F467571

General Info

Members Datasets Scaffolds Average Seq Length
596 263 1192 215

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100008102|Ga0307408_1000081028
Length 250
Sequence VTPHDHAGLAPDESLDAVAPTAPALRDGDVDGGGAMPRDRASAGIVPALDPATRRLIRLSAVICAASEAAIREAMADATDGIDPVWVEELILQSYLFAGFPRALNAMREWRRISGRRAPPADEDARAESQAALWRERGERTCAVVYGPFYDALRHNIRDLHPALDAWMIVDGYGKVLARAGLDLRRRELCVVGACAAARQDRQLHSHLHGALHAGATPAEVADALHVVEDLAGPDDARRYRQLLARVVGK

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
178 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
191 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
242 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
243 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.52
Rhizosphere 97.15
Stem 0
Stem Tuber 0
Unclassified 9.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100008102 3300031548 Bacteria 6946
2 JGI24737J22298_10029355 3300001990 Bacteria 1725
3 JGI24750J21931_1003346 3300002070 Bacteria 1919
4 Ga0065707_10210518 3300005295 Bacteria 1268
5 Ga0070658_10023333 3300005327 Bacteria 4967
6 Ga0070658_10056809 3300005327 Bacteria 3182
7 Ga0070658_10380678 3300005327 Bacteria 1210
8 Ga0070658_10653978 3300005327 Bacteria 912
9 Ga0070676_10008120 3300005328 Bacteria 5647
10 Ga0070676_10081692 3300005328 Bacteria 1962
11 Ga0070676_10093313 3300005328 Bacteria 1848
12 Ga0070683_100000681 3300005329 Bacteria 24634
13 Ga0070683_100010079 3300005329 Bacteria 8106
14 Ga0070683_100022880 3300005329 Bacteria 5589
15 Ga0070683_100041535 3300005329 Bacteria 4231
16 Ga0070683_100179991 3300005329 Bacteria 2006
17 Ga0070683_100336243 3300005329 Bacteria 1438
18 Ga0070670_100171030 3300005331 Bacteria 1884
19 Ga0070670_100188933 3300005331 Bacteria 1789
20 Ga0070670_100290336 3300005331 Bacteria 1429
21 Ga0070670_100479235 3300005331 Bacteria 1105
22 Ga0068869_100000336 3300005334 Bacteria 25057
23 Ga0068869_100003185 3300005334 Bacteria 10023
24 Ga0068869_100997942 3300005334 Unclassified 729
25 Ga0070666_10113294 3300005335 Bacteria 1876
26 Ga0070666_10357363 3300005335 Bacteria 1046
27 Ga0070680_100000247 3300005336 Bacteria 35633
28 Ga0070680_100016663 3300005336 Bacteria 5787
29 Ga0070680_100050750 3300005336 Bacteria 3384
30 Ga0070680_100073293 3300005336 Bacteria 2815
31 Ga0070682_100006710 3300005337 Bacteria 6454
32 Ga0070682_100295135 3300005337 Bacteria 1187
33 Ga0068868_100037170 3300005338 Bacteria 3774
34 Ga0068868_100054291 3300005338 Bacteria 3157
35 Ga0070660_100025284 3300005339 Bacteria 4412
36 Ga0070660_100126897 3300005339 Bacteria 2039
37 Ga0070689_100003792 3300005340 Bacteria 10123
38 Ga0070689_100009066 3300005340 Bacteria 7042
39 Ga0070689_100542484 3300005340 Bacteria 1001
40 Ga0070687_100009043 3300005343 Bacteria 4249
41 Ga0070661_100005547 3300005344 Bacteria 8699
42 Ga0070661_100007742 3300005344 Bacteria 7417
43 Ga0070661_100065231 3300005344 Bacteria 2675
44 Ga0070661_100066085 3300005344 Bacteria 2657
45 Ga0070661_100117045 3300005344 Bacteria 1994
46 Ga0070692_10006391 3300005345 Bacteria 5116
47 Ga0070668_100004050 3300005347 Bacteria 10850
48 Ga0070669_100002374 3300005353 Bacteria 13618
49 Ga0070669_100017185 3300005353 Bacteria 5161
50 Ga0070669_100024551 3300005353 Bacteria 4322
51 Ga0070669_100189645 3300005353 Bacteria 1612
52 Ga0070675_100000547 3300005354 Bacteria 25799
53 Ga0070675_100010741 3300005354 Bacteria 7162
54 Ga0070675_100011278 3300005354 Bacteria 6996
55 Ga0070675_100032429 3300005354 Bacteria 4228
56 Ga0070671_100007736 3300005355 Bacteria 8584
57 Ga0070674_100072016 3300005356 Bacteria 2446
58 Ga0070674_100535292 3300005356 Unclassified 981
59 Ga0070673_100016912 3300005364 Bacteria 5172
60 Ga0070673_100029330 3300005364 Bacteria 4102
61 Ga0070673_100064374 3300005364 Bacteria 2921
62 Ga0070673_100322686 3300005364 Bacteria 1364
63 Ga0070688_100010739 3300005365 Bacteria 5059
64 Ga0070688_100026534 3300005365 Bacteria 3443
65 Ga0070659_100006929 3300005366 Bacteria 8206
66 Ga0070659_100225117 3300005366 Bacteria 1549
67 Ga0070667_100004361 3300005367 Bacteria 11938
68 Ga0070667_100024900 3300005367 Bacteria 4971
69 Ga0070667_100273902 3300005367 Bacteria 1514
70 Ga0070667_100414056 3300005367 Bacteria 1228
71 Ga0070709_10203843 3300005434 Unclassified 1402
72 Ga0070714_100073555 3300005435 Bacteria 2961
73 Ga0070701_10223408 3300005438 Bacteria 1124
74 Ga0070711_100817716 3300005439 Bacteria 791
75 Ga0070700_100101883 3300005441 Bacteria 1893
76 Ga0070694_100092001 3300005444 Bacteria 2130
77 Ga0070694_100127279 3300005444 Bacteria 1835
78 Ga0070678_100368950 3300005456 Bacteria 1239
79 Ga0070662_100010640 3300005457 Bacteria 6049
80 Ga0070662_100079870 3300005457 Bacteria 2434
81 Ga0070662_100135797 3300005457 Bacteria 1902
82 Ga0070681_10009028 3300005458 Bacteria 9800
83 Ga0070681_10150059 3300005458 Bacteria 2258
84 Ga0070681_10324247 3300005458 Bacteria 1450
85 Ga0068867_100019037 3300005459 Bacteria 4888
86 Ga0068867_100042966 3300005459 Bacteria 3308
87 Ga0068867_100143437 3300005459 Bacteria 1869
88 Ga0068867_100265492 3300005459 Bacteria 1401
89 Ga0070698_100099851 3300005471 Bacteria 2875
90 Ga0070699_100115930 3300005518 Bacteria 2354
91 Ga0070699_100200961 3300005518 Unclassified 1772
92 Ga0070679_100045506 3300005530 Bacteria 4373
93 Ga0070679_100092366 3300005530 Bacteria 3014
94 Ga0070679_100163588 3300005530 Bacteria 2199
95 Ga0070679_100189309 3300005530 Bacteria 2027
96 Ga0070679_100285648 3300005530 Bacteria 1602
97 Ga0070679_100469149 3300005530 Bacteria 1203
98 Ga0070684_100004716 3300005535 Bacteria 10413
99 Ga0070684_100006298 3300005535 Bacteria 9169
100 Ga0070684_100010020 3300005535 Bacteria 7492
101 Ga0070684_100012054 3300005535 Bacteria 6911
