772 3300048913 Bacteria 5119
396 Ga0496110_0113485 3300048913 Bacteria 2437
397 Ga0496110_0249025 3300048913 Bacteria 1617
398 Ga0496110_0405057 3300048913 Bacteria 1243
399 Ga0496111_0142490 3300048914 Bacteria 1776
400 Ga0496111_0154208 3300048914 Bacteria 1704
401 Ga0496111_0300510 3300048914 Bacteria 1190
402 Ga0496112_0008050 3300048915 Bacteria 9407
403 Ga0496112_0036659 3300048915 Bacteria 4784
404 Ga0496112_0221400 3300048915 Bacteria 1848
405 Ga0496113_0005228 3300048916 Bacteria 8079
406 Ga0496115_0321959 3300048918 Bacteria 1264
407 Ga0496115_0323628 3300048918 Bacteria 1261
408 Ga0496115_0835609 3300048918 Bacteria 714
409 Ga0496117_0207237 3300048920 Bacteria 1102
410 Ga0496118_0077877 3300048921 Bacteria 2349
411 Ga0496118_0324170 3300048921 Bacteria 834
412 Ga0496119_0038359 3300048922 Bacteria 3097
413 Ga0496120_0445160 3300048923 Bacteria 565
414 Ga0496121_0800766 3300048924 Bacteria 554
415 Ga0496123_0069530 3300048926 Bacteria 2210
416 Ga0496126_0010610 3300048929 Bacteria 9633
417 Ga0496126_0012871 3300048929 Bacteria 8547
418 Ga0496126_0028469 3300048929 Bacteria 5324
419 Ga0496126_0179760 3300048929 Bacteria 1797
420 Ga0501067_0034209 3300049583 Bacteria 2820
421 nmdc:mga03n38_21490_c1 3300050490 Bacteria 2597
422 nmdc:mga03n38_589143_c1 3300050490 Bacteria 632
423 nmdc:mga0yw44_296000_c1 3300050492 Bacteria 1084
424 nmdc:mga0k408_42972_c1 3300050493 Bacteria 2603
425 nmdc:mga06z11_242238_c1 3300050494 Bacteria 1059
426 nmdc:mga06z11_293817_c1 3300050494 Bacteria 965
427 nmdc:mga04h51_13837_c1 3300050495 Bacteria 2294
428 nmdc:mga07m45_27883_c1 3300050496 Bacteria 3115
429 nmdc:mga0n895_24136_c1 3300050512 Bacteria 5727
430 nmdc:mga0n895_365343_c1 3300050512 Bacteria 1461
431 nmdc:mga0rr50_164852_c1 3300050513 Bacteria 1801
432 nmdc:mga0sz30_11997_c1 3300050516 Bacteria 3363
433 nmdc:mga0sz30_282498_c1 3300050516 Bacteria 740
434 nmdc:mga0sz30_39125_c1 3300050516 Bacteria 1989
435 Ga0495601_0063451 3300053077 Bacteria 2348
436 Ga0495601_0666960 3300053077 Bacteria 665
437 Ga0495612_0060551 3300053078 Bacteria 1567
438 Ga0495655_0015082 3300053083 Bacteria 1635
439 Ga0500647_0273768 3300053091 Bacteria 732
440 Ga0500651_0068671 3300053093 Bacteria 2207
441 Ga0500557_000165 3300053105 Bacteria 14520
442 Ga0500597_098477 3300053120 Bacteria 1271
443 Ga0500642_0000053 3300053130 Bacteria 71632
444 Ga0500559_0024632 3300053136 Bacteria 2561
445 Ga0500564_224790 3300053138 Bacteria 757
446 Ga0500573_0107795 3300053140 Bacteria 1561
447 Ga0500590_038521 3300053148 Bacteria 2467
448 Ga0500634_0166542 3300053161 Bacteria 1010
449 Ga0500625_022126 3300053729 Bacteria 3002
450 Ga0500596_005917 3300053735 Bacteria 2109
451 2507504568 2507262055 Bacteria 8048963
452 2508545992 2508501009 Bacteria 7784016
453 2508694842 2508501042 Bacteria 8719808
454 2513628427 2513237092 Bacteria 8341956
455 2513649334 2513237095 Bacteria 8976980
