F467530

General Info

Members Datasets Scaffolds Average Seq Length
596 186 1192 146

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100413864|Ga0068861_1004138642
Length 159
Sequence MKPKNQRLVLVGAALVAVLAAVLLAMWGLRDRASYFYTPAEVVAGKAEALKAIRLGGMVERGSIHRGADGVTTSFVVTDGQARVMVDYRGITPDLFREGSGVVAEGHVQPLATAIDANSRTVGPIFVADTILAKHDERYMPPELGNLAAEHKAGKTLQR

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
135 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
136 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
137 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
138 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
162 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
181 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
182 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
183 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
184 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 3.02
Rhizosphere 96.48
Stem 0
Stem Tuber 0.17
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100413864 3300005719 Bacteria 1199
2 MBSR1b_contig_9705856 2162886012 Bacteria 849
3 JGI24739J22299_10000218 3300001989 Bacteria 19232
4 JGI24737J22298_10001076 3300001990 Bacteria 9605
5 JGI24748J21848_1018694 3300002074 Bacteria 832
6 JGI24738J21930_10000923 3300002075 Bacteria 8451
7 JGI24034J26672_10010046 3300002239 Bacteria 1403
8 JGI24034J26672_10060621 3300002239 Bacteria 664
9 Ga0065712_10047667 3300005290 Bacteria 861
10 Ga0065715_10107215 3300005293 Bacteria 2783
11 Ga0065715_10195841 3300005293 Bacteria 1388
12 Ga0070658_10076626 3300005327 Bacteria 2743
13 Ga0070658_10087145 3300005327 Bacteria 2569
14 Ga0070658_10092445 3300005327 Bacteria 2494
15 Ga0070658_11057996 3300005327 Bacteria 706
16 Ga0070683_100242098 3300005329 Bacteria 1716
17 Ga0070690_100009606 3300005330 Bacteria 5609
18 Ga0070670_100000600 3300005331 Bacteria 28387
19 Ga0070670_100082684 3300005331 Bacteria 2759
20 Ga0070670_100084867 3300005331 Bacteria 2721
21 Ga0070670_100161352 3300005331 Bacteria 1943
22 Ga0070670_100223884 3300005331 Bacteria 1637
23 Ga0070670_100261891 3300005331 Bacteria 1507
24 Ga0070670_100641795 3300005331 Bacteria 952
25 Ga0070677_10000735 3300005333 Bacteria 10923
26 Ga0068869_100025580 3300005334 Bacteria 4100
27 Ga0070666_10000731 3300005335 Bacteria 19890
28 Ga0070666_10004646 3300005335 Bacteria 8385
29 Ga0070666_10006870 3300005335 Bacteria 7009
30 Ga0070666_10049326 3300005335 Bacteria 2829
31 Ga0070666_10426083 3300005335 Bacteria 956
32 Ga0068868_100002334 3300005338 Bacteria 13125
33 Ga0068868_100008603 3300005338 Bacteria 7310
34 Ga0070660_100005952 3300005339 Bacteria 8432
35 Ga0070660_100150517 3300005339 Bacteria 1871
36 Ga0070660_100437784 3300005339 Bacteria 1084
37 Ga0070689_100071123 3300005340 Bacteria 2717
38 Ga0070689_100103921 3300005340 Bacteria 2252
39 Ga0070661_100024235 3300005344 Bacteria 4352
40 Ga0070661_100115994 3300005344 Bacteria 2003
41 Ga0070661_100144635 3300005344 Bacteria 1794
42 Ga0070661_100228128 3300005344 Bacteria 1431
43 Ga0070661_100254758 3300005344 Bacteria 1355
44 Ga0070692_10105896 3300005345 Bacteria 1548
45 Ga0070692_10210669 3300005345 Bacteria 1143
46 Ga0070668_100010572 3300005347 Bacteria 6865
47 Ga0070668_100252244 3300005347 Bacteria 1465
48 Ga0070668_100365151 3300005347 Bacteria 1225
49 Ga0070668_100617548 3300005347 Bacteria 950
50 Ga0070668_101697458 3300005347 Bacteria 580
51 Ga0070669_100046775 3300005353 Bacteria 3155
52 Ga0070669_100231701 3300005353 Bacteria 1464
53 Ga0070669_100258269 3300005353 Bacteria 1389
54 Ga0070669_100483375 3300005353 Bacteria 1025
55 Ga0070675_100007982 3300005354 Bacteria 8201
56 Ga0070675_100009299 3300005354 Bacteria 7641
57 Ga0070675_100029253 3300005354 Bacteria 4442
58 Ga0070675_100201119 3300005354 Bacteria 1729
59 Ga0070675_100277498 3300005354 Bacteria 1472
60 Ga0070671_100000190 3300005355 Bacteria 41368
61 Ga0070671_100022674 3300005355 Bacteria 5129
62 Ga0070671_100038838 3300005355 Bacteria 3951
63 Ga0070671_100177804 3300005355 Bacteria 1801
64 Ga0070671_100525222 3300005355 Bacteria 1019
65 Ga0070674_100027796 3300005356 Bacteria 3710
66 Ga0070674_100038592 3300005356 Bacteria 3219
67 Ga0070674_100082966 3300005356 Bacteria 2294
68 Ga0070674_100169129 3300005356 Bacteria 1665
69 Ga0070674_101168194 3300005356 Bacteria 682
70 Ga0070673_100003726 3300005364 Bacteria 9552
71 Ga0070673_100005750 3300005364 Bacteria 7979
72 Ga0070673_100007428 3300005364 Bacteria 7226
73 Ga0070673_100007601 3300005364 Bacteria 7169
74 Ga0070673_100040011 3300005364 Bacteria 3593
75 Ga0070673_100405584 3300005364 Bacteria 1220
76 Ga0070688_100207246 3300005365 Bacteria 1375
77 Ga0070659_100011923 3300005366 Bacteria 6434
78 Ga0070659_100016545 3300005366 Bacteria 5537
79 Ga0070659_100062773 3300005366 Bacteria 2938
80 Ga0070659_100069696 3300005366 Bacteria 2792
81 Ga0070659_100098728 3300005366 Bacteria 2348
82 Ga0070659_100366747 3300005366 Bacteria 1211
83 Ga0070659_100759079 3300005366 Bacteria 842
84 Ga0070667_100001536 3300005367 Bacteria 20668
85 Ga0070667_100003165 3300005367 Bacteria 14103
86 Ga0070667_100007076 3300005367 Bacteria 9324
87 Ga0070667_100008296 3300005367 Bacteria 8609
88 Ga0070667_100012023 3300005367 Bacteria 7165
89 Ga0070667_100018727 3300005367 Bacteria 5742
90 Ga0070667_100060546 3300005367 Bacteria 3203
91 Ga0070667_100116502 3300005367 Bacteria 2320
92 Ga0070667_100306389 3300005367 Bacteria 1431
93 Ga0070667_101198628 3300005367 Bacteria 711
94 Ga0070705_100389785 3300005440 Bacteria 1028
95 Ga0070663_100063708 3300005455 Bacteria 2663
96 Ga0070663_100770920 3300005455 Bacteria 823
97 Ga0070678_100040855 3300005456 Bacteria 3284