102 Ga0070684_100146696 3300005535 Bacteria 2136
103 Ga0070684_100319602 3300005535 Bacteria 1426
104 Ga0070684_100336089 3300005535 Unclassified 1388
105 Ga0070697_100448262 3300005536 Bacteria 1124
106 Ga0068853_100008061 3300005539 Bacteria 8448
107 Ga0068853_100024434 3300005539 Bacteria 5066
108 Ga0068853_100590022 3300005539 Bacteria 1055
109 Ga0070672_100029789 3300005543 Bacteria 4096
110 Ga0070672_100071261 3300005543 Bacteria 2764
111 Ga0070672_100098231 3300005543 Bacteria 2371
112 Ga0070672_100103354 3300005543 Bacteria 2314
113 Ga0070672_100228072 3300005543 Bacteria 1564
114 Ga0070672_100558084 3300005543 Bacteria 995
115 Ga0070686_100642005 3300005544 Bacteria 841
116 Ga0070686_100763456 3300005544 Unclassified 776
117 Ga0070695_100035292 3300005545 Bacteria 3141
118 Ga0070693_100030580 3300005547 Bacteria 2944
119 Ga0070665_100181608 3300005548 Bacteria 2105
120 Ga0068855_100059280 3300005563 Bacteria 4479
121 Ga0068855_100087932 3300005563 Bacteria 3590
122 Ga0068855_100294924 3300005563 Unclassified 1797
123 Ga0068855_100333925 3300005563 Bacteria 1673
124 Ga0070664_100005450 3300005564 Bacteria 10216
125 Ga0070664_100010643 3300005564 Bacteria 7453
126 Ga0070664_100013631 3300005564 Bacteria 6625
127 Ga0070664_100033122 3300005564 Bacteria 4325
128 Ga0070664_100100588 3300005564 Unclassified 2513
129 Ga0070664_100127605 3300005564 Bacteria 2232
130 Ga0070664_100271366 3300005564 Bacteria 1528
131 Ga0070664_100543652 3300005564 Unclassified 1074
132 Ga0068857_100003188 3300005577 Bacteria 13600
133 Ga0068857_100012828 3300005577 Bacteria 7302
134 Ga0068857_100027471 3300005577 Bacteria 5020
135 Ga0068857_100030916 3300005577 Bacteria 4731
136 Ga0068857_100078648 3300005577 Bacteria 2944
137 Ga0068854_100075120 3300005578 Bacteria 2481
138 Ga0068854_100584085 3300005578 Bacteria 952
139 Ga0068854_101185395 3300005578 Bacteria 684
140 Ga0068856_100004404 3300005614 Bacteria 14032
141 Ga0068856_100097012 3300005614 Bacteria 2937
142 Ga0068856_100143304 3300005614 Bacteria 2397
143 Ga0068856_100856444 3300005614 Unclassified 928
144 Ga0070702_100003041 3300005615 Bacteria 7420
145 Ga0070702_100157770 3300005615 Bacteria 1463
146 Ga0068852_100006303 3300005616 Bacteria 8560
147 Ga0068852_100026250 3300005616 Bacteria 4732
148 Ga0068852_100050273 3300005616 Bacteria 3571
149 Ga0068852_100055451 3300005616 Bacteria 3421
150 Ga0068852_100192660 3300005616 Bacteria 1924
151 Ga0068852_100720371 3300005616 Bacteria 1009
152 Ga0068859_100040566 3300005617 Bacteria 4672
153 Ga0068859_100132524 3300005617 Bacteria 2564
154 Ga0068859_100182395 3300005617 Bacteria 2182
155 Ga0068864_100029675 3300005618 Bacteria 4634
156 Ga0068861_100014363 3300005719 Bacteria 5557
157 Ga0068861_100031208 3300005719 Bacteria 3912
158 Ga0068861_100523339 3300005719 Bacteria 1076
159 Ga0068861_100740408 3300005719 Bacteria 917
160 Ga0068851_10003188 3300005834 Bacteria 7275
161 Ga0068870_10012379 3300005840 Bacteria 3986
162 Ga0068870_10094352 3300005840 Bacteria 1679
163 Ga0068863_100013838 3300005841 Bacteria 7776
164 Ga0068863_100178298 3300005841 Bacteria 2039
165 Ga0068863_100875417 3300005841 Bacteria 898
166 Ga0068858_100012176 3300005842 Bacteria 8110
167 Ga0068858_100082269 3300005842 Bacteria 2992
168 Ga0068858_100086564 3300005842 Bacteria 2914
169 Ga0068858_100117492 3300005842 Bacteria 2486
170 Ga0068860_100006907 3300005843 Bacteria 11382
171 Ga0068860_100014614 3300005843 Bacteria 7682
172 Ga0068860_100166983 3300005843 Bacteria 2125
173 Ga0068862_100008006 3300005844 Bacteria 8745
174 Ga0081455_10028128 3300005937 Bacteria 5139
175 Ga0081539_10012248 3300005985 Bacteria 6648
176 Ga0097621_100012625 3300006237 Bacteria 6269
177 Ga0068871_100020170 3300006358 Bacteria 5102
178 Ga0068871_100753928 3300006358 Unclassified 895
179 Ga0075428_100160807 3300006844 Bacteria 2438
180 Ga0075428_100209060 3300006844 Bacteria 2109
181 Ga0075428_100418508 3300006844 Bacteria 1436
182 Ga0075430_100016806 3300006846 Bacteria 6231
183 Ga0075430_100024856 3300006846 Bacteria 5095
184 Ga0075430_100039628 3300006846 Bacteria 3988
185 Ga0075430_100058837 3300006846 Bacteria 3231
186 Ga0075431_100031621 3300006847 Bacteria 5450
187 Ga0075431_100061920 3300006847 Bacteria 3861
188 Ga0075431_100115542 3300006847 Unclassified 2770
189 Ga0075431_100131271 3300006847 Bacteria 2583
190 Ga0075431_100264535 3300006847 Bacteria 1745
191 Ga0075431_100276052 3300006847 Bacteria 1702
192 Ga0075433_10013303 3300006852 Bacteria 6686
193 Ga0075434_100008741 3300006871 Bacteria 9423
194 Ga0075434_100365309 3300006871 Bacteria 1464
195 Ga0075429_100031032 3300006880 Unclassified 4644
196 Ga0075429_100064042 3300006880 Bacteria 3202
197 Ga0075429_100124743 3300006880 Bacteria 2252
198 Ga0068865_100009369 3300006881 Bacteria 6068
199 Ga0068865_100123076 3300006881 Bacteria 1932
200 Ga0068865_100283830 3300006881 Bacteria 1319
201 Ga0097620_100040566 3300006931 Bacteria 4672
202 Ga0097620_100132517 3300006931 Bacteria 2564
203 Ga0097620_100182391 3300006931 Bacteria 2182
204 Ga0075435_100337712 3300007076 Bacteria 1291
205 Ga0105240_10008178 3300009093 Bacteria 15002
206 Ga0105240_10289202 3300009093 Bacteria 1880
207 Ga0111539_10034268 3300009094 Bacteria 6159
208 Ga0111539_10112864 3300009094 Bacteria 3188
209 Ga0111539_10216851 3300009094 Bacteria 2229
210 Ga0111539_10264150 3300009094 Bacteria 2003
211 Ga0105245_10004762 3300009098 Bacteria 11978
212 Ga0105245_10028583 3300009098 Bacteria 4920
213 Ga0105245_10114634 3300009098 Bacteria 2510
214 Ga0114129_10039108 3300009147 Bacteria 6688
215 Ga0114129_10544237 3300009147 Unclassified 1511
216 Ga0105243_10048333 3300009148 Bacteria 3353