456 2513674168 2513237098 Bacteria 9902361
457 2513699361 2513237102 Bacteria 7703324
458 2513875544 2513237139 Bacteria 8737671
459 2513890621 2513237141 Bacteria 8496279
460 2514011069 2513237161 Bacteria 8871253
461 2515624226 2515154112 Bacteria 8294334
462 2517102945 2517093001 Bacteria 9002274
463 2524438747 2524023205 Bacteria 8918781
464 2524469540 2524023210 Bacteria 9029266
465 2528854469 2528768022 Bacteria 10457665
466 2617347612 2617270735 Bacteria 9163226
467 2617376979 2617270741 Bacteria 8201522
468 2745080442 2744054633 Bacteria 8678936
469 2793063592 2791355196 Bacteria 7323613
470 2805921101 2802429603 Bacteria 8777136
471 2818240724 2816332527 Bacteria 8933356
472 2824606373 2824600985 Bacteria 8488197
473 2824612159 2824609381 Bacteria 8672835
474 2824619520 2824617872 Bacteria 8814715
475 2824627975 2824626560 Bacteria 8813858
476 2824635981 2824635225 Bacteria 8785348
477 2824646267 2824644064 Bacteria 8743947
478 2824658489 2824653114 Bacteria 8493680
479 2824669862 2824661429 Bacteria 9877870
480 2824677711 2824671348 Bacteria 8369588
481 2824686972 2824679649 Bacteria 8248951
482 2824694073 2824687955 Bacteria 8360029
483 2824703316 2824696289 Bacteria 8335049
484 2824719753 2824714736 Bacteria 8717648
485 2824727577 2824723954 Bacteria 8758240
486 2824736885 2824732956 Bacteria 7810675
487 2824747612 2824746037 Bacteria 7911610
488 2824777046 2824773399 Bacteria 8360218
489 2838129205 2838122688 Bacteria 8803140
490 2841944156 2841941048 Bacteria 8688029
491 2841954658 2841949485 Bacteria 8680857
492 2841963087 2841957949 Bacteria 8652217
493 2841968949 2841966195 Bacteria 8673214
494 2841979677 2841974524 Bacteria 8931498
495 2841989681 2841983080 Bacteria 8395090
496 2842044195 2842038055 Bacteria 8002051
497 2842051816 2842045827 Bacteria 8006841
498 2847931842 2847930680 Bacteria 9342022
499 2847941443 2847939898 Bacteria 8606328
500 2849082380 2849076700 Bacteria 7039503
501 2857514936 2857509624 Bacteria 7472071
502 2874595488 2874590934 Bacteria 8299676
503 2874607066 2874604998 Bacteria 7834745
504 2874620048 2874612657 Bacteria 8252029
505 2874621533 2874620515 Bacteria 8290088
506 2874629474 2874628541 Bacteria 8630250
507 2874651916 2874645413 Bacteria 8214782
508 2876775682 2876771140 Bacteria 8287509
509 2876823674 2876818435 Bacteria 8274608
510 2879079773 2879074833 Bacteria 8279565
511 2879091248 2879083081 Bacteria 8587928
512 2879103097 2879099564 Bacteria 10442239
513 2879133823 2879127579 Bacteria 8294491
514 2879144533 2879142872 Bacteria 8267021
515 2881369785 2881364244 Bacteria 7710352
516 2881670338 2881665667 Bacteria 8175609
517 2885368284 2885366525 Bacteria 8326213
518 2885391835 2885383462 Bacteria 9473874
519 2885415036 2885409591 Bacteria 9235467
520 2888380308 2888378607 Bacteria 9652610
521 2888427136 2888419890 Bacteria 7857137
522 2903773515 2903768456 Bacteria 9749579
