F467482

General Info

Members Datasets Scaffolds Average Seq Length
595 263 1190 174

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0101494|Ga0496100_0101494_1308_1904
Length 198
Sequence VSPEPDPPEATAGDDGTGHDDSGLDLARSIARGLARPGVRKRRAGSSDSGRYSPTRSAQRGDPQLSGAHPDDRDPQPLDATIGRLIDEQGWGTDVRVHGVFSRWDHIVGREVAQHCRPESFRQADDGPRPGGRLLVRTDSTAWATQMKLLAPQVVRRLNEELGDDTVTMIDVEGPHGPSWKRGRRSVRDGRGPRDTYG

Samples

Sample ID Description Type Environment
1 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
152 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
153 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
154 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
158 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
161 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
162 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
163 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
174 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
177 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
242 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
255 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
259 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
260 2643221696 Nocardioides sp. Root140 Isolate Unclassified
261 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
262 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
263 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0
Isolates 0.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.26
Nodule 0
Rhizoplane 8.74
Rhizosphere 78.99
Stem 0
Stem Tuber 0
Unclassified 3.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496100_0101494 3300048903 Bacteria 1984
2 JGI24750J21931_1024464 3300002070 Bacteria 861
3 rootH2_10147828 3300003320 Bacteria 1030
4 Ga0070658_10074664 3300005327 Bacteria 2781
5 Ga0070658_10082113 3300005327 Bacteria 2648
6 Ga0070683_100047670 3300005329 Bacteria 3960
7 Ga0070683_100072973 3300005329 Bacteria 3205
8 Ga0070683_100108192 3300005329 Bacteria 2622
9 Ga0070683_100594686 3300005329 Bacteria 1059
10 Ga0070670_100456163 3300005331 Bacteria 1133
11 Ga0070670_100528283 3300005331 Bacteria 1051
12 Ga0070680_100076152 3300005336 Bacteria 2762
13 Ga0070682_100007506 3300005337 Bacteria 6146
14 Ga0070682_100007958 3300005337 Bacteria 5964
15 Ga0070682_100071488 3300005337 Bacteria 2221
16 Ga0070682_100492900 3300005337 Bacteria 948
17 Ga0068868_100358725 3300005338 Bacteria 1250
18 Ga0068868_100435844 3300005338 Unclassified 1137
19 Ga0070660_100201644 3300005339 Bacteria 1614
20 Ga0070687_100107415 3300005343 Bacteria 1573
21 Ga0070661_100137564 3300005344 Bacteria 1839
22 Ga0070661_100808921 3300005344 Bacteria 769
23 Ga0070692_10239873 3300005345 Bacteria 1080
24 Ga0070668_100020104 3300005347 Bacteria 5034
25 Ga0070668_100064106 3300005347 Bacteria 2848
26 Ga0070675_100218338 3300005354 Bacteria 1660
27 Ga0070674_100419240 3300005356 Bacteria 1098
28 Ga0070674_100938516 3300005356 Bacteria 756
29 Ga0070688_101243859 3300005365 Bacteria 599
30 Ga0070659_100053664 3300005366 Bacteria 3173
31 Ga0070659_100129682 3300005366 Bacteria 2047
32 Ga0070667_100087977 3300005367 Bacteria 2667
33 Ga0070667_100461244 3300005367 Bacteria 1162
34 Ga0070700_100899308 3300005441 Unclassified 721