217 Ga0105241_10003558 3300009174 Bacteria 11587
218 Ga0105242_10016201 3300009176 Bacteria 5792
219 Ga0105242_10277538 3300009176 Bacteria 1521
220 Ga0105248_10015710 3300009177 Bacteria 8344
221 Ga0105248_10016255 3300009177 Bacteria 8190
222 Ga0105248_10047581 3300009177 Bacteria 4810
223 Ga0105248_10082569 3300009177 Bacteria 3614
224 Ga0105248_10142839 3300009177 Bacteria 2700
225 Ga0105248_10315860 3300009177 Bacteria 1760
226 Ga0105237_10638173 3300009545 Bacteria 1072
227 Ga0105238_10111041 3300009551 Bacteria 2722
228 Ga0105238_10353815 3300009551 Bacteria 1458
229 Ga0105238_10542294 3300009551 Bacteria 1167
230 Ga0105249_10000401 3300009553 Bacteria 41704
231 Ga0105249_10025142 3300009553 Bacteria 5359
232 Ga0105249_10501733 3300009553 Bacteria 1259
233 Ga0105239_10012515 3300010375 Bacteria 9450
234 Ga0105239_10025212 3300010375 Bacteria 6548
235 Ga0105246_10000533 3300011119 Bacteria 20789
236 Ga0105246_10625396 3300011119 Bacteria 934
237 Ga0157373_10044476 3300013100 Bacteria 3170
238 Ga0157373_10309231 3300013100 Bacteria 1123
239 Ga0157373_10398658 3300013100 Bacteria 986
240 Ga0157371_10020222 3300013102 Bacteria 4900
241 Ga0157370_10011107 3300013104 Bacteria 9441
242 Ga0157370_10036679 3300013104 Bacteria 4756
243 Ga0157370_10075470 3300013104 Bacteria 3178
244 Ga0157370_10315934 3300013104 Bacteria 1441
245 Ga0157369_10017079 3300013105 Bacteria 8154
246 Ga0157369_10100386 3300013105 Bacteria 3085
247 Ga0157369_10202695 3300013105 Bacteria 2082
248 Ga0157369_10231304 3300013105 Bacteria 1933
249 Ga0157374_10046567 3300013296 Bacteria 4017
250 Ga0157374_10376654 3300013296 Bacteria 1413
251 Ga0163162_10006251 3300013306 Bacteria 11547
252 Ga0163162_10093767 3300013306 Bacteria 3088
253 Ga0163162_10376346 3300013306 Bacteria 1553
254 Ga0157372_10012289 3300013307 Bacteria 9122
255 Ga0157372_10018962 3300013307 Bacteria 7404
256 Ga0157372_10021746 3300013307 Bacteria 6933
257 Ga0157372_10036682 3300013307 Bacteria 5404
258 Ga0157372_10290894 3300013307 Bacteria 1900
259 Ga0157372_10458506 3300013307 Bacteria 1486
260 Ga0157372_10765478 3300013307 Bacteria 1122
261 Ga0157375_10007703 3300013308 Bacteria 9424
262 Ga0157375_10155663 3300013308 Bacteria 2424
263 Ga0157375_10162094 3300013308 Bacteria 2378
264 Ga0157375_10537380 3300013308 Bacteria 1331
265 Ga0157375_10891209 3300013308 Unclassified 1034
266 Ga0163163_10050780 3300014325 Bacteria 4086
267 Ga0163163_10199473 3300014325 Bacteria 2049
268 Ga0163163_10399946 3300014325 Bacteria 1432
269 Ga0157380_10002943 3300014326 Bacteria 11579
270 Ga0157380_10159520 3300014326 Bacteria 1959
271 Ga0157380_10383867 3300014326 Bacteria 1327
272 Ga0157377_10001214 3300014745 Bacteria 10986
273 Ga0157379_10002779 3300014968 Bacteria 14754
274 Ga0157379_10460801 3300014968 Bacteria 1175
275 Ga0157376_10021797 3300014969 Bacteria 4980
276 Ga0157376_11253349 3300014969 Bacteria 771
277 Ga0163161_10061252 3300017792 Bacteria 2739
278 Ga0163161_10587099 3300017792 Bacteria 917
279 Ga0206356_11452365 3300020070 Unclassified 1204
280 Ga0206353_10829339 3300020082 Bacteria 3091
281 Ga0207697_10004114 3300025315 Bacteria 7023
282 Ga0207656_10008725 3300025321 Bacteria 3744
283 Ga0207682_10022945 3300025893 Bacteria 2462
284 Ga0207688_10008758 3300025901 Bacteria 5505
285 Ga0207680_10145851 3300025903 Bacteria 1573
286 Ga0207680_10324758 3300025903 Bacteria 1077
287 Ga0207647_10091023 3300025904 Bacteria 1819
288 Ga0207645_10000246 3300025907 Bacteria 44995
289 Ga0207645_10046076 3300025907 Bacteria 2786
290 Ga0207645_10399763 3300025907 Bacteria 924
291 Ga0207643_10005735 3300025908 Bacteria 6635
292 Ga0207705_10008483 3300025909 Bacteria 7499
293 Ga0207705_10027463 3300025909 Bacteria 4058
294 Ga0207705_10337446 3300025909 Bacteria 1160
295 Ga0207705_10510233 3300025909 Bacteria 934
296 Ga0207654_10006351 3300025911 Bacteria 5943
297 Ga0207707_10008044 3300025912 Bacteria 9158
298 Ga0207707_10034532 3300025912 Bacteria 4425
299 Ga0207707_10264225 3300025912 Bacteria 1492
300 Ga0207707_10609740 3300025912 Bacteria 923
301 Ga0207695_10015068 3300025913 Bacteria 9120
302 Ga0207695_10049287 3300025913 Bacteria 4442
303 Ga0207695_10055931 3300025913 Bacteria 4109
304 Ga0207695_10202071 3300025913 Bacteria 1901
305 Ga0207695_10494519 3300025913 Bacteria 1105
306 Ga0207671_10725906 3300025914 Unclassified 790
307 Ga0207660_10000019 3300025917 Bacteria 74841
308 Ga0207660_10193439 3300025917 Bacteria 1585
309 Ga0207662_10001341 3300025918 Bacteria 11871
310 Ga0207657_10035139 3300025919 Bacteria 4498
311 Ga0207657_10047429 3300025919 Bacteria 3756
312 Ga0207649_10001792 3300025920 Bacteria 12287
313 Ga0207649_10141668 3300025920 Bacteria 1646
314 Ga0207649_10404344 3300025920 Bacteria 1022
315 Ga0207652_10040959 3300025921 Bacteria 3936
316 Ga0207652_10052768 3300025921 Bacteria 3491
317 Ga0207652_10069352 3300025921 Bacteria 3061
318 Ga0207652_10393495 3300025921 Unclassified 1251
319 Ga0207652_10502895 3300025921 Bacteria 1091
320 Ga0207681_10004605 3300025923 Bacteria 8482
321 Ga0207681_10010274 3300025923 Bacteria 5729
322 Ga0207694_10048137 3300025924 Bacteria 3298
323 Ga0207650_10028491 3300025925 Bacteria 4005
324 Ga0207659_10008740 3300025926 Bacteria 6306
325 Ga0207659_10030744 3300025926 Bacteria 3672
326 Ga0207659_10093133 3300025926 Bacteria 2254
327 Ga0207687_10004209 3300025927 Bacteria 9624
328 Ga0207664_10019391 3300025929 Bacteria 5026
329 Ga0207690_10224469 3300025932 Bacteria 1439
330 Ga0207690_10566392 3300025932 Bacteria 925
331 Ga0207706_10000357 3300025933 Bacteria 49369
332 Ga0207706_10004509 3300025933 Bacteria 13079
333 Ga0207686_10041324 3300025934 Bacteria 2810
334 Ga0207669_10166423 3300025937 Bacteria 1564