523 2904668202 2904666416 Bacteria 8226587
524 2906647871 2906643746 Bacteria 8722424
525 2908782884 2908775508 Bacteria 8092255
526 2922364736 2922361189 Bacteria 7436256
527 2922369858
528 2922398737 2922393267 Bacteria 8285685
529 2929622801 2929615660 Bacteria 9193770
530 2929632095 2929624759 Bacteria 9339455
531 2932789891 2932784394 Bacteria 9704911
532 2932815434 2932809354 Bacteria 9135765
533 2932825127 2932818245 Bacteria 9955613
534 2932829253 2932828146 Bacteria 9745859
535 2933584567 2933577622 Bacteria 9116884
536 2935614238 2935608549 Bacteria 8203142
537 2935617728 2935616580 Bacteria 9032984
538 2935643773 2935638405 Bacteria 10015038
539 2935651396 2935648319 Bacteria 8801166
540 2935659836 2935656913 Bacteria 8965014
541 2935670917 2935665750 Bacteria 9571747
542 2935681557 2935675223 Bacteria 9928132
543 2935692537 2935684952 Bacteria 9590419
544 2935699231 2935694250 Bacteria 9291695
545 2935710055 2935703347 Bacteria 10242284
546 2935721155 2935713505 Bacteria 9608509
547 2935730852 2935722832 Bacteria 9608746
548 2935739844 2935732158 Bacteria 9706831
549 2935748882 2935741537 Bacteria 9707219
550 2935758752 2935750917 Bacteria 9590372
551 2935767815 2935760218 Bacteria 9817913
552 2935806781 2935801545 Bacteria 9301974
553 2935817944 2935810662 Bacteria 9401221
554 2935826489 2935819856 Bacteria 8261050
555 2935834458 2935827899 Bacteria 10038562
556 2935843817 2935837841 Bacteria 9454360
557 2935851275 2935847175 Bacteria 8228321
558 2935856773 2935855204 Bacteria 9035059
559 2935868300 2935864058 Bacteria 9784707
560 2935879610 2935873716 Bacteria 9632195
561 2935913264 2935908558 Bacteria 8568796
562 2935922686 2935916978 Bacteria 9113783
563 2935930811 2935926038 Bacteria 8601059
564 2935939855 2935934488 Bacteria 8602579
565 2935946804 2935942939 Bacteria 8599779
566 2935955995 2935951376 Bacteria 8602333
567 2935966278 2935959822 Bacteria 7869783
568 2935972788 2935967501 Bacteria 8603075
569 2935982560 2935975950 Bacteria 8347125
570 2935984470 2935984226 Bacteria 8302647
571 2935997116 2935992306 Bacteria 9802711
572 2936009772 2936002035 Bacteria 9362176
573 2936014252 2936011229 Bacteria 8801034
574 2936022839 2936019824 Bacteria 8804134
575 2936030976 2936028420 Bacteria 8965941
576 2936044658 2936037263 Bacteria 9446081
577 2936049097 2936046547 Bacteria 8903709
578 2936055543 2936055302 Bacteria 8785755
579 2940564658 2940556831 Bacteria 9590747
580 3005490372 3005483717 Bacteria 7877331
581 3005510725 3005506211 Bacteria 6943378
582 3005591232 3005587118 Bacteria 7794411
583 3005595736 3005594810 Bacteria 8716512
584 8006965068 8006964411 Bacteria 8966052
585 8006995316 8006994254 Bacteria 8309700
586 8016518954 8016511872 Bacteria 9921665
587 8017057737 8017057580 Bacteria 10023680
588 8019578045 8019576017 Bacteria 10049540
589 8019596101 8019586578 Bacteria 10212056
590 8019605617 8019597564 Bacteria 10041141