98 Ga0070678_100165462 3300005456 Bacteria 1796
99 Ga0070662_100001246 3300005457 Bacteria 15625
100 Ga0070662_100001439 3300005457 Bacteria 14660
101 Ga0070662_100003210 3300005457 Bacteria 10163
102 Ga0070662_100007707 3300005457 Bacteria 6987
103 Ga0070662_100018517 3300005457 Bacteria 4712
104 Ga0070662_100109329 3300005457 Bacteria 2104
105 Ga0070662_100862266 3300005457 Bacteria 771
106 Ga0068867_100154687 3300005459 Bacteria 1804
107 Ga0070685_10759879 3300005466 Bacteria 711
108 Ga0070679_100211094 3300005530 Bacteria 1905
109 Ga0070684_100989450 3300005535 Bacteria 789
110 Ga0068853_100004667 3300005539 Bacteria 10623
111 Ga0068853_100067399 3300005539 Bacteria 3110
112 Ga0068853_100431661 3300005539 Bacteria 1237
113 Ga0068853_100480797 3300005539 Bacteria 1171
114 Ga0070672_100001644 3300005543 Bacteria 13918
115 Ga0070672_100012803 3300005543 Bacteria 5906
116 Ga0070672_100097586 3300005543 Bacteria 2379
117 Ga0070686_100008017 3300005544 Bacteria 5903
118 Ga0070693_100273675 3300005547 Bacteria 1128
119 Ga0070665_100002886 3300005548 Bacteria 18572
120 Ga0070665_101005447 3300005548 Bacteria 846
121 Ga0068855_100451650 3300005563 Bacteria 1402
122 Ga0068855_100572682 3300005563 Bacteria 1220
123 Ga0068855_100642406 3300005563 Bacteria 1140
124 Ga0068855_100903964 3300005563 Bacteria 932
125 Ga0070664_100004638 3300005564 Bacteria 11035
126 Ga0070664_100024252 3300005564 Bacteria 5016
127 Ga0070664_100055243 3300005564 Bacteria 3370
128 Ga0070664_100126489 3300005564 Bacteria 2242
129 Ga0070664_100277295 3300005564 Bacteria 1511
130 Ga0068857_100010833 3300005577 Bacteria 7939
131 Ga0068857_100047147 3300005577 Bacteria 3825
132 Ga0068857_100208455 3300005577 Bacteria 1783
133 Ga0068854_100000334 3300005578 Bacteria 30834
134 Ga0068854_100020970 3300005578 Bacteria 4428
135 Ga0068854_100056441 3300005578 Bacteria 2830
136 Ga0068854_100392135 3300005578 Bacteria 1147
137 Ga0068854_100406344 3300005578 Bacteria 1128
138 Ga0068852_100001072 3300005616 Bacteria 18069
139 Ga0068852_100028203 3300005616 Bacteria 4590
140 Ga0068852_100266476 3300005616 Bacteria 1647
141 Ga0068852_100391942 3300005616 Bacteria 1364
142 Ga0068852_100530991 3300005616 Bacteria 1175
143 Ga0068852_101012207 3300005616 Bacteria 850
144 Ga0068859_100000377 3300005617 Bacteria 44438
145 Ga0068859_100016908 3300005617 Bacteria 7322
146 Ga0068859_100099693 3300005617 Bacteria 2960
147 Ga0068859_100157669 3300005617 Bacteria 2348
148 Ga0068859_100960594 3300005617 Bacteria 937
149 Ga0068864_100000074 3300005618 Bacteria 109458
150 Ga0068864_100006328 3300005618 Bacteria 9710
151 Ga0068864_100008279 3300005618 Bacteria 8577
152 Ga0068864_100071812 3300005618 Bacteria 3015
153 Ga0068864_100112080 3300005618 Bacteria 2431
154 Ga0068861_100409769 3300005719 Bacteria 1205
155 Ga0068851_10090118 3300005834 Bacteria 1613
156 Ga0068851_10292740 3300005834 Bacteria 934
157 Ga0068851_10736228 3300005834 Bacteria 609
158 Ga0068863_100000887 3300005841 Bacteria 30122
159 Ga0068863_100007439 3300005841 Bacteria 10717
160 Ga0068863_100007887 3300005841 Bacteria 10414
161 Ga0068863_100714491 3300005841 Bacteria 996
162 Ga0068858_100003534 3300005842 Bacteria 15479
163 Ga0068858_100003796 3300005842 Bacteria 14940
164 Ga0068858_100008153 3300005842 Bacteria 10069
165 Ga0068858_100178461 3300005842 Bacteria 2005
166 Ga0068858_100203941 3300005842 Bacteria 1871
167 Ga0068860_100001585 3300005843 Bacteria 24476
168 Ga0068860_100008637 3300005843 Bacteria 10152
169 Ga0068860_100114405 3300005843 Bacteria 2580
170 Ga0068860_100117583 3300005843 Bacteria 2544
171 Ga0068862_100035335 3300005844 Bacteria 4232
172 Ga0068862_100043504 3300005844 Bacteria 3830
173 Ga0068862_100110345 3300005844 Bacteria 2414
174 Ga0068862_100131235 3300005844 Bacteria 2216
175 Ga0068862_100369060 3300005844 Bacteria 1335
176 Ga0068862_101178552 3300005844 Bacteria 764
177 Ga0097621_100005924 3300006237 Bacteria 8639
178 Ga0097621_100146324 3300006237 Bacteria 2023
179 Ga0097621_100571759 3300006237 Bacteria 1030
180 Ga0068871_100234764 3300006358 Bacteria 1593
181 Ga0068871_100308670 3300006358 Bacteria 1390
182 Ga0068865_100214151 3300006881 Bacteria 1503
183 Ga0068865_100706214 3300006881 Bacteria 862
184 Ga0097620_100000377 3300006931 Bacteria 44438
185 Ga0097620_100016909 3300006931 Bacteria 7322
186 Ga0097620_100099689 3300006931 Bacteria 2960
187 Ga0097620_100157660 3300006931 Bacteria 2348
188 Ga0097620_100960564 3300006931 Bacteria 937
189 Ga0105251_10122200 3300009011 Bacteria 1182
190 Ga0105240_10008099 3300009093 Bacteria 15093
191 Ga0105240_10098562 3300009093 Bacteria 3559
192 Ga0105240_10267544 3300009093 Bacteria 1969
193 Ga0105240_10300764 3300009093 Bacteria 1835
194 Ga0105245_10002347 3300009098 Bacteria 17117
195 Ga0105243_10411516 3300009148 Bacteria 1259
196 Ga0105243_10708098 3300009148 Bacteria 982
197 Ga0105241_10043853 3300009174 Bacteria 3388
198 Ga0105241_10631779 3300009174 Bacteria 971
199 Ga0105242_10493663 3300009176 Bacteria 1163
200 Ga0105242_12032593 3300009176 Bacteria 617
201 Ga0105248_10000071 3300009177 Bacteria 118281
202 Ga0105248_10000268 3300009177 Bacteria 61070
203 Ga0105248_10002245 3300009177 Bacteria 21383
204 Ga0105248_10003138 3300009177 Bacteria 18284
205 Ga0105248_10003624 3300009177 Bacteria 17137
206 Ga0105248_10020222 3300009177 Bacteria 7374
207 Ga0105248_11071219 3300009177 Bacteria 911
208 Ga0105238_10112662 3300009551 Bacteria 2700
209 Ga0105238_10623051 3300009551 Bacteria 1088
210 Ga0105249_10196393 3300009553 Bacteria 1972
211 Ga0105239_10137250 3300010375 Bacteria 2723
212 Ga0157315_1051510 3300012508 Bacteria 554