335 Ga0207669_10212592 3300025937 Unclassified 1413
336 Ga0207669_10533466 3300025937 Bacteria 944
337 Ga0207704_10011553 3300025938 Bacteria 4351
338 Ga0207704_10093293 3300025938 Bacteria 1984
339 Ga0207704_10454829 3300025938 Bacteria 1023
340 Ga0207691_10001314 3300025940 Bacteria 24795
341 Ga0207691_10001355 3300025940 Bacteria 24425
342 Ga0207691_10002440 3300025940 Bacteria 18181
343 Ga0207691_10017747 3300025940 Bacteria 6747
344 Ga0207691_10023156 3300025940 Bacteria 5848
345 Ga0207691_10114299 3300025940 Bacteria 2398
346 Ga0207711_10012482 3300025941 Bacteria 7060
347 Ga0207711_10188200 3300025941 Bacteria 1880
348 Ga0207711_10377280 3300025941 Unclassified 1315
349 Ga0207711_10402317 3300025941 Bacteria 1272
350 Ga0207689_10000838 3300025942 Bacteria 29648
351 Ga0207689_10001360 3300025942 Bacteria 23476
352 Ga0207661_10002707 3300025944 Bacteria 12194
353 Ga0207661_10012163 3300025944 Bacteria 6249
354 Ga0207661_10016359 3300025944 Bacteria 5471
355 Ga0207661_10221446 3300025944 Bacteria 1673
356 Ga0207661_10450574 3300025944 Bacteria 1172
357 Ga0207661_10559334 3300025944 Unclassified 1048
358 Ga0207679_10001293 3300025945 Bacteria 15800
359 Ga0207679_10073037 3300025945 Bacteria 2594
360 Ga0207679_10089529 3300025945 Unclassified 2376
361 Ga0207679_10098064 3300025945 Bacteria 2284
362 Ga0207679_10214924 3300025945 Bacteria 1615
363 Ga0207679_10910136 3300025945 Unclassified 805
364 Ga0207667_10067852 3300025949 Bacteria 3715
365 Ga0207667_10247351 3300025949 Bacteria 1824
366 Ga0207667_10647948 3300025949 Bacteria 1062
367 Ga0207651_10013040 3300025960 Bacteria 4736
368 Ga0207651_10221656 3300025960 Bacteria 1529
369 Ga0207651_10255050 3300025960 Bacteria 1437
370 Ga0207712_10004798 3300025961 Bacteria 8542
371 Ga0207712_10294845 3300025961 Bacteria 1329
372 Ga0207668_10030244 3300025972 Bacteria 3557
373 Ga0207668_10100358 3300025972 Bacteria 2149
374 Ga0207668_10163630 3300025972 Unclassified 1737
375 Ga0207668_10237780 3300025972 Bacteria 1472
376 Ga0207668_10784366 3300025972 Bacteria 842
377 Ga0207640_10018594 3300025981 Bacteria 4087
378 Ga0207640_10350857 3300025981 Bacteria 1185
379 Ga0207658_10019166 3300025986 Bacteria 4731
380 Ga0207658_10294159 3300025986 Bacteria 1397
381 Ga0207658_10635455 3300025986 Unclassified 961
382 Ga0207677_10034060 3300026023 Bacteria 3294
383 Ga0207703_10005549 3300026035 Bacteria 10126
384 Ga0207703_10086685 3300026035 Bacteria 2623
385 Ga0207703_10130373 3300026035 Bacteria 2170
386 Ga0207639_10103518 3300026041 Bacteria 2306
387 Ga0207639_10286049 3300026041 Bacteria 1452
388 Ga0207639_10553318 3300026041 Bacteria 1057
389 Ga0207678_10052781 3300026067 Bacteria 3505
390 Ga0207708_10052601 3300026075 Bacteria 3102
391 Ga0207708_10129045 3300026075 Bacteria 1975
392 Ga0207702_10008970 3300026078 Bacteria 8426
393 Ga0207702_10111929 3300026078 Bacteria 2429
394 Ga0207702_10149450 3300026078 Bacteria 2123
395 Ga0207641_10015530 3300026088 Bacteria 6240
396 Ga0207641_10023335 3300026088 Bacteria 5098
397 Ga0207641_10120792 3300026088 Bacteria 2338
398 Ga0207648_10043640 3300026089 Bacteria 3935
399 Ga0207648_10048053 3300026089 Bacteria 3738
400 Ga0207648_10127878 3300026089 Bacteria 2235
401 Ga0207676_10006741 3300026095 Bacteria 8128
402 Ga0207676_10013795 3300026095 Bacteria 5802
403 Ga0207676_11255112 3300026095 Bacteria 735
404 Ga0207674_10001189 3300026116 Bacteria 33857
405 Ga0207674_10005220 3300026116 Bacteria 15462
406 Ga0207674_10012363 3300026116 Bacteria 9541
407 Ga0207674_10020068 3300026116 Bacteria 7229
408 Ga0207674_10084809 3300026116 Bacteria 3165
409 Ga0207675_100000320 3300026118 Bacteria 45668
410 Ga0207675_100024660 3300026118 Bacteria 5592
411 Ga0207698_10038232 3300026142 Bacteria 3544
412 Ga0207698_10052960 3300026142 Bacteria 3112
413 Ga0207698_10268896 3300026142 Bacteria 1570
414 Ga0207698_10298593 3300026142 Bacteria 1498
415 Ga0207428_10092971 3300027907 Bacteria 2340
416 Ga0207428_10197484 3300027907 Bacteria 1514
417 Ga0268266_10065062 3300028379 Bacteria 3152
418 Ga0268266_10303356 3300028379 Bacteria 1490
419 Ga0268266_10990145 3300028379 Bacteria 814
420 Ga0268265_10002328 3300028380 Bacteria 14426
421 Ga0268265_10002878 3300028380 Bacteria 12639
422 Ga0268264_10007527 3300028381 Bacteria 9085
423 Ga0268264_10037773 3300028381 Bacteria 3983
424 Ga0307408_100187332 3300031548 Bacteria 1664
425 Ga0307405_10002563 3300031731 Bacteria 8065
426 Ga0307405_10006095 3300031731 Bacteria 5898
427 Ga0307405_10011026 3300031731 Bacteria 4715
428 Ga0307405_10020285 3300031731 Bacteria 3711
429 Ga0307405_10198154 3300031731 Bacteria 1456
430 Ga0307413_10002839 3300031824 Bacteria 7147
431 Ga0307413_10029397 3300031824 Bacteria 3073
432 Ga0307413_10066930 3300031824 Bacteria 2244
433 Ga0307410_10005473 3300031852 Bacteria 6727
434 Ga0307410_10025754 3300031852 Bacteria 3694
435 Ga0307410_10480401 3300031852 Bacteria 1019
436 Ga0307410_10560084 3300031852 Bacteria 948
437 Ga0307406_10000997 3300031901 Bacteria 15702
438 Ga0307406_10003135 3300031901 Bacteria 8987
439 Ga0307406_10007929 3300031901 Bacteria 5912
440 Ga0307406_10190655 3300031901 Bacteria 1500
441 Ga0307406_10244351 3300031901 Bacteria 1348
442 Ga0307406_10297630 3300031901 Bacteria 1238
443 Ga0307407_10006846 3300031903 Bacteria 5110
444 Ga0307407_10037378 3300031903 Bacteria 2682
445 Ga0307412_10302608 3300031911 Bacteria 1265
446 Ga0307412_10482307 3300031911 Bacteria 1028
447 Ga0307412_10552150 3300031911 Bacteria 968
448 Ga0307409_100023265 3300031995 Bacteria 4289
449 Ga0307409_100038991 3300031995 Bacteria 3520
450 Ga0307409_100039847 3300031995 Bacteria 3490
451 Ga0307409_100115909 3300031995 Bacteria 2257
452 Ga0307409_100212235 3300031995 Bacteria 1740