591 8019638520 8019629233 Bacteria 8687553
592 8019653366 8019648815 Bacteria 10014479
593 8019666354 8019659431 Bacteria 8577854
594 8019675963 8019668869 Bacteria 8791617
595 8055750685 8055742211 Bacteria 9226248
596 8056681452 8056681323 Bacteria 8472857
597 Ga0495686_0186326
598 JGI25406J46586_10014653
599 JGI25153J46596_10003243
600 JGI25153J46596_10014093
601 JGI25153J46596_10033916
602 JGI25160J50197_1000710
603 JGI25160J50197_1003342
604 JGI25404J52841_10016797
605 Ga0055524_1047452
606 Ga0055531_10010089
607 Ga0065165_1011141
608 Ga0065165_1014445
609 Ga0065165_1020545
610 Ga0070658_10236618
611 Ga0070658_11440661
612 Ga0070683_100178879
613 Ga0068869_100110506
614 Ga0070682_100554833
615 Ga0070660_100169140
616 Ga0070660_100329791
617 Ga0070660_101849824
618 Ga0070661_100106700
619 Ga0070668_100289439
620 Ga0070669_100461963
621 Ga0070675_100547605
622 Ga0070671_100221574
623 Ga0070671_100386762
624 Ga0070671_101386826
625 Ga0070659_100390994
626 Ga0070667_100174992
627 Ga0070709_10016989
628 Ga0070713_100003270
629 Ga0070713_100062028
630 Ga0070713_101844626
631 Ga0070711_100004274
632 Ga0070711_100060687
633 Ga0070700_100564627
634 Ga0070663_100221884
635 Ga0070663_100296620
636 Ga0070663_100530242
637 Ga0070678_101855013
638 Ga0070662_100200894
639 Ga0070707_100706652
640 Ga0070679_100023184
641 Ga0070679_100458427
642 Ga0070679_101711204
643 Ga0070684_100078493
644 Ga0070684_100400860
645 Ga0070684_101109083
646 Ga0070684_101297321
647 Ga0068853_100446073
648 Ga0070696_100408084
649 Ga0070693_100156573
650 Ga0070665_100084075
651 Ga0070665_100146238
652 Ga0068855_100350702
653 Ga0070664_100299127
654 Ga0070664_100605852
655 Ga0070664_101621215
656 Ga0070664_101780202
657 Ga0068857_100202465
658 Ga0068856_100050482
659 Ga0070702_100345364
660 Ga0068852_101101123
661 Ga0068864_100524719
662 Ga0068864_100560129
663 Ga0068858_100166775
664 Ga0068858_100286345
665 Ga0068858_100480415
666 Ga0081540_1003881
667 Ga0081540_1043218
668 Ga0081539_10002294
669 Ga0070717_10000676
670 Ga0070717_10042113
671 Ga0070717_10353301
672 Ga0070717_10480221
673 Ga0075365_10035412
674 Ga0075365_10114918
675 Ga0075368_10043115
676 Ga0075364_10109692
677 Ga0070715_10905178
678 Ga0070716_100091818
679 Ga0070716_100600095
680 Ga0070712_100201299
681 Ga0070712_101296313
682 Ga0075367_10122921
683 Ga0075367_10339215
684 Ga0075369_10113128
685 Ga0075369_10192722
686 Ga0075366_10030959
687 Ga0097621_100258476
688 Ga0075370_10022209
689 Ga0075370_10061098
690 Ga0068871_100326379
691 Ga0068871_100455149
692 Ga0075434_100042126
693 Ga0099824_1021533
694 Ga0099823_1044816
695 Ga0075435_100106328
696 Ga0099794_10083744
697 Ga0099794_10125309
698 Ga0099795_10223070
699 Ga0105240_10041109
700 Ga0105240_10117017
701 Ga0105240_12155304
702 Ga0105245_10544358
703 Ga0105245_10851798
704 Ga0105245_11378409
705 Ga0105243_10093056
706 Ga0105243_10782311