213 Ga0157373_10078699 3300013100 Bacteria 2325
214 Ga0157373_10079845 3300013100 Bacteria 2307
215 Ga0157373_10102090 3300013100 Bacteria 2018
216 Ga0157373_10187149 3300013100 Bacteria 1459
217 Ga0157371_10000867 3300013102 Bacteria 34332
218 Ga0157371_10033139 3300013102 Bacteria 3713
219 Ga0157371_10131647 3300013102 Bacteria 1780
220 Ga0157371_10292786 3300013102 Bacteria 1177
221 Ga0157370_10034625 3300013104 Bacteria 4915
222 Ga0157370_10666620 3300013104 Bacteria 950
223 Ga0157369_10000298 3300013105 Bacteria 66393
224 Ga0157369_10014983 3300013105 Bacteria 8751
225 Ga0157369_10117618 3300013105 Bacteria 2821
226 Ga0157374_10065892 3300013296 Bacteria 3403
227 Ga0157374_10072915 3300013296 Bacteria 3240
228 Ga0157374_10343064 3300013296 Bacteria 1483
229 Ga0157378_10150614 3300013297 Bacteria 2167
230 Ga0157378_10166858 3300013297 Bacteria 2063
231 Ga0157378_10642401 3300013297 Bacteria 1076
232 Ga0163162_10421611 3300013306 Bacteria 1467
233 Ga0163162_10524248 3300013306 Bacteria 1314
234 Ga0163162_10667118 3300013306 Bacteria 1163
235 Ga0163162_10691809 3300013306 Bacteria 1142
236 Ga0163162_10795134 3300013306 Bacteria 1063
237 Ga0157372_10146967 3300013307 Bacteria 2718
238 Ga0157372_10189843 3300013307 Bacteria 2380
239 Ga0157375_10104424 3300013308 Bacteria 2922
240 Ga0157375_10133983 3300013308 Bacteria 2599
241 Ga0157375_10499304 3300013308 Bacteria 1381
242 Ga0157375_10655380 3300013308 Bacteria 1206
243 Ga0163163_10000219 3300014325 Bacteria 59481
244 Ga0163163_10032124 3300014325 Bacteria 5071
245 Ga0163163_10522218 3300014325 Bacteria 1250
246 Ga0157380_11598218 3300014326 Bacteria 707
247 Ga0157379_10001730 3300014968 Bacteria 18065
248 Ga0157379_11334728 3300014968 Bacteria 693
249 Ga0157379_11565274 3300014968 Bacteria 643
250 Ga0163161_10094721 3300017792 Bacteria 2214
251 Ga0163161_10823597 3300017792 Bacteria 782
252 Ga0207697_10133848 3300025315 Bacteria 1072
253 Ga0207656_10080598 3300025321 Bacteria 1462
254 Ga0207656_10259336 3300025321 Bacteria 853
255 Ga0207682_10002976 3300025893 Bacteria 7434
256 Ga0207688_10119830 3300025901 Bacteria 1535
257 Ga0207680_10074654 3300025903 Bacteria 2112
258 Ga0207680_10357290 3300025903 Bacteria 1027
259 Ga0207680_10446184 3300025903 Bacteria 918
260 Ga0207647_10002939 3300025904 Bacteria 12824
261 Ga0207647_10020274 3300025904 Bacteria 4459
262 Ga0207647_10026341 3300025904 Bacteria 3806
263 Ga0207647_10046968 3300025904 Bacteria 2687
264 Ga0207647_10150032 3300025904 Bacteria 1363
265 Ga0207647_10174148 3300025904 Unclassified 1252
266 Ga0207645_10004867 3300025907 Bacteria 9849
267 Ga0207645_10044351 3300025907 Bacteria 2846
268 Ga0207645_10977966 3300025907 Bacteria 574
269 Ga0207705_10000070 3300025909 Bacteria 130733
270 Ga0207705_10046559 3300025909 Bacteria 3117
271 Ga0207705_10062537 3300025909 Bacteria 2689
272 Ga0207705_10148670 3300025909 Bacteria 1754
273 Ga0207654_10033771 3300025911 Bacteria 2838
274 Ga0207695_10011780 3300025913 Bacteria 10560
275 Ga0207695_10015034 3300025913 Bacteria 9133
276 Ga0207695_10082120 3300025913 Bacteria 3260
277 Ga0207657_10014072 3300025919 Bacteria 7828
278 Ga0207657_10030981 3300025919 Bacteria 4849
279 Ga0207657_10387675 3300025919 Bacteria 1100
280 Ga0207649_10000816 3300025920 Bacteria 20025
281 Ga0207649_10036981 3300025920 Bacteria 2945
282 Ga0207649_10042328 3300025920 Bacteria 2778
283 Ga0207649_10042888 3300025920 Bacteria 2762
284 Ga0207681_10038332 3300025923 Bacteria 3175
285 Ga0207681_10046614 3300025923 Bacteria 2916
286 Ga0207681_10176987 3300025923 Bacteria 1622
287 Ga0207681_10235535 3300025923 Bacteria 1423
288 Ga0207694_10036679 3300025924 Bacteria 3763
289 Ga0207650_10027429 3300025925 Bacteria 4077
290 Ga0207650_10028803 3300025925 Bacteria 3985
291 Ga0207650_10100644 3300025925 Bacteria 2224
292 Ga0207650_10200526 3300025925 Bacteria 1598
293 Ga0207650_10258436 3300025925 Bacteria 1412
294 Ga0207650_10268366 3300025925 Bacteria 1386
295 Ga0207650_10465970 3300025925 Bacteria 1053
296 Ga0207659_10006496 3300025926 Bacteria 7166
297 Ga0207659_10168394 3300025926 Bacteria 1726
298 Ga0207659_10293770 3300025926 Bacteria 1332
299 Ga0207659_10622559 3300025926 Bacteria 921
300 Ga0207687_10027837 3300025927 Bacteria 3794
301 Ga0207644_10001850 3300025931 Bacteria 13771
302 Ga0207644_10012706 3300025931 Bacteria 5598
303 Ga0207644_10014933 3300025931 Bacteria 5207
304 Ga0207644_10017372 3300025931 Bacteria 4857
305 Ga0207644_10160822 3300025931 Bacteria 1745
306 Ga0207690_10016994 3300025932 Bacteria 4436
307 Ga0207690_10078948 3300025932 Bacteria 2292
308 Ga0207690_10101506 3300025932 Bacteria 2055
309 Ga0207690_10149356 3300025932 Bacteria 1731
310 Ga0207690_10293706 3300025932 Bacteria 1269
311 Ga0207690_10406543 3300025932 Bacteria 1086
312 Ga0207706_10002227 3300025933 Bacteria 18932
313 Ga0207706_10004069 3300025933 Bacteria 13822
314 Ga0207706_10027529 3300025933 Bacteria 5082
315 Ga0207706_10027660 3300025933 Bacteria 5070
316 Ga0207706_10033378 3300025933 Bacteria 4582
317 Ga0207706_10034743 3300025933 Bacteria 4486
318 Ga0207706_10039836 3300025933 Bacteria 4166
319 Ga0207706_10121902 3300025933 Bacteria 2293
320 Ga0207706_10338918 3300025933 Bacteria 1308
321 Ga0207706_10495613 3300025933 Bacteria 1055
322 Ga0207686_10469579 3300025934 Bacteria 971
323 Ga0207709_10336050 3300025935 Bacteria 1135
324 Ga0207670_10085406 3300025936 Bacteria 2218
325 Ga0207670_10087665 3300025936 Bacteria 2193
326 Ga0207670_10821504 3300025936 Bacteria 775
327 Ga0207669_10024485 3300025937 Bacteria 3245
328 Ga0207669_10638982 3300025937 Bacteria 869
329 Ga0207704_10014745 3300025938 Bacteria 3958
330 Ga0207704_10238480 3300025938 Bacteria 1357