453 Ga0307409_100422047 3300031995 Bacteria 1280
454 Ga0307416_100017933 3300032002 Bacteria 4971
455 Ga0307416_100018106 3300032002 Bacteria 4952
456 Ga0307416_100020574 3300032002 Bacteria 4712
457 Ga0307416_100079715 3300032002 Bacteria 2761
458 Ga0307416_100124611 3300032002 Bacteria 2305
459 Ga0307416_100334795 3300032002 Bacteria 1523
460 Ga0307416_100442581 3300032002 Unclassified 1350
461 Ga0307416_101117569 3300032002 Bacteria 893
462 Ga0307414_10004771 3300032004 Bacteria 7397
463 Ga0307414_10023255 3300032004 Bacteria 3927
464 Ga0307414_10041511 3300032004 Bacteria 3117
465 Ga0307411_10016870 3300032005 Bacteria 4142
466 Ga0307411_10017025 3300032005 Bacteria 4128
467 Ga0307411_10097853 3300032005 Bacteria 2066
468 Ga0307415_100004642 3300032126 Bacteria 7176
469 Ga0307415_100004895 3300032126 Bacteria 7035
470 Ga0307415_100010501 3300032126 Bacteria 5249
471 Ga0307415_100117207 3300032126 Bacteria 1988
472 Ga0307415_100238943 3300032126 Bacteria 1468
473 Ga0307415_100363626 3300032126 Bacteria 1223
474 Ga0373934_0009118 3300035086 Bacteria 3712
475 Ga0373923_0048579 3300035111 Bacteria 1772
476 Ga0373956_0010506 3300035119 Bacteria 3796
477 Ga0373957_0105396 3300035120 Unclassified 1132
478 Ga0373960_0059628 3300035121 Bacteria 1155
479 Ga0373924_0110981 3300035410 Unclassified 1185
480 Ga0373931_0004289 3300035691 Bacteria 6494
481 Ga0373931_0274986 3300035691 Bacteria 1032
482 Ga0373935_0259841 3300035692 Unclassified 1218
483 Ga0373933_0005918 3300035724 Bacteria 6654
484 Ga0373937_0009784 3300036401 Bacteria 8358
485 Ga0373937_0654475 3300036401 Bacteria 996
486 Ga0395899_0110016 3300037312 Bacteria 1982
487 Ga0395900_0066207 3300037418 Bacteria 3713
488 Ga0395898_0116174 3300037466 Bacteria 2564
489 Ga0395905_0006883 3300037471 Bacteria 11367
490 Ga0395905_0141882 3300037471 Bacteria 2260
491 Ga0395901_0103552 3300038443 Bacteria 2986
492 Ga0436365_0262337 3300039437 Bacteria 7273
493 Ga0436365_0614410 3300039437 Bacteria 1502
494 Ga0451807_0077717 3300041486 Bacteria 1283
495 Ga0439462_0060789 3300042015 Bacteria 1022
496 Ga0451577_0000016 3300042876 Bacteria 531002
497 Ga0451577_0029136 3300042876 Bacteria 4991
498 Ga0451577_0045506 3300042876 Bacteria 3928
499 Ga0451577_0121515 3300042876 Bacteria 2339
500 Ga0451577_0623837 3300042876 Unclassified 978
501 Ga0453684_0036233 3300044712 Bacteria 6801
502 Ga0453684_0918023 3300044712 Unclassified 936
503 Ga0451576_0106572 3300045051 Bacteria 2916
504 Ga0451576_0793667 3300045051 Unclassified 994
505 Ga0466967_0147298 3300045976 Bacteria 2197
506 Ga0466967_0244092 3300045976 Bacteria 1714
507 Ga0466967_0918418 3300045976 Bacteria 871
508 Ga0495592_0069656 3300046454 Bacteria 2564
509 Ga0495651_0001301 3300046462 Bacteria 19332
510 Ga0495653_0017208 3300046463 Bacteria 5878
511 Ga0495664_0067927 3300046477 Bacteria 2127
512 Ga0495608_0009500 3300046511 Bacteria 6795
513 Ga0495608_0225593 3300046511 Bacteria 1174
514 Ga0495618_0453374 3300046514 Unclassified 778
515 Ga0495628_0000494 3300046516 Bacteria 36135
516 Ga0495630_0265247 3300046517 Unclassified 1312
517 Ga0495652_0004653 3300046529 Bacteria 13086
518 Ga0495665_0429092 3300046531 Unclassified 669
519 Ga0495586_0610060 3300046535 Unclassified 630
520 Ga0495587_0000269 3300046536 Bacteria 37262
521 Ga0495645_0076410 3300046543 Bacteria 2409
522 Ga0495645_0467804 3300046543 Unclassified 793
523 Ga0495667_0090743 3300046559 Bacteria 1979
524 Ga0495635_0000200 3300046663 Bacteria 37911
525 Ga0495657_0001237 3300046675 Bacteria 22362
526 Ga0495599_0004010 3300046678 Bacteria 8674
527 Ga0495599_0229830 3300046678 Unclassified 1133
528 Ga0495623_0000156 3300046679 Bacteria 42279
529 Ga0495646_0139099 3300046680 Bacteria 1359
530 Ga0495613_0345732 3300046689 Unclassified 1022
531 Ga0495670_0038861 3300046691 Bacteria 2373
532 Ga0495600_0005770 3300046809 Bacteria 7477
533 Ga0495604_0345792 3300047317 Unclassified 989
534 Ga0495674_0004839 3300047319 Bacteria 12950
535 Ga0495680_0432590 3300047322 Unclassified 903
536 Ga0495675_0058505 3300047444 Bacteria 2444
537 Ga0495684_0028480 3300047471 Bacteria 4288
538 Ga0495602_0022321 3300048088 Bacteria 6198
539 Ga0496104_0827413 3300048907 Unclassified 832
540 Ga0496106_0208930 3300048909 Bacteria 1554
541 Ga0496107_0220874 3300048910 Bacteria 1410
542 Ga0496108_0020209 3300048911 Bacteria 5473
543 Ga0496108_0139525 3300048911 Bacteria 2088
544 Ga0496109_0031858 3300048912 Bacteria 4736
545 Ga0496112_0000196 3300048915 Bacteria 39516
546 Ga0496112_0088854 3300048915 Bacteria 3058
547 Ga0496113_0014762 3300048916 Bacteria 5343
548 Ga0496113_0203528 3300048916 Bacteria 1574
549 Ga0496114_0133646 3300048917 Bacteria 2144
550 Ga0496114_0308843 3300048917 Unclassified 1397
551 Ga0496115_0023520 3300048918 Bacteria 4781
552 Ga0496115_0128735 3300048918 Bacteria 2086
553 Ga0501032_0261876 3300049569 Bacteria 1121
554 Ga0501033_0026915 3300049570 Bacteria 4326
555 Ga0501034_0023281 3300049571 Bacteria 6311
556 Ga0501040_0085139 3300049576 Bacteria 2194
557 Ga0501042_0629947 3300049578 Unclassified 780
558 Ga0501046_0391768 3300049580 Bacteria 1004
559 Ga0501047_0030185 3300049581 Bacteria 5227
560 Ga0501076_0071229 3300049592 Bacteria 2781
561 Ga0501206_020164 3300049653 Unclassified 946
562 Ga0501233_065594 3300049668 Unclassified 910
563 Ga0501259_011575 3300049688 Bacteria 1461
564 Ga0501259_064161 3300049688 Unclassified 774
565 Ga0501079_0330498 3300049741 Unclassified 1194
566 Ga0501080_0102262 3300049742 Bacteria 2658
567 Ga0501080_0442693 3300049742 Unclassified 1166
568 Ga0501080_1112539 3300049742 Unclassified 682
569 Ga0501081_0412949 3300049743 Unclassified 1000
570 Ga0501035_0028174 3300049822 Bacteria 5127