707 Ga0105241_10149816
708 Ga0105241_10675511
709 Ga0105248_10225033
710 Ga0105248_12325051
711 Ga0105237_10072073
712 Ga0105237_10288542
713 Ga0105237_10442758
714 Ga0105237_10542471
715 Ga0105238_10120004
716 Ga0105238_10530093
717 Ga0105238_11724297
718 Ga0105249_10421569
719 Ga0105249_11274311
720 Ga0105239_10165623
721 Ga0105239_10184367
722 Ga0105239_10209694
723 Ga0105239_10686841
724 Ga0105246_10079509
725 Ga0157339_1052946
726 Ga0157370_10196521
727 Ga0157369_10577312
728 Ga0157378_10827088
729 Ga0163162_10153868
730 Ga0163162_10437216
731 Ga0157375_10224578
732 Ga0157375_10245617
733 Ga0157375_10613130
734 Ga0163163_10013018
735 Ga0163163_10301689
736 Ga0163163_10824003
737 Ga0157380_10873783
738 Ga0182008_10327346
739 Ga0182008_10661893
740 Ga0157379_10464718
741 Ga0163161_10908332
742 Ga0163161_11353919
743 Ga0214544_1000007
744 Ga0214542_1000007
745 Ga0214542_1030436
746 Ga0214545_1000006
747 Ga0214545_1024842
748 Ga0214543_1000009
749 Ga0207425_1018154
750 Ga0209233_1040851
751 Ga0209564_1006671
752 Ga0209564_1014286
753 Ga0209758_1000015
754 Ga0209758_1000161
755 Ga0209758_1000673
756 Ga0209758_1001304
757 Ga0209758_1056532
758 Ga0209758_1085508
759 Ga0209758_1133920
760 Ga0209256_1004503
761 Ga0209256_1079282
762 Ga0207426_1000186
763 Ga0207426_1001117
764 Ga0207426_1006768
765 Ga0207426_1022032
766 Ga0209257_1004161
767 Ga0209257_1008991
768 Ga0209257_1091835
769 Ga0207697_10058944
770 Ga0207656_10351819
771 Ga0207692_10219891
772 Ga0207710_10030298
773 Ga0207710_10351062
774 Ga0207710_10587907
775 Ga0207680_10246481
776 Ga0207647_10039349
777 Ga0207699_10044623
778 Ga0207699_10155386
779 Ga0207645_10129888
780 Ga0207705_10341179
781 Ga0207695_10367029
782 Ga0207671_10052014
783 Ga0207671_10520853
784 Ga0207693_10005524
785 Ga0207693_10082082
786 Ga0207663_10007792
787 Ga0207663_10084693
788 Ga0207657_10086653
789 Ga0207652_10057479
790 Ga0207652_10981662
791 Ga0207681_11274571
792 Ga0207694_10149145
793 Ga0207694_10328510
794 Ga0207659_10785910
795 Ga0207687_10901058
796 Ga0207700_10040357
797 Ga0207700_10050981
798 Ga0207700_10202223
799 Ga0207700_10436695
800 Ga0207664_10108933
801 Ga0207644_10335954
802 Ga0207644_10344602
803 Ga0207644_11026343
804 Ga0207690_10108033
805 Ga0207690_10245816
806 Ga0207706_10079551
807 Ga0207709_10075986
808 Ga0207709_10384737
809 Ga0207665_10030788
810 Ga0207665_10366596
811 Ga0207665_10763469
812 Ga0207665_10915883
813 Ga0207661_10000920
814 Ga0207661_10319884
815 Ga0207667_10225432
816 Ga0207651_10617313
817 Ga0207668_10263536
818 Ga0207640_10820491
819 Ga0207658_10305221
820 Ga0207703_10435153
821 Ga0207639_10436540
822 Ga0207678_10019372
823 Ga0207678_10243227
824 Ga0207678_10723933
825 Ga0207702_10380019
826 Ga0207641_11228389
827 Ga0207648_10382452
828 Ga0207676_10265981
829 Ga0207676_10294976
830 Ga0207676_10871711
831 Ga0207674_10474894
832 Ga0207683_11016579
833 Ga0209389_1000062