331 Ga0207704_10385835 3300025938 Bacteria 1101
332 Ga0207691_10001285 3300025940 Bacteria 25027
333 Ga0207691_10048439 3300025940 Bacteria 3896
334 Ga0207711_10000333 3300025941 Bacteria 50088
335 Ga0207711_10000450 3300025941 Bacteria 42929
336 Ga0207711_10000999 3300025941 Bacteria 27105
337 Ga0207711_10001758 3300025941 Bacteria 19856
338 Ga0207711_10019305 3300025941 Bacteria 5677
339 Ga0207711_10037411 3300025941 Bacteria 4122
340 Ga0207689_10363956 3300025942 Bacteria 1203
341 Ga0207679_10115156 3300025945 Bacteria 2129
342 Ga0207679_10184968 3300025945 Bacteria 1727
343 Ga0207679_10321886 3300025945 Bacteria 1339
344 Ga0207679_10485651 3300025945 Bacteria 1100
345 Ga0207667_10162795 3300025949 Bacteria 2294
346 Ga0207667_10277377 3300025949 Bacteria 1713
347 Ga0207667_10281897 3300025949 Bacteria 1698
348 Ga0207667_10475364 3300025949 Bacteria 1269
349 Ga0207651_10004576 3300025960 Bacteria 7002
350 Ga0207651_10013579 3300025960 Bacteria 4667
351 Ga0207651_10069150 3300025960 Bacteria 2492
352 Ga0207651_10085712 3300025960 Bacteria 2286
353 Ga0207651_10137652 3300025960 Bacteria 1881
354 Ga0207712_10155406 3300025961 Bacteria 1771
355 Ga0207712_10622951 3300025961 Bacteria 935
356 Ga0207668_10122667 3300025972 Bacteria 1970
357 Ga0207668_10255571 3300025972 Bacteria 1425
358 Ga0207668_10409508 3300025972 Bacteria 1148
359 Ga0207668_10732742 3300025972 Bacteria 871
360 Ga0207668_11894195 3300025972 Bacteria 538
361 Ga0207640_10000344 3300025981 Bacteria 30468
362 Ga0207640_10006924 3300025981 Bacteria 6237
363 Ga0207640_10011746 3300025981 Bacteria 4967
364 Ga0207640_10181931 3300025981 Bacteria 1577
365 Ga0207640_10414502 3300025981 Bacteria 1100
366 Ga0207640_10666003 3300025981 Bacteria 888
367 Ga0207658_10000634 3300025986 Bacteria 30862
368 Ga0207658_10004146 3300025986 Bacteria 10101
369 Ga0207658_10013250 3300025986 Bacteria 5631
370 Ga0207658_10021255 3300025986 Bacteria 4502
371 Ga0207658_10043370 3300025986 Bacteria 3269
372 Ga0207658_10120327 3300025986 Bacteria 2092
373 Ga0207658_10141709 3300025986 Bacteria 1946
374 Ga0207658_10182504 3300025986 Bacteria 1738
375 Ga0207658_10190620 3300025986 Bacteria 1704
376 Ga0207658_10749669 3300025986 Bacteria 884
377 Ga0207677_10000665 3300026023 Bacteria 20426
378 Ga0207677_10039450 3300026023 Bacteria 3105
379 Ga0207677_11539490 3300026023 Bacteria 615
380 Ga0207703_10002818 3300026035 Bacteria 14828
381 Ga0207703_10011564 3300026035 Bacteria 6863
382 Ga0207703_10138144 3300026035 Bacteria 2112
383 Ga0207703_10188919 3300026035 Bacteria 1823
384 Ga0207703_10900027 3300026035 Bacteria 847
385 Ga0207639_10011224 3300026041 Bacteria 6215
386 Ga0207639_10407396 3300026041 Bacteria 1226
387 Ga0207678_10007626 3300026067 Bacteria 9559
388 Ga0207678_10026409 3300026067 Bacteria 5065
389 Ga0207678_10068571 3300026067 Bacteria 3043
390 Ga0207678_10199758 3300026067 Bacteria 1709
391 Ga0207678_10684427 3300026067 Bacteria 902
392 Ga0207678_11191027 3300026067 Bacteria 674
393 Ga0207702_10016214 3300026078 Bacteria 6167
394 Ga0207702_10083918 3300026078 Bacteria 2773
395 Ga0207641_10000188 3300026088 Bacteria 86532
396 Ga0207641_10063317 3300026088 Bacteria 3159
397 Ga0207648_10019688 3300026089 Bacteria 6089
398 Ga0207676_10000438 3300026095 Bacteria 35161
399 Ga0207676_10012470 3300026095 Bacteria 6092
400 Ga0207676_10031484 3300026095 Bacteria 3990
401 Ga0207676_10199326 3300026095 Bacteria 1767
402 Ga0207676_10367353 3300026095 Bacteria 1335
403 Ga0207676_10423006 3300026095 Bacteria 1250
404 Ga0207676_11054992 3300026095 Bacteria 802
405 Ga0207674_10003595 3300026116 Bacteria 18906
406 Ga0207674_10028779 3300026116 Bacteria 5859
407 Ga0207675_100130020 3300026118 Bacteria 2387
408 Ga0207683_10009090 3300026121 Bacteria 8469
409 Ga0207683_10195975 3300026121 Bacteria 1835
410 Ga0207683_10394365 3300026121 Bacteria 1273
411 Ga0207698_10007920 3300026142 Bacteria 6692
412 Ga0207698_10029979 3300026142 Bacteria 3905
413 Ga0207698_10033317 3300026142 Bacteria 3743
414 Ga0207698_10095945 3300026142 Bacteria 2443
415 Ga0207698_10718713 3300026142 Bacteria 995
416 Ga0268266_10049998 3300028379 Bacteria 3586
417 Ga0268266_10205249 3300028379 Bacteria 1805
418 Ga0268266_11413458 3300028379 Bacteria 671
419 Ga0268265_10088734 3300028380 Bacteria 2464
420 Ga0268265_10108107 3300028380 Bacteria 2263
421 Ga0268265_10112327 3300028380 Bacteria 2227
422 Ga0268265_10313944 3300028380 Bacteria 1416
423 Ga0268265_10373472 3300028380 Bacteria 1309
424 Ga0268265_11462575 3300028380 Bacteria 686
425 Ga0268265_11785801 3300028380 Bacteria 621
426 Ga0268264_10001006 3300028381 Bacteria 28608
427 Ga0268264_10045042 3300028381 Bacteria 3662
428 Ga0268264_10787235 3300028381 Bacteria 949
429 Ga0268264_11034695 3300028381 Bacteria 828
430 Ga0316177_1138970 3300030731 Bacteria 661
431 Ga0314311_1097860 3300030733 Bacteria 782
432 Ga0316178_1006155 3300030735 Bacteria 699
433 Ga0316183_1064884 3300030742 Bacteria 2576
434 Ga0316182_1085336 3300030745 Bacteria 1968
435 Ga0307408_100058079 3300031548 Bacteria 2811
436 Ga0307408_100126627 3300031548 Bacteria 1987
437 Ga0307408_100243144 3300031548 Bacteria 1480
438 Ga0307408_101036375 3300031548 Bacteria 758
439 Ga0307405_10042024 3300031731 Bacteria 2780
440 Ga0307405_10046226 3300031731 Bacteria 2673
441 Ga0307405_10153746 3300031731 Bacteria 1621
442 Ga0307405_10220893 3300031731 Bacteria 1390
443 Ga0307405_10817250 3300031731 Bacteria 782
444 Ga0307405_11170535 3300031731 Bacteria 664
445 Ga0307413_10003858 3300031824 Bacteria 6402
446 Ga0307413_10017016 3300031824 Bacteria 3776
447 Ga0307413_10072983 3300031824 Bacteria 2168
448 Ga0307413_10183499 3300031824 Bacteria 1494