571 Ga0501035_0879961 3300049822 Bacteria 711
572 Ga0501044_0042149 3300049823 Bacteria 4750
573 Ga0501045_0351037 3300049824 Bacteria 1098
574 nmdc:mga05p37_1508813_c1 3300050507 Unclassified 669
575 nmdc:mga05p37_272908_c1 3300050507 Bacteria 2020
576 nmdc:mga09592_137749_c1 3300050508 Bacteria 2103
577 nmdc:mga09592_33595_c1 3300050508 Unclassified 4283
578 nmdc:mga0qj67_39857_c1 3300050509 Bacteria 3690
579 nmdc:mga0qj67_422506_c1 3300050509 Bacteria 1075
580 nmdc:mga0qj67_71620_c1 3300050509 Bacteria 2767
581 nmdc:mga06r32_189904_c1 3300050510 Bacteria 2042
582 nmdc:mga06r32_321556_c1 3300050510 Bacteria 1533
583 nmdc:mga06r32_414762_c1 3300050510 Bacteria 1328
584 nmdc:mga06r32_92915_c1 3300050510 Bacteria 2950
585 nmdc:mga08y16_335477_c1 3300050511 Bacteria 1555
586 nmdc:mga08y16_66250_c1 3300050511 Bacteria 3769
587 nmdc:mga0n895_18729_c1 3300050512 Bacteria 6415
588 nmdc:mga0n895_342946_c1 3300050512 Bacteria 1513
589 nmdc:mga0rr50_553955_c1 3300050513 Unclassified 979
590 nmdc:mga08x19_44349_c1 3300050514 Bacteria 2839
591 nmdc:mga0a205_24539_c1 3300050515 Bacteria 5736
592 Ga0495601_0088017 3300053077 Bacteria 1997
593 Ga0495612_0074613 3300053078 Unclassified 1418
594 Ga0495595_0311602 3300053084 Unclassified 792
595 Ga0495619_0076356 3300053085 Bacteria 2249
596 Ga0590071_055781 3300059421 Unclassified 961
597 Ga0307408_100008102
598 JGI24737J22298_10029355
599 JGI24750J21931_1003346
600 Ga0065707_10210518
601 Ga0070658_10023333
602 Ga0070658_10056809
603 Ga0070658_10380678
604 Ga0070658_10653978
605 Ga0070676_10008120
606 Ga0070676_10081692
607 Ga0070676_10093313
608 Ga0070683_100000681
609 Ga0070683_100010079
610 Ga0070683_100022880
611 Ga0070683_100041535
612 Ga0070683_100179991
613 Ga0070683_100336243
614 Ga0070670_100171030
615 Ga0070670_100188933
616 Ga0070670_100290336
617 Ga0070670_100479235
618 Ga0068869_100000336
619 Ga0068869_100003185
620 Ga0068869_100997942
621 Ga0070666_10113294
622 Ga0070666_10357363
623 Ga0070680_100000247
624 Ga0070680_100016663
625 Ga0070680_100050750
626 Ga0070680_100073293
627 Ga0070682_100006710
628 Ga0070682_100295135
629 Ga0068868_100037170
630 Ga0068868_100054291
631 Ga0070660_100025284
632 Ga0070660_100126897
633 Ga0070689_100003792
634 Ga0070689_100009066
635 Ga0070689_100542484
636 Ga0070687_100009043
637 Ga0070661_100005547
638 Ga0070661_100007742
639 Ga0070661_100065231
640 Ga0070661_100066085
641 Ga0070661_100117045
642 Ga0070692_10006391
643 Ga0070668_100004050
644 Ga0070669_100002374
645 Ga0070669_100017185
646 Ga0070669_100024551
647 Ga0070669_100189645
648 Ga0070675_100000547
649 Ga0070675_100010741
650 Ga0070675_100011278
651 Ga0070675_100032429
652 Ga0070671_100007736
653 Ga0070674_100072016
654 Ga0070674_100535292
655 Ga0070673_100016912
656 Ga0070673_100029330
657 Ga0070673_100064374
658 Ga0070673_100322686
659 Ga0070688_100010739
660 Ga0070688_100026534
661 Ga0070659_100006929
662 Ga0070659_100225117
663 Ga0070667_100004361
664 Ga0070667_100024900
665 Ga0070667_100273902
666 Ga0070667_100414056
667 Ga0070709_10203843
668 Ga0070714_100073555
669 Ga0070701_10223408
670 Ga0070711_100817716
671 Ga0070700_100101883
672 Ga0070694_100092001
673 Ga0070694_100127279
674 Ga0070678_100368950
675 Ga0070662_100010640
676 Ga0070662_100079870
677 Ga0070662_100135797
678 Ga0070681_10009028
679 Ga0070681_10150059
680 Ga0070681_10324247
681 Ga0068867_100019037
682 Ga0068867_100042966
683 Ga0068867_100143437
684 Ga0068867_100265492
685 Ga0070698_100099851
686 Ga0070699_100115930
687 Ga0070699_100200961
688 Ga0070679_100045506
689 Ga0070679_100092366
690 Ga0070679_100163588
691 Ga0070679_100189309
692 Ga0070679_100285648
693 Ga0070679_100469149
694 Ga0070684_100004716
695 Ga0070684_100006298
696 Ga0070684_100010020
697 Ga0070684_100012054
698 Ga0070684_100146696
699 Ga0070684_100319602
700 Ga0070684_100336089
701 Ga0070697_100448262
702 Ga0068853_100008061
703 Ga0068853_100024434
704 Ga0068853_100590022
705 Ga0070672_100029789
706 Ga0070672_100071261
707 Ga0070672_100098231
708 Ga0070672_100103354
709 Ga0070672_100228072
710 Ga0070672_100558084
711 Ga0070686_100642005
712 Ga0070686_100763456
713 Ga0070695_100035292
714 Ga0070693_100030580
715 Ga0070665_100181608
716 Ga0068855_100059280
717 Ga0068855_100087932
718 Ga0068855_100294924
719 Ga0068855_100333925
720 Ga0070664_100005450
721 Ga0070664_100010643
722 Ga0070664_100013631
723 Ga0070664_100033122
724 Ga0070664_100100588
725 Ga0070664_100127605
726 Ga0070664_100271366
727 Ga0070664_100543652
728 Ga0068857_100003188
729 Ga0068857_100012828
730 Ga0068857_100027471
731 Ga0068857_100030916
732 Ga0068857_100078648
733 Ga0068854_100075120
734 Ga0068854_100584085
735 Ga0068854_101185395
736 Ga0068856_100004404
737 Ga0068856_100097012
738 Ga0068856_100143304
739 Ga0068856_100856444
740 Ga0070702_100003041
741 Ga0070702_100157770
742 Ga0068852_100006303
743 Ga0068852_100026250
744 Ga0068852_100050273
745 Ga0068852_100055451
746 Ga0068852_100192660
747 Ga0068852_100720371
748 Ga0068859_100040566
749 Ga0068859_100132524
750 Ga0068859_100182395
751 Ga0068864_100029675
752 Ga0068861_100014363
753 Ga0068861_100031208
754 Ga0068861_100523339
755 Ga0068861_100740408
756 Ga0068851_10003188
757 Ga0068870_10012379
758 Ga0068870_10094352
759 Ga0068863_100013838
760 Ga0068863_100178298
761 Ga0068863_100875417
762 Ga0068858_100012176
763 Ga0068858_100082269
764 Ga0068858_100086564
765 Ga0068858_100117492
766 Ga0068860_100006907
767 Ga0068860_100014614
768 Ga0068860_100166983
769 Ga0068862_100008006
770 Ga0081455_10028128
771 Ga0081539_10012248
772 Ga0097621_100012625
773 Ga0068871_100020170
774 Ga0068871_100753928
775 Ga0075428_100160807
776 Ga0075428_100209060