834 Ga0209389_1000440
835 Ga0209589_1014238
836 Ga0209489_100160
837 Ga0209489_104739
838 Ga0209700_102603
839 Ga0268266_10161611
840 Ga0268266_10471328
841 Ga0268264_10000051
842 Ga0268264_10941516
843 Ga0307516_10137534
844 Ga0307415_100383962
845 Ga0316215_1009722
846 Ga0373923_0131956
847 Ga0373946_0123916
848 Ga0373955_0001347
849 Ga0373931_0892369
850 Ga0373935_0102679
851 Ga0373927_0019698
852 Ga0373927_0055877
853 Ga0373947_0095911
854 Ga0372808_005702
855 Ga0373925_0017912
856 Ga0373925_0219257
857 Ga0373925_1129164
858 Ga0395899_0036461
859 Ga0395900_0001763
860 Ga0395900_0418049
861 Ga0395905_0001866
862 Ga0395905_0971736
863 Ga0436364_1036798
864 Ga0395901_0026318
865 Ga0395901_0169575
866 Ga0436365_1388237
867 Ga0436360_0446467
868 Ga0436360_0485190
869 Ga0436360_1196032
870 Ga0436360_1317105
871 Ga0436361_0333264
872 Ga0436363_1308626
873 Ga0451793_1750901
874 Ga0451795_1247655
875 Ga0451800_1340289
876 Ga0451802_0817623
877 Ga0451804_0868802
878 Ga0451807_1880128
879 Ga0451835_0930080
880 Ga0451839_1302708
881 Ga0451841_0439065
882 Ga0451845_0394178
883 Ga0451849_0789152
884 Ga0466972_0000136
885 Ga0466972_0005603
886 Ga0466965_0023854
887 Ga0466965_0106445
888 Ga0466966_0168226
889 Ga0466966_0680841
890 Ga0466961_0000324
891 Ga0466961_0033314
892 Ga0466964_0112345
893 Ga0466968_0010844
894 Ga0466968_0087573
895 Ga0466968_0100775
896 Ga0466968_0658278
897 Ga0466970_0159692
898 Ga0466957_0107227
899 Ga0466960_0008953
900 Ga0466960_0081677
901 Ga0466959_0006988
902 Ga0466959_0162773
903 Ga0466967_0026340
904 Ga0466967_0191905
905 Ga0466967_0293821
906 Ga0495603_0019598
907 Ga0495603_0053295
908 Ga0495653_0031682
909 Ga0495580_0641631
910 Ga0495582_0251713
911 Ga0495605_0039213
912 Ga0495605_0233802
913 Ga0495639_0047166
914 Ga0495639_0089062
915 Ga0495585_0458713
916 Ga0495594_0247199
917 Ga0495594_0458531
918 Ga0495607_0245529
919 Ga0495606_0068369
920 Ga0495606_0264045
921 Ga0495606_0313508
922 Ga0495606_0319004
923 Ga0495606_0329354
924 Ga0495606_0533118
925 Ga0495606_0539299
926 Ga0495610_0148097
927 Ga0495610_0254210
928 Ga0495616_0143121
929 Ga0495620_0151819
930 Ga0495630_0818678
931 Ga0495631_0117687
932 Ga0495631_0131158
933 Ga0495643_0091968
934 Ga0495648_0267692
935 Ga0495663_0112114
936 Ga0495652_0099577
937 Ga0495654_0327253
938 Ga0495587_0074571
939 Ga0495622_0046636
940 Ga0495668_0119826
941 Ga0495625_0350250
942 Ga0495661_0175022
943 Ga0495588_0002090
944 Ga0495657_0699046
945 Ga0495599_0072682
946 Ga0495669_0091079
947 Ga0495624_0342776
948 Ga0495624_0794571
949 Ga0495670_0518164
950 Ga0495670_0617559
951 Ga0495649_0334194
952 Ga0495636_0358732
953 Ga0495674_0176915
954 Ga0495674_0367813
955 Ga0495676_0129035
956 Ga0495676_0228195
957 Ga0495683_0021070
958 Ga0495683_0209413
959 Ga0495687_013995
960 Ga0495675_0856879
961 Ga0495673_0093175
962 Ga0495686_0222122
963 Ga0495602_0472895
964 Ga0495614_0144966
965 Ga0496100_0079574