449 Ga0307413_10229273 3300031824 Bacteria 1363
450 Ga0307413_10317787 3300031824 Bacteria 1188
451 Ga0307413_10619106 3300031824 Bacteria 888
452 Ga0307413_10784119 3300031824 Bacteria 799
453 Ga0307413_11799995 3300031824 Bacteria 548
454 Ga0307410_10002293 3300031852 Bacteria 9183
455 Ga0307410_10002603 3300031852 Bacteria 8771
456 Ga0307410_10006803 3300031852 Bacteria 6205
457 Ga0307410_10120052 3300031852 Bacteria 1916
458 Ga0307410_10243625 3300031852 Bacteria 1394
459 Ga0307410_10363554 3300031852 Bacteria 1159
460 Ga0307410_10369189 3300031852 Bacteria 1151
461 Ga0307410_10386284 3300031852 Bacteria 1127
462 Ga0307410_10419542 3300031852 Bacteria 1085
463 Ga0307410_10820975 3300031852 Bacteria 792
464 Ga0307410_11024028 3300031852 Bacteria 713
465 Ga0307406_10056479 3300031901 Bacteria 2514
466 Ga0307406_10071050 3300031901 Bacteria 2280
467 Ga0307406_10161426 3300031901 Bacteria 1611
468 Ga0307406_11185744 3300031901 Unclassified 662
469 Ga0307407_10003942 3300031903 Bacteria 6196
470 Ga0307407_10047567 3300031903 Bacteria 2435
471 Ga0307407_10091571 3300031903 Bacteria 1865
472 Ga0307407_10157079 3300031903 Bacteria 1484
473 Ga0307407_10168670 3300031903 Bacteria 1440
474 Ga0307407_10350330 3300031903 Bacteria 1045
475 Ga0307407_10639436 3300031903 Bacteria 796
476 Ga0307412_10003002 3300031911 Bacteria 9337
477 Ga0307412_10109903 3300031911 Bacteria 1966
478 Ga0307412_10137325 3300031911 Bacteria 1785
479 Ga0307412_10205116 3300031911 Bacteria 1500
480 Ga0307412_10327603 3300031911 Bacteria 1221
481 Ga0307412_10766321 3300031911 Bacteria 834
482 Ga0307412_10784467 3300031911 Bacteria 826
483 Ga0307412_11267911 3300031911 Bacteria 662
484 Ga0307409_100011689 3300031995 Bacteria 5550
485 Ga0307409_100014063 3300031995 Bacteria 5185
486 Ga0307409_100044437 3300031995 Bacteria 3346
487 Ga0307409_100051090 3300031995 Bacteria 3161
488 Ga0307409_100118636 3300031995 Bacteria 2235
489 Ga0307409_100170889 3300031995 Bacteria 1913
490 Ga0307409_100209557 3300031995 Bacteria 1750
491 Ga0307409_100215190 3300031995 Bacteria 1730
492 Ga0307409_100273898 3300031995 Bacteria 1556
493 Ga0307409_100416053 3300031995 Bacteria 1288
494 Ga0307409_100492948 3300031995 Bacteria 1191
495 Ga0307409_100618780 3300031995 Bacteria 1072
496 Ga0307409_101039473 3300031995 Bacteria 838
497 Ga0307409_101474150 3300031995 Bacteria 707
498 Ga0307416_100001561 3300032002 Bacteria 12546
499 Ga0307416_100028750 3300032002 Bacteria 4140
500 Ga0307416_100047549 3300032002 Bacteria 3397
501 Ga0307416_100066775 3300032002 Bacteria 2963
502 Ga0307416_100097629 3300032002 Bacteria 2545
503 Ga0307416_100412015 3300032002 Bacteria 1392
504 Ga0307416_100446649 3300032002 Bacteria 1344
505 Ga0307416_100717627 3300032002 Bacteria 1090
506 Ga0307416_100949346 3300032002 Bacteria 962
507 Ga0307416_101340356 3300032002 Unclassified 821
508 Ga0307416_101811205 3300032002 Bacteria 714
509 Ga0307414_10003633 3300032004 Bacteria 8262
510 Ga0307414_10020007 3300032004 Bacteria 4162
511 Ga0307414_10032939 3300032004 Bacteria 3418
512 Ga0307414_10127738 3300032004 Bacteria 1967
513 Ga0307414_10132221 3300032004 Bacteria 1939
514 Ga0307414_10248733 3300032004 Bacteria 1476
515 Ga0307414_10512465 3300032004 Bacteria 1063
516 Ga0307411_10000438 3300032005 Bacteria 14246
517 Ga0307411_10007089 3300032005 Bacteria 5674
518 Ga0307411_10007464 3300032005 Bacteria 5572
519 Ga0307411_10084978 3300032005 Bacteria 2190
520 Ga0307411_10197689 3300032005 Bacteria 1541
521 Ga0307411_10396596 3300032005 Bacteria 1139
522 Ga0307411_10474978 3300032005 Bacteria 1051
523 Ga0307411_10576952 3300032005 Bacteria 963
524 Ga0307411_10626872 3300032005 Bacteria 928
525 Ga0307411_10668027 3300032005 Bacteria 901
526 Ga0307411_10958501 3300032005 Bacteria 763
527 Ga0307411_11107251 3300032005 Bacteria 714
528 Ga0307411_11414380 3300032005 Unclassified 637
529 Ga0307415_100002360 3300032126 Bacteria 9391
530 Ga0307415_100071842 3300032126 Bacteria 2435
531 Ga0307415_100208059 3300032126 Bacteria 1558
532 Ga0307415_100249727 3300032126 Bacteria 1441
533 Ga0307415_100351760 3300032126 Bacteria 1240
534 Ga0373937_0383897 3300036401 Bacteria 1332
535 Ga0395899_0017106 3300037312 Bacteria 5524
536 Ga0395899_0331177 3300037312 Bacteria 1023
537 Ga0395900_0017641 3300037418 Bacteria 7284
538 Ga0395900_0052306 3300037418 Bacteria 4205
539 Ga0395900_0066666 3300037418 Bacteria 3699
540 Ga0395900_0098924 3300037418 Bacteria 2997
541 Ga0395900_0156051 3300037418 Bacteria 2331
542 Ga0395900_0281003 3300037418 Bacteria 1656
543 Ga0395900_0959463 3300037418 Bacteria 776
544 Ga0395898_0025005 3300037466 Bacteria 6020
545 Ga0395898_0178403 3300037466 Bacteria 2030
546 Ga0395898_0305478 3300037466 Bacteria 1518
547 Ga0395898_0841369 3300037466 Bacteria 857
548 Ga0395898_1840270 3300037466 Bacteria 526
549 Ga0395905_0044209 3300037471 Bacteria 4180
550 Ga0395905_0047505 3300037471 Bacteria 4023
551 Ga0395905_0237537 3300037471 Bacteria 1703
552 Ga0395905_0327304 3300037471 Bacteria 1422
553 Ga0395905_0618658 3300037471 Bacteria 985
554 Ga0395901_0011159 3300038443 Bacteria 9104
555 Ga0395901_0289185 3300038443 Bacteria 1701
556 Ga0395901_0567351 3300038443 Bacteria 1148
557 Ga0451807_0199346 3300041486 Bacteria 2232
558 Ga0451835_0385350 3300041492 Bacteria 1182
559 Ga0439449_0098457 3300042007 Bacteria 1080
560 Ga0466963_0045087 3300044694 Bacteria 2903
561 Ga0466964_0057432 3300044706 Bacteria 1611
562 Ga0466967_0327207 3300045976 Bacteria 1479
563 Ga0466967_0514041 3300045976 Bacteria 1176
564 Ga0495663_0119075 3300046525 Bacteria 883
565 Ga0495668_0006757 3300046616 Bacteria 7457
566 Ga0495588_0372527 3300046674 Bacteria 750