777 Ga0075428_100418508
778 Ga0075430_100016806
779 Ga0075430_100024856
780 Ga0075430_100039628
781 Ga0075430_100058837
782 Ga0075431_100031621
783 Ga0075431_100061920
784 Ga0075431_100115542
785 Ga0075431_100131271
786 Ga0075431_100264535
787 Ga0075431_100276052
788 Ga0075433_10013303
789 Ga0075434_100008741
790 Ga0075434_100365309
791 Ga0075429_100031032
792 Ga0075429_100064042
793 Ga0075429_100124743
794 Ga0068865_100009369
795 Ga0068865_100123076
796 Ga0068865_100283830
797 Ga0097620_100040566
798 Ga0097620_100132517
799 Ga0097620_100182391
800 Ga0075435_100337712
801 Ga0105240_10008178
802 Ga0105240_10289202
803 Ga0111539_10034268
804 Ga0111539_10112864
805 Ga0111539_10216851
806 Ga0111539_10264150
807 Ga0105245_10004762
808 Ga0105245_10028583
809 Ga0105245_10114634
810 Ga0114129_10039108
811 Ga0114129_10544237
812 Ga0105243_10048333
813 Ga0105241_10003558
814 Ga0105242_10016201
815 Ga0105242_10277538
816 Ga0105248_10015710
817 Ga0105248_10016255
818 Ga0105248_10047581
819 Ga0105248_10082569
820 Ga0105248_10142839
821 Ga0105248_10315860
822 Ga0105237_10638173
823 Ga0105238_10111041
824 Ga0105238_10353815
825 Ga0105238_10542294
826 Ga0105249_10000401
827 Ga0105249_10025142
828 Ga0105249_10501733
829 Ga0105239_10012515
830 Ga0105239_10025212
831 Ga0105246_10000533
832 Ga0105246_10625396
833 Ga0157373_10044476
834 Ga0157373_10309231
835 Ga0157373_10398658
836 Ga0157371_10020222
837 Ga0157370_10011107
838 Ga0157370_10036679
839 Ga0157370_10075470
840 Ga0157370_10315934
841 Ga0157369_10017079
842 Ga0157369_10100386
843 Ga0157369_10202695
844 Ga0157369_10231304
845 Ga0157374_10046567
846 Ga0157374_10376654
847 Ga0163162_10006251
848 Ga0163162_10093767
849 Ga0163162_10376346
850 Ga0157372_10012289
851 Ga0157372_10018962
852 Ga0157372_10021746
853 Ga0157372_10036682
854 Ga0157372_10290894
855 Ga0157372_10458506
856 Ga0157372_10765478
857 Ga0157375_10007703
858 Ga0157375_10155663
859 Ga0157375_10162094
860 Ga0157375_10537380
861 Ga0157375_10891209
862 Ga0163163_10050780
863 Ga0163163_10199473
864 Ga0163163_10399946
865 Ga0157380_10002943
866 Ga0157380_10159520
867 Ga0157380_10383867
868 Ga0157377_10001214
869 Ga0157379_10002779
870 Ga0157379_10460801
871 Ga0157376_10021797
872 Ga0157376_11253349
873 Ga0163161_10061252
874 Ga0163161_10587099
875 Ga0206356_11452365
876 Ga0206353_10829339
877 Ga0207697_10004114
878 Ga0207656_10008725
879 Ga0207682_10022945
880 Ga0207688_10008758
881 Ga0207680_10145851
882 Ga0207680_10324758
883 Ga0207647_10091023
884 Ga0207645_10000246
885 Ga0207645_10046076
886 Ga0207645_10399763
887 Ga0207643_10005735
888 Ga0207705_10008483
889 Ga0207705_10027463
890 Ga0207705_10337446
891 Ga0207705_10510233
892 Ga0207654_10006351
893 Ga0207707_10008044
894 Ga0207707_10034532
895 Ga0207707_10264225
896 Ga0207707_10609740
897 Ga0207695_10015068
898 Ga0207695_10049287
899 Ga0207695_10055931
900 Ga0207695_10202071
901 Ga0207695_10494519
902 Ga0207671_10725906
903 Ga0207660_10000019
904 Ga0207660_10193439
905 Ga0207662_10001341
906 Ga0207657_10035139
907 Ga0207657_10047429
908 Ga0207649_10001792
909 Ga0207649_10141668
910 Ga0207649_10404344
911 Ga0207652_10040959
912 Ga0207652_10052768
913 Ga0207652_10069352
914 Ga0207652_10393495
915 Ga0207652_10502895
916 Ga0207681_10004605
917 Ga0207681_10010274
918 Ga0207694_10048137
919 Ga0207650_10028491
920 Ga0207659_10008740
921 Ga0207659_10030744
922 Ga0207659_10093133
923 Ga0207687_10004209
924 Ga0207664_10019391
925 Ga0207690_10224469
926 Ga0207690_10566392
927 Ga0207706_10000357
928 Ga0207706_10004509
929 Ga0207686_10041324
930 Ga0207669_10166423
931 Ga0207669_10212592
932 Ga0207669_10533466
933 Ga0207704_10011553
934 Ga0207704_10093293
935 Ga0207704_10454829
936 Ga0207691_10001314
937 Ga0207691_10001355
938 Ga0207691_10002440
939 Ga0207691_10017747
940 Ga0207691_10023156
941 Ga0207691_10114299
942 Ga0207711_10012482
943 Ga0207711_10188200
944 Ga0207711_10377280
945 Ga0207711_10402317
946 Ga0207689_10000838
947 Ga0207689_10001360
948 Ga0207661_10002707
949 Ga0207661_10012163
950 Ga0207661_10016359
951 Ga0207661_10221446
952 Ga0207661_10450574
953 Ga0207661_10559334
954 Ga0207679_10001293
955 Ga0207679_10073037
956 Ga0207679_10089529
957 Ga0207679_10098064
958 Ga0207679_10214924
959 Ga0207679_10910136
960 Ga0207667_10067852
961 Ga0207667_10247351
962 Ga0207667_10647948
963 Ga0207651_10013040
964 Ga0207651_10221656
965 Ga0207651_10255050
966 Ga0207712_10004798
967 Ga0207712_10294845
968 Ga0207668_10030244
969 Ga0207668_10100358
970 Ga0207668_10163630
971 Ga0207668_10237780
972 Ga0207668_10784366
973 Ga0207640_10018594
974 Ga0207640_10350857
975 Ga0207658_10019166
976 Ga0207658_10294159
977 Ga0207658_10635455
978 Ga0207677_10034060
979 Ga0207703_10005549
980 Ga0207703_10086685
981 Ga0207703_10130373
982 Ga0207639_10103518
983 Ga0207639_10286049
984 Ga0207639_10553318
985 Ga0207678_10052781
986 Ga0207708_10052601
987 Ga0207708_10129045
988 Ga0207702_10008970
989 Ga0207702_10111929
990 Ga0207702_10149450
991 Ga0207641_10015530
992 Ga0207641_10023335
993 Ga0207641_10120792
994 Ga0207648_10043640
995 Ga0207648_10048053
996 Ga0207648_10127878
997 Ga0207676_10006741
998 Ga0207676_10013795
999 Ga0207676_11255112
1000 Ga0207674_10001189
1001 Ga0207674_10005220
1002 Ga0207674_10012363
1003 Ga0207674_10020068
1004 Ga0207674_10084809
1005 Ga0207675_100000320
1006 Ga0207675_100024660
1007 Ga0207698_10038232
1008 Ga0207698_10052960
1009 Ga0207698_10268896
1010 Ga0207698_10298593
1011 Ga0207428_10092971
1012 Ga0207428_10197484
1013 Ga0268266_10065062
1014 Ga0268266_10303356
1015 Ga0268266_10990145
1016 Ga0268265_10002328
1017 Ga0268265_10002878
1018 Ga0268264_10007527
1019 Ga0268264_10037773
1020 Ga0307408_100187332
1021 Ga0307405_10002563