966 Ga0496100_0431792
967 Ga0496101_0056176
968 Ga0496101_0101224
969 Ga0496101_0245145
970 Ga0496101_0323536
971 Ga0496102_0010925
972 Ga0496102_0810307
973 Ga0496102_1781593
974 Ga0496103_0022447
975 Ga0496104_0007603
976 Ga0496104_0013985
977 Ga0496104_0121739
978 Ga0496104_1590419
979 Ga0496105_0023309
980 Ga0496105_0234515
981 Ga0496106_0052434
982 Ga0496106_0060199
983 Ga0496106_0198664
984 Ga0496107_0022524
985 Ga0496107_0518743
986 Ga0496108_0032197
987 Ga0496108_0141849
988 Ga0496108_0180913
989 Ga0496108_0411636
990 Ga0496109_0020157
991 Ga0496110_0024772
992 Ga0496110_0113485
993 Ga0496110_0249025
994 Ga0496110_0405057
995 Ga0496111_0142490
996 Ga0496111_0154208
997 Ga0496111_0300510
998 Ga0496112_0008050
999 Ga0496112_0036659
1000 Ga0496112_0221400
1001 Ga0496113_0005228
1002 Ga0496115_0321959
1003 Ga0496115_0323628
1004 Ga0496115_0835609
1005 Ga0496117_0207237
1006 Ga0496118_0077877
1007 Ga0496118_0324170
1008 Ga0496119_0038359
1009 Ga0496120_0445160
1010 Ga0496121_0800766
1011 Ga0496123_0069530
1012 Ga0496126_0010610
1013 Ga0496126_0012871
1014 Ga0496126_0028469
1015 Ga0496126_0179760
1016 Ga0501067_0034209
1017 nmdc:mga03n38_21490_c1
1018 nmdc:mga03n38_589143_c1
1019 nmdc:mga0yw44_296000_c1
1020 nmdc:mga0k408_42972_c1
1021 nmdc:mga06z11_242238_c1
1022 nmdc:mga06z11_293817_c1
1023 nmdc:mga04h51_13837_c1
1024 nmdc:mga07m45_27883_c1
1025 nmdc:mga0n895_24136_c1
1026 nmdc:mga0n895_365343_c1
1027 nmdc:mga0rr50_164852_c1
1028 nmdc:mga0sz30_11997_c1
1029 nmdc:mga0sz30_282498_c1
1030 nmdc:mga0sz30_39125_c1
1031 Ga0495601_0063451
1032 Ga0495601_0666960
1033 Ga0495612_0060551
1034 Ga0495655_0015082
1035 Ga0500647_0273768
1036 Ga0500651_0068671
1037 Ga0500557_000165
1038 Ga0500597_098477
1039 Ga0500642_0000053
1040 Ga0500559_0024632
1041 Ga0500564_224790
1042 Ga0500573_0107795
1043 Ga0500590_038521
1044 Ga0500634_0166542
1045 Ga0500625_022126
1046 Ga0500596_005917
1047 2507504568
1048 2508545992
1049 2508694842
1050 2513628427
1051 2513649334
1052 2513674168
1053 2513699361
1054 2513875544
1055 2513890621
1056 2514011069
1057 2515624226
1058 2517102945
1059 2524438747
1060 2524469540
1061 2528854469
1062 2617347612
1063 2617376979
1064 2745080442
1065 2793063592
1066 2805921101
1067 2818240724
1068 2824606373
1069 2824612159
1070 2824619520
1071 2824627975
1072 2824635981
1073 2824646267
1074 2824658489
1075 2824669862
1076 2824677711
1077 2824686972
1078 2824694073
1079 2824703316
1080 2824719753
1081 2824727577
1082 2824736885
1083 2824747612
1084 2824777046
1085 2838129205
1086 2841944156
1087 2841954658
1088 2841963087
1089 2841968949
1090 2841979677
1091 2841989681
1092 2842044195
1093 2842051816
1094 2847931842
1095 2847941443
1096 2849082380
1097 2857514936
1098 2874595488
1099 2874607066
1100 2874620048
1101 2874621533
1102 2874629474
1103 2874651916
1104 2876775682
1105 2876823674
1106 2879079773
1107 2879091248