567 Ga0495669_0035507 3300046684 Bacteria 2201
568 Ga0495669_0065399 3300046684 Bacteria 1651
569 Ga0495669_0070901 3300046684 Bacteria 1588
570 Ga0495683_0181188 3300047323 Bacteria 962
571 Ga0496101_0041000 3300048904 Bacteria 3299
572 Ga0496102_0104521 3300048905 Bacteria 2634
573 Ga0496103_0518568 3300048906 Bacteria 762
574 Ga0496107_0361330 3300048910 Bacteria 1080
575 Ga0496108_0020259 3300048911 Bacteria 5465
576 Ga0496108_0047621 3300048911 Bacteria 3584
577 Ga0496108_1142395 3300048911 Bacteria 660
578 Ga0496109_0156413 3300048912 Bacteria 2135
579 Ga0496109_1120647 3300048912 Bacteria 724
580 Ga0496110_0006432 3300048913 Bacteria 9303
581 Ga0496110_0209380 3300048913 Bacteria 1772
582 Ga0496111_0025608 3300048914 Bacteria 4163
583 Ga0496111_0274078 3300048914 Bacteria 1251
584 Ga0496111_0727214 3300048914 Bacteria 721
585 Ga0496112_0119331 3300048915 Bacteria 2607
586 Ga0496112_1570162 3300048915 Bacteria 571
587 Ga0496114_0009772 3300048917 Bacteria 7621
588 Ga0501069_0243225 3300049585 Bacteria 1049
589 Ga0501071_0700513 3300049587 Bacteria 780
590 Ga0501227_088768 3300049665 Bacteria 815
591 Ga0501239_037656 3300049672 Bacteria 658
592 Ga0501267_028848 3300049764 Bacteria 645
593 Ga0501268_122161 3300049765 Bacteria 578
594 Ga0500658_0000963 3300053134 Bacteria 11749
595 Ga0466962_0180437 3300061719 Bacteria 1029
596 2885428241 2885427238 Bacteria 2291351
597 Ga0068861_100413864
598 MBSR1b_contig_9705856
599 JGI24739J22299_10000218
600 JGI24737J22298_10001076
601 JGI24748J21848_1018694
602 JGI24738J21930_10000923
603 JGI24034J26672_10010046
604 JGI24034J26672_10060621
605 Ga0065712_10047667
606 Ga0065715_10107215
607 Ga0065715_10195841
608 Ga0070658_10076626
609 Ga0070658_10087145
610 Ga0070658_10092445
611 Ga0070658_11057996
612 Ga0070683_100242098
613 Ga0070690_100009606
614 Ga0070670_100000600
615 Ga0070670_100082684
616 Ga0070670_100084867
617 Ga0070670_100161352
618 Ga0070670_100223884
619 Ga0070670_100261891
620 Ga0070670_100641795
621 Ga0070677_10000735
622 Ga0068869_100025580
623 Ga0070666_10000731
624 Ga0070666_10004646
625 Ga0070666_10006870
626 Ga0070666_10049326
627 Ga0070666_10426083
628 Ga0068868_100002334
629 Ga0068868_100008603
630 Ga0070660_100005952
631 Ga0070660_100150517
632 Ga0070660_100437784
633 Ga0070689_100071123
634 Ga0070689_100103921
635 Ga0070661_100024235
636 Ga0070661_100115994
637 Ga0070661_100144635
638 Ga0070661_100228128
639 Ga0070661_100254758
640 Ga0070692_10105896
641 Ga0070692_10210669
642 Ga0070668_100010572
643 Ga0070668_100252244
644 Ga0070668_100365151
645 Ga0070668_100617548
646 Ga0070668_101697458
647 Ga0070669_100046775
648 Ga0070669_100231701
649 Ga0070669_100258269
650 Ga0070669_100483375
651 Ga0070675_100007982
652 Ga0070675_100009299
653 Ga0070675_100029253
654 Ga0070675_100201119
655 Ga0070675_100277498
656 Ga0070671_100000190
657 Ga0070671_100022674
658 Ga0070671_100038838
659 Ga0070671_100177804
660 Ga0070671_100525222
661 Ga0070674_100027796
662 Ga0070674_100038592
663 Ga0070674_100082966
664 Ga0070674_100169129
665 Ga0070674_101168194
666 Ga0070673_100003726
667 Ga0070673_100005750
668 Ga0070673_100007428
669 Ga0070673_100007601
670 Ga0070673_100040011
671 Ga0070673_100405584
672 Ga0070688_100207246
673 Ga0070659_100011923
674 Ga0070659_100016545
675 Ga0070659_100062773
676 Ga0070659_100069696
677 Ga0070659_100098728
678 Ga0070659_100366747
679 Ga0070659_100759079
680 Ga0070667_100001536
681 Ga0070667_100003165
682 Ga0070667_100007076
683 Ga0070667_100008296
684 Ga0070667_100012023
685 Ga0070667_100018727
686 Ga0070667_100060546
687 Ga0070667_100116502
688 Ga0070667_100306389
689 Ga0070667_101198628
690 Ga0070705_100389785
691 Ga0070663_100063708
692 Ga0070663_100770920
693 Ga0070678_100040855
694 Ga0070678_100165462
695 Ga0070662_100001246
696 Ga0070662_100001439
697 Ga0070662_100003210
698 Ga0070662_100007707
699 Ga0070662_100018517
700 Ga0070662_100109329
701 Ga0070662_100862266
702 Ga0068867_100154687
703 Ga0070685_10759879
704 Ga0070679_100211094
705 Ga0070684_100989450
706 Ga0068853_100004667
707 Ga0068853_100067399
708 Ga0068853_100431661
709 Ga0068853_100480797
710 Ga0070672_100001644
711 Ga0070672_100012803
712 Ga0070672_100097586
713 Ga0070686_100008017
714 Ga0070693_100273675
715 Ga0070665_100002886
716 Ga0070665_101005447
717 Ga0068855_100451650
718 Ga0068855_100572682
719 Ga0068855_100642406
720 Ga0068855_100903964
721 Ga0070664_100004638
722 Ga0070664_100024252
723 Ga0070664_100055243
724 Ga0070664_100126489
725 Ga0070664_100277295
726 Ga0068857_100010833
727 Ga0068857_100047147
728 Ga0068857_100208455
729 Ga0068854_100000334
730 Ga0068854_100020970
731 Ga0068854_100056441
732 Ga0068854_100392135
733 Ga0068854_100406344
734 Ga0068852_100001072
735 Ga0068852_100028203
736 Ga0068852_100266476
737 Ga0068852_100391942
738 Ga0068852_100530991
739 Ga0068852_101012207
740 Ga0068859_100000377
741 Ga0068859_100016908
742 Ga0068859_100099693
743 Ga0068859_100157669
744 Ga0068859_100960594
745 Ga0068864_100000074
746 Ga0068864_100006328
747 Ga0068864_100008279
748 Ga0068864_100071812
749 Ga0068864_100112080
750 Ga0068861_100409769
751 Ga0068851_10090118
752 Ga0068851_10292740
753 Ga0068851_10736228
754 Ga0068863_100000887
755 Ga0068863_100007439
756 Ga0068863_100007887
757 Ga0068863_100714491
758 Ga0068858_100003534
759 Ga0068858_100003796
760 Ga0068858_100008153
761 Ga0068858_100178461
762 Ga0068858_100203941
763 Ga0068860_100001585
764 Ga0068860_100008637
765 Ga0068860_100114405
766 Ga0068860_100117583
767 Ga0068862_100035335
768 Ga0068862_100043504
769 Ga0068862_100110345
770 Ga0068862_100131235
771 Ga0068862_100369060
772 Ga0068862_101178552
773 Ga0097621_100005924