1022 Ga0307405_10006095
1023 Ga0307405_10011026
1024 Ga0307405_10020285
1025 Ga0307405_10198154
1026 Ga0307413_10002839
1027 Ga0307413_10029397
1028 Ga0307413_10066930
1029 Ga0307410_10005473
1030 Ga0307410_10025754
1031 Ga0307410_10480401
1032 Ga0307410_10560084
1033 Ga0307406_10000997
1034 Ga0307406_10003135
1035 Ga0307406_10007929
1036 Ga0307406_10190655
1037 Ga0307406_10244351
1038 Ga0307406_10297630
1039 Ga0307407_10006846
1040 Ga0307407_10037378
1041 Ga0307412_10302608
1042 Ga0307412_10482307
1043 Ga0307412_10552150
1044 Ga0307409_100023265
1045 Ga0307409_100038991
1046 Ga0307409_100039847
1047 Ga0307409_100115909
1048 Ga0307409_100212235
1049 Ga0307409_100422047
1050 Ga0307416_100017933
1051 Ga0307416_100018106
1052 Ga0307416_100020574
1053 Ga0307416_100079715
1054 Ga0307416_100124611
1055 Ga0307416_100334795
1056 Ga0307416_100442581
1057 Ga0307416_101117569
1058 Ga0307414_10004771
1059 Ga0307414_10023255
1060 Ga0307414_10041511
1061 Ga0307411_10016870
1062 Ga0307411_10017025
1063 Ga0307411_10097853
1064 Ga0307415_100004642
1065 Ga0307415_100004895
1066 Ga0307415_100010501
1067 Ga0307415_100117207
1068 Ga0307415_100238943
1069 Ga0307415_100363626
1070 Ga0373934_0009118
1071 Ga0373923_0048579
1072 Ga0373956_0010506
1073 Ga0373957_0105396
1074 Ga0373960_0059628
1075 Ga0373924_0110981
1076 Ga0373931_0004289
1077 Ga0373931_0274986
1078 Ga0373935_0259841
1079 Ga0373933_0005918
1080 Ga0373937_0009784
1081 Ga0373937_0654475
1082 Ga0395899_0110016
1083 Ga0395900_0066207
1084 Ga0395898_0116174
1085 Ga0395905_0006883
1086 Ga0395905_0141882
1087 Ga0395901_0103552
1088 Ga0436365_0262337
1089 Ga0436365_0614410
1090 Ga0451807_0077717
1091 Ga0439462_0060789
1092 Ga0451577_0000016
1093 Ga0451577_0029136
1094 Ga0451577_0045506
1095 Ga0451577_0121515
1096 Ga0451577_0623837
1097 Ga0453684_0036233
1098 Ga0453684_0918023
1099 Ga0451576_0106572
1100 Ga0451576_0793667
1101 Ga0466967_0147298
1102 Ga0466967_0244092
1103 Ga0466967_0918418
1104 Ga0495592_0069656
1105 Ga0495651_0001301
1106 Ga0495653_0017208
1107 Ga0495664_0067927
1108 Ga0495608_0009500
1109 Ga0495608_0225593
1110 Ga0495618_0453374
1111 Ga0495628_0000494
1112 Ga0495630_0265247
1113 Ga0495652_0004653
1114 Ga0495665_0429092
1115 Ga0495586_0610060
1116 Ga0495587_0000269
1117 Ga0495645_0076410
1118 Ga0495645_0467804
1119 Ga0495667_0090743
1120 Ga0495635_0000200
1121 Ga0495657_0001237
1122 Ga0495599_0004010
1123 Ga0495599_0229830
1124 Ga0495623_0000156
1125 Ga0495646_0139099
1126 Ga0495613_0345732
1127 Ga0495670_0038861
1128 Ga0495600_0005770
1129 Ga0495604_0345792
1130 Ga0495674_0004839
1131 Ga0495680_0432590
1132 Ga0495675_0058505
1133 Ga0495684_0028480
1134 Ga0495602_0022321
1135 Ga0496104_0827413
1136 Ga0496106_0208930
1137 Ga0496107_0220874
1138 Ga0496108_0020209
1139 Ga0496108_0139525
1140 Ga0496109_0031858
1141 Ga0496112_0000196
1142 Ga0496112_0088854
1143 Ga0496113_0014762
1144 Ga0496113_0203528
1145 Ga0496114_0133646
1146 Ga0496114_0308843
1147 Ga0496115_0023520
1148 Ga0496115_0128735
1149 Ga0501032_0261876
1150 Ga0501033_0026915
1151 Ga0501034_0023281
1152 Ga0501040_0085139
1153 Ga0501042_0629947
1154 Ga0501046_0391768
1155 Ga0501047_0030185
1156 Ga0501076_0071229
1157 Ga0501206_020164
1158 Ga0501233_065594
1159 Ga0501259_011575
1160 Ga0501259_064161
1161 Ga0501079_0330498
1162 Ga0501080_0102262
1163 Ga0501080_0442693
1164 Ga0501080_1112539
1165 Ga0501081_0412949
1166 Ga0501035_0028174
1167 Ga0501035_0879961
1168 Ga0501044_0042149
1169 Ga0501045_0351037
1170 nmdc:mga05p37_1508813_c1
1171 nmdc:mga05p37_272908_c1
1172 nmdc:mga09592_137749_c1
1173 nmdc:mga09592_33595_c1
1174 nmdc:mga0qj67_39857_c1
1175 nmdc:mga0qj67_422506_c1
1176 nmdc:mga0qj67_71620_c1
1177 nmdc:mga06r32_189904_c1
1178 nmdc:mga06r32_321556_c1
1179 nmdc:mga06r32_414762_c1
1180 nmdc:mga06r32_92915_c1
1181 nmdc:mga08y16_335477_c1
1182 nmdc:mga08y16_66250_c1
1183 nmdc:mga0n895_18729_c1
1184 nmdc:mga0n895_342946_c1
1185 nmdc:mga0rr50_553955_c1
1186 nmdc:mga08x19_44349_c1
1187 nmdc:mga0a205_24539_c1
1188 Ga0495601_0088017
1189 Ga0495612_0074613
1190 Ga0495595_0311602
1191 Ga0495619_0076356
1192 Ga0590071_055781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

163

245

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.905 91 206
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8899 91 208
2af7-assembly1.cif.gz_A crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8763 91 208
2af7-assembly1.cif.gz_F crystal structure of the gamma-carboxymuconolactone decarboxylase from methanobacterium thermoautotrophicum. northeast structural genomics consortium target tt747. 0.8635 91 206
4g9q-assembly1.cif.gz_A crystal structure of a 4-carboxymuconolactone decarboxylase 0.759 6 207
ID Description Score Start End Superfamily
2af7G00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8751 93 208 1.20.1290.10
2af7D00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8748 92 206 1.20.1290.10
2af7G00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8541 93 208 1.20.1290.10
af_Q58906_2_101_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8421 110 202 1.20.1290.10
2af7F00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.8307 91 206 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A7D5XEZ3-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9841 89 207 GO:0051920
AF-A0A841HV07-F1-model_v4 4-carboxymuconolactone decarboxylase (EC 4.1.1.44) 0.9754 99 207 GO:0016829
GO:0051920
AF-A0A2V7SID8-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9753 1 208 GO:0051920
AF-A0A7V9U3B1-F1-model_v4 Carboxymuconolactone decarboxylase family protein 0.9752 8 205 GO:0051920
AF-A0A430RUR7-F1-model_v4 4-carboxymuconolactone decarboxylase 0.9734 99 207 GO:0051920

Map