1108 2879103097
1109 2879133823
1110 2879144533
1111 2881369785
1112 2881670338
1113 2885368284
1114 2885391835
1115 2885415036
1116 2888380308
1117 2888427136
1118 2903773515
1119 2904668202
1120 2906647871
1121 2908782884
1122 2922364736
1123 2922369858
1124 2922398737
1125 2929622801
1126 2929632095
1127 2932789891
1128 2932815434
1129 2932825127
1130 2932829253
1131 2933584567
1132 2935614238
1133 2935617728
1134 2935643773
1135 2935651396
1136 2935659836
1137 2935670917
1138 2935681557
1139 2935692537
1140 2935699231
1141 2935710055
1142 2935721155
1143 2935730852
1144 2935739844
1145 2935748882
1146 2935758752
1147 2935767815
1148 2935806781
1149 2935817944
1150 2935826489
1151 2935834458
1152 2935843817
1153 2935851275
1154 2935856773
1155 2935868300
1156 2935879610
1157 2935913264
1158 2935922686
1159 2935930811
1160 2935939855
1161 2935946804
1162 2935955995
1163 2935966278
1164 2935972788
1165 2935982560
1166 2935984470
1167 2935997116
1168 2936009772
1169 2936014252
1170 2936022839
1171 2936030976
1172 2936044658
1173 2936049097
1174 2936055543
1175 2940564658
1176 3005490372
1177 3005510725
1178 3005591232
1179 3005595736
1180 8006965068
1181 8006995316
1182 8016518954
1183 8017057737
1184 8019578045
1185 8019596101
1186 8019605617
1187 8019638520
1188 8019653366
1189 8019666354
1190 8019675963
1191 8055750685
1192 8056681452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11164

DUF2948

Protein of unknown function (DUF2948)

36

171

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8shj-assembly2.cif.gz_B crystal structure of the wd-repeat domain of human wdr91 in complex with mr45279 0.8249 90 122
6vyc-assembly2.cif.gz_B crystal structure of wd-repeat domain of human wdr91 0.79 90 123
4dx9-assembly18.cif.gz_i icap1 in complex with integrin beta 1 cytoplasmic tail 0.7773 91 123
6hjm-assembly2.cif.gz_E myxococcus xanthus mglb 0.773 94 120
6hjm-assembly9.cif.gz_P myxococcus xanthus mglb 0.7658 94 120
ID Description Score Start End Superfamily
af_Q5EGY4_1_140_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.8064 93 120 3.30.450.50
af_Q4DDN8_1_121_3.30.450.50 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Longin domain 0.8 94 120 3.30.450.50
af_B4FEQ9_4_135_3.30.450.70 Alpha Beta;2-Layer Sandwich;Beta-Lactamase; 0.7857 92 120 3.30.450.70
af_C6S3C4_1_106_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.7818 95 123 3.30.450.30
af_Q54VE6_6_119_3.30.450.30 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;Dynein light chain 2a, cytoplasmic 0.78 88 120 3.30.450.30
ID Description Score Start End GO Terms
AF-A0A519NPZ5-F1-model_v4 DUF2948 family protein 0.9085 4 131
AF-A0A1F8IQ76-F1-model_v4 deleted 0.8968 22 131
AF-A0A7C4KLP2-F1-model_v4 Uncharacterized protein 0.8929 5 130
AF-A0A1W9I2Q8-F1-model_v4 DUF2948 domain-containing protein 0.8857 4 131
AF-A0A3E0QBG3-F1-model_v4 DUF2948 family protein 0.8855 9 130

Map