774 Ga0097621_100146324
775 Ga0097621_100571759
776 Ga0068871_100234764
777 Ga0068871_100308670
778 Ga0068865_100214151
779 Ga0068865_100706214
780 Ga0097620_100000377
781 Ga0097620_100016909
782 Ga0097620_100099689
783 Ga0097620_100157660
784 Ga0097620_100960564
785 Ga0105251_10122200
786 Ga0105240_10008099
787 Ga0105240_10098562
788 Ga0105240_10267544
789 Ga0105240_10300764
790 Ga0105245_10002347
791 Ga0105243_10411516
792 Ga0105243_10708098
793 Ga0105241_10043853
794 Ga0105241_10631779
795 Ga0105242_10493663
796 Ga0105242_12032593
797 Ga0105248_10000071
798 Ga0105248_10000268
799 Ga0105248_10002245
800 Ga0105248_10003138
801 Ga0105248_10003624
802 Ga0105248_10020222
803 Ga0105248_11071219
804 Ga0105238_10112662
805 Ga0105238_10623051
806 Ga0105249_10196393
807 Ga0105239_10137250
808 Ga0157315_1051510
809 Ga0157373_10078699
810 Ga0157373_10079845
811 Ga0157373_10102090
812 Ga0157373_10187149
813 Ga0157371_10000867
814 Ga0157371_10033139
815 Ga0157371_10131647
816 Ga0157371_10292786
817 Ga0157370_10034625
818 Ga0157370_10666620
819 Ga0157369_10000298
820 Ga0157369_10014983
821 Ga0157369_10117618
822 Ga0157374_10065892
823 Ga0157374_10072915
824 Ga0157374_10343064
825 Ga0157378_10150614
826 Ga0157378_10166858
827 Ga0157378_10642401
828 Ga0163162_10421611
829 Ga0163162_10524248
830 Ga0163162_10667118
831 Ga0163162_10691809
832 Ga0163162_10795134
833 Ga0157372_10146967
834 Ga0157372_10189843
835 Ga0157375_10104424
836 Ga0157375_10133983
837 Ga0157375_10499304
838 Ga0157375_10655380
839 Ga0163163_10000219
840 Ga0163163_10032124
841 Ga0163163_10522218
842 Ga0157380_11598218
843 Ga0157379_10001730
844 Ga0157379_11334728
845 Ga0157379_11565274
846 Ga0163161_10094721
847 Ga0163161_10823597
848 Ga0207697_10133848
849 Ga0207656_10080598
850 Ga0207656_10259336
851 Ga0207682_10002976
852 Ga0207688_10119830
853 Ga0207680_10074654
854 Ga0207680_10357290
855 Ga0207680_10446184
856 Ga0207647_10002939
857 Ga0207647_10020274
858 Ga0207647_10026341
859 Ga0207647_10046968
860 Ga0207647_10150032
861 Ga0207647_10174148
862 Ga0207645_10004867
863 Ga0207645_10044351
864 Ga0207645_10977966
865 Ga0207705_10000070
866 Ga0207705_10046559
867 Ga0207705_10062537
868 Ga0207705_10148670
869 Ga0207654_10033771
870 Ga0207695_10011780
871 Ga0207695_10015034
872 Ga0207695_10082120
873 Ga0207657_10014072
874 Ga0207657_10030981
875 Ga0207657_10387675
876 Ga0207649_10000816
877 Ga0207649_10036981
878 Ga0207649_10042328
879 Ga0207649_10042888
880 Ga0207681_10038332
881 Ga0207681_10046614
882 Ga0207681_10176987
883 Ga0207681_10235535
884 Ga0207694_10036679
885 Ga0207650_10027429
886 Ga0207650_10028803
887 Ga0207650_10100644
888 Ga0207650_10200526
889 Ga0207650_10258436
890 Ga0207650_10268366
891 Ga0207650_10465970
892 Ga0207659_10006496
893 Ga0207659_10168394
894 Ga0207659_10293770
895 Ga0207659_10622559
896 Ga0207687_10027837
897 Ga0207644_10001850
898 Ga0207644_10012706
899 Ga0207644_10014933
900 Ga0207644_10017372
901 Ga0207644_10160822
902 Ga0207690_10016994
903 Ga0207690_10078948
904 Ga0207690_10101506
905 Ga0207690_10149356
906 Ga0207690_10293706
907 Ga0207690_10406543
908 Ga0207706_10002227
909 Ga0207706_10004069
910 Ga0207706_10027529
911 Ga0207706_10027660
912 Ga0207706_10033378
913 Ga0207706_10034743
914 Ga0207706_10039836
915 Ga0207706_10121902
916 Ga0207706_10338918
917 Ga0207706_10495613
918 Ga0207686_10469579
919 Ga0207709_10336050
920 Ga0207670_10085406
921 Ga0207670_10087665
922 Ga0207670_10821504
923 Ga0207669_10024485
924 Ga0207669_10638982
925 Ga0207704_10014745
926 Ga0207704_10238480
927 Ga0207704_10385835
928 Ga0207691_10001285
929 Ga0207691_10048439
930 Ga0207711_10000333
931 Ga0207711_10000450
932 Ga0207711_10000999
933 Ga0207711_10001758
934 Ga0207711_10019305
935 Ga0207711_10037411
936 Ga0207689_10363956
937 Ga0207679_10115156
938 Ga0207679_10184968
939 Ga0207679_10321886
940 Ga0207679_10485651
941 Ga0207667_10162795
942 Ga0207667_10277377
943 Ga0207667_10281897
944 Ga0207667_10475364
945 Ga0207651_10004576
946 Ga0207651_10013579
947 Ga0207651_10069150
948 Ga0207651_10085712
949 Ga0207651_10137652
950 Ga0207712_10155406
951 Ga0207712_10622951
952 Ga0207668_10122667
953 Ga0207668_10255571
954 Ga0207668_10409508
955 Ga0207668_10732742
956 Ga0207668_11894195
957 Ga0207640_10000344
958 Ga0207640_10006924
959 Ga0207640_10011746
960 Ga0207640_10181931
961 Ga0207640_10414502
962 Ga0207640_10666003
963 Ga0207658_10000634
964 Ga0207658_10004146
965 Ga0207658_10013250
966 Ga0207658_10021255
967 Ga0207658_10043370
968 Ga0207658_10120327
969 Ga0207658_10141709
970 Ga0207658_10182504
971 Ga0207658_10190620
972 Ga0207658_10749669
973 Ga0207677_10000665
974 Ga0207677_10039450
975 Ga0207677_11539490
976 Ga0207703_10002818
977 Ga0207703_10011564
978 Ga0207703_10138144
979 Ga0207703_10188919
980 Ga0207703_10900027
981 Ga0207639_10011224
982 Ga0207639_10407396
983 Ga0207678_10007626
984 Ga0207678_10026409
985 Ga0207678_10068571
986 Ga0207678_10199758
987 Ga0207678_10684427
988 Ga0207678_11191027
989 Ga0207702_10016214
990 Ga0207702_10083918
991 Ga0207641_10000188
992 Ga0207641_10063317
993 Ga0207648_10019688
994 Ga0207676_10000438
995 Ga0207676_10012470
996 Ga0207676_10031484
997 Ga0207676_10199326
998 Ga0207676_10367353
999 Ga0207676_10423006
1000 Ga0207676_11054992
1001 Ga0207674_10003595
1002 Ga0207674_10028779
1003 Ga0207675_100130020
1004 Ga0207683_10009090
1005 Ga0207683_10195975
1006 Ga0207683_10394365
1007 Ga0207698_10007920
1008 Ga0207698_10029979
1009 Ga0207698_10033317
1010 Ga0207698_10095945
1011 Ga0207698_10718713
1012 Ga0268266_10049998
1013 Ga0268266_10205249
1014 Ga0268266_11413458
1015 Ga0268265_10088734
1016 Ga0268265_10108107
1017 Ga0268265_10112327
1018 Ga0268265_10313944
1019 Ga0268265_10373472
1020 Ga0268265_11462575
1021 Ga0268265_11785801
1022 Ga0268264_10001006
1023 Ga0268264_10045042
1024 Ga0268264_10787235
1025 Ga0268264_11034695
1026 Ga0316177_1138970
1027 Ga0314311_1097860
1028 Ga0316178_1006155
1029 Ga0316183_1064884
1030 Ga0316182_1085336
1031 Ga0307408_100058079
1032 Ga0307408_100126627
1033 Ga0307408_100243144
1034 Ga0307408_101036375
1035 Ga0307405_10042024
1036 Ga0307405_10046226
1037 Ga0307405_10153746
1038 Ga0307405_10220893
1039 Ga0307405_10817250
1040 Ga0307405_11170535
1041 Ga0307413_10003858
1042 Ga0307413_10017016
1043 Ga0307413_10072983
1044 Ga0307413_10183499
1045 Ga0307413_10229273
1046 Ga0307413_10317787
1047 Ga0307413_10619106
1048 Ga0307413_10784119
1049 Ga0307413_11799995
1050 Ga0307410_10002293
1051 Ga0307410_10002603
1052 Ga0307410_10006803
1053 Ga0307410_10120052
1054 Ga0307410_10243625
1055 Ga0307410_10363554
1056 Ga0307410_10369189
1057 Ga0307410_10386284
1058 Ga0307410_10419542
1059 Ga0307410_10820975
1060 Ga0307410_11024028
1061 Ga0307406_10056479
1062 Ga0307406_10071050
1063 Ga0307406_10161426
1064 Ga0307406_11185744
1065 Ga0307407_10003942
1066 Ga0307407_10047567
1067 Ga0307407_10091571
1068 Ga0307407_10157079
1069 Ga0307407_10168670
1070 Ga0307407_10350330
1071 Ga0307407_10639436
1072 Ga0307412_10003002
1073 Ga0307412_10109903
1074 Ga0307412_10137325
1075 Ga0307412_10205116
1076 Ga0307412_10327603
1077 Ga0307412_10766321
1078 Ga0307412_10784467
1079 Ga0307412_11267911
1080 Ga0307409_100011689
1081 Ga0307409_100014063
1082 Ga0307409_100044437
1083 Ga0307409_100051090
1084 Ga0307409_100118636
1085 Ga0307409_100170889
1086 Ga0307409_100209557
1087 Ga0307409_100215190
1088 Ga0307409_100273898
1089 Ga0307409_100416053
1090 Ga0307409_100492948
1091 Ga0307409_100618780
1092 Ga0307409_101039473
1093 Ga0307409_101474150
1094 Ga0307416_100001561
1095 Ga0307416_100028750
1096 Ga0307416_100047549
1097 Ga0307416_100066775
1098 Ga0307416_100097629
1099 Ga0307416_100412015
1100 Ga0307416_100446649
1101 Ga0307416_100717627
1102 Ga0307416_100949346
1103 Ga0307416_101340356
1104 Ga0307416_101811205
1105 Ga0307414_10003633
1106 Ga0307414_10020007
1107 Ga0307414_10032939
1108 Ga0307414_10127738
1109 Ga0307414_10132221
1110 Ga0307414_10248733
1111 Ga0307414_10512465
1112 Ga0307411_10000438
1113 Ga0307411_10007089
1114 Ga0307411_10007464
1115 Ga0307411_10084978
1116 Ga0307411_10197689
1117 Ga0307411_10396596
1118 Ga0307411_10474978
1119 Ga0307411_10576952
1120 Ga0307411_10626872
1121 Ga0307411_10668027
1122 Ga0307411_10958501
1123 Ga0307411_11107251
1124 Ga0307411_11414380
1125 Ga0307415_100002360
1126 Ga0307415_100071842
1127 Ga0307415_100208059
1128 Ga0307415_100249727
1129 Ga0307415_100351760
1130 Ga0373937_0383897
1131 Ga0395899_0017106
1132 Ga0395899_0331177
1133 Ga0395900_0017641
1134 Ga0395900_0052306
1135 Ga0395900_0066666
1136 Ga0395900_0098924
1137 Ga0395900_0156051
1138 Ga0395900_0281003
1139 Ga0395900_0959463
1140 Ga0395898_0025005
1141 Ga0395898_0178403
1142 Ga0395898_0305478
1143 Ga0395898_0841369
1144 Ga0395898_1840270
1145 Ga0395905_0044209
1146 Ga0395905_0047505
1147 Ga0395905_0237537
1148 Ga0395905_0327304
1149 Ga0395905_0618658
1150 Ga0395901_0011159
1151 Ga0395901_0289185
1152 Ga0395901_0567351
1153 Ga0451807_0199346
1154 Ga0451835_0385350
1155 Ga0439449_0098457
1156 Ga0466963_0045087
1157 Ga0466964_0057432
1158 Ga0466967_0327207
1159 Ga0466967_0514041
1160 Ga0495663_0119075
1161 Ga0495668_0006757
1162 Ga0495588_0372527
1163 Ga0495669_0035507
1164 Ga0495669_0065399
1165 Ga0495669_0070901
1166 Ga0495683_0181188
1167 Ga0496101_0041000
1168 Ga0496102_0104521
1169 Ga0496103_0518568
1170 Ga0496107_0361330
1171 Ga0496108_0020259
1172 Ga0496108_0047621
1173 Ga0496108_1142395
1174 Ga0496109_0156413
1175 Ga0496109_1120647
1176 Ga0496110_0006432
1177 Ga0496110_0209380
1178 Ga0496111_0025608
1179 Ga0496111_0274078
1180 Ga0496111_0727214
1181 Ga0496112_0119331
1182 Ga0496112_1570162
1183 Ga0496114_0009772
1184 Ga0501069_0243225
1185 Ga0501071_0700513
1186 Ga0501227_088768
1187 Ga0501239_037656
1188 Ga0501267_028848
1189 Ga0501268_122161
1190 Ga0500658_0000963
1191 Ga0466962_0180437
1192 2885428241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

3

142

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8933 37 125
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.841 49 124
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.8226 34 136
6t8h-assembly1.cif.gz_A cryo-em structure of the dna-bound pold-pcna processive complex from p. abyssi 0.8097 36 121
2pi2-assembly3.cif.gz_C full-length replication protein a subunits rpa14 and rpa32 0.7949 54 126
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8933 37 125 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.841 49 124 2.40.50.140
1sr3A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8226 34 136 2.40.50.140
af_Q2FY46_5_100_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8217 54 122 2.40.50.140
af_K7VHZ3_96_226_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8095 32 133 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A5W4VQ91-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9462 32 123 GO:0005886
GO:0017004
GO:0020037
AF-A0A1F4BIV1-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9168 4 127 GO:0005886
GO:0017004
GO:0020037
AF-A0A1F4BIV1-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9031 4 127 GO:0005886
GO:0017004
GO:0020037
AF-A0A520RT28-F1-model_v4 Cytochrome c maturation protein CcmE 0.8984 55 132 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A2E5PIS8-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.891 18 127 GO:0005886
GO:0017004
GO:0020037

Map