35 Ga0070700_101407190 3300005441 Bacteria 590
36 Ga0070694_101192762 3300005444 Unclassified 638
37 Ga0070663_100158337 3300005455 Bacteria 1742
38 Ga0070663_100690086 3300005455 Bacteria 867
39 Ga0070678_100343155 3300005456 Bacteria 1282
40 Ga0070662_100007456 3300005457 Bacteria 7091
41 Ga0070681_10072610 3300005458 Bacteria 3404
42 Ga0068867_100214439 3300005459 Bacteria 1548
43 Ga0070679_100012937 3300005530 Bacteria 7992
44 Ga0070679_100398125 3300005530 Bacteria 1323
45 Ga0070684_100006247 3300005535 Bacteria 9196
46 Ga0070684_100109597 3300005535 Bacteria 2474
47 Ga0070684_100306076 3300005535 Bacteria 1459
48 Ga0070684_100803075 3300005535 Bacteria 880
49 Ga0068853_100220972 3300005539 Bacteria 1730
50 Ga0068853_101065335 3300005539 Bacteria 779
51 Ga0070672_100159650 3300005543 Bacteria 1869
52 Ga0070693_100120212 3300005547 Bacteria 1628
53 Ga0070693_100984770 3300005547 Bacteria 637
54 Ga0070665_100030238 3300005548 Bacteria 5451
55 Ga0070665_100117286 3300005548 Bacteria 2665
56 Ga0070704_100543216 3300005549 Unclassified 1014
57 Ga0068855_100436885 3300005563 Bacteria 1430
58 Ga0068855_101979286 3300005563 Unclassified 589
59 Ga0068857_100015038 3300005577 Bacteria 6752
60 Ga0068857_100751769 3300005577 Bacteria 929
61 Ga0068854_100043348 3300005578 Bacteria 3189
62 Ga0068856_100126727 3300005614 Bacteria 2557
63 Ga0070702_100218423 3300005615 Bacteria 1273
64 Ga0070702_100330155 3300005615 Bacteria 1066
65 Ga0068852_100067112 3300005616 Bacteria 3136
66 Ga0068852_100073152 3300005616 Bacteria 3015
67 Ga0068852_100133184 3300005616 Unclassified 2291
68 Ga0068852_100277723 3300005616 Bacteria 1614
69 Ga0068852_101303306 3300005616 Bacteria 748
70 Ga0068864_100007822 3300005618 Bacteria 8809
71 Ga0068864_101033587 3300005618 Bacteria 816
72 Ga0068866_10040192 3300005718 Bacteria 2314
73 Ga0068866_10268303 3300005718 Bacteria 1052
74 Ga0068861_100196885 3300005719 Bacteria 1689
75 Ga0068861_100485395 3300005719 Bacteria 1114
76 Ga0068851_10232860 3300005834 Bacteria 1039
77 Ga0068863_100865560 3300005841 Bacteria 903
78 Ga0068858_101352622 3300005842 Bacteria 701
79 Ga0068860_100000169 3300005843 Bacteria 107281
80 Ga0068860_100135251 3300005843 Bacteria 2367
81 Ga0068860_100875642 3300005843 Bacteria 913
82 Ga0068862_100294402 3300005844 Bacteria 1492
83 Ga0068862_100791796 3300005844 Bacteria 925
84 Ga0081455_10012750 3300005937 Bacteria 8360
85 Ga0081455_10039656 3300005937 Bacteria 4160
86 Ga0081455_10074614 3300005937 Bacteria 2801
87 Ga0081455_10548664 3300005937 Bacteria 765
88 Ga0081538_10001122 3300005981 Bacteria 28365
89 Ga0081538_10123301 3300005981 Unclassified 1239
90 Ga0075365_10006726 3300006038 Bacteria 6359
91 Ga0075365_10016342 3300006038 Bacteria 4512
92 Ga0075365_10047312 3300006038 Bacteria 2827
93 Ga0075365_10061813 3300006038 Bacteria 2502
94 Ga0075365_10064304 3300006038 Bacteria 2457
95 Ga0075365_10082947 3300006038 Bacteria 2174
96 Ga0075365_10151026 3300006038 Bacteria 1616
97 Ga0075365_10232178 3300006038 Bacteria 1295
98 Ga0075365_10242724 3300006038 Bacteria 1265
99 Ga0075365_10283149 3300006038 Bacteria 1166
100 Ga0075365_10627585 3300006038 Bacteria 760
101 Ga0075365_10735762 3300006038 Bacteria 696
102 Ga0075368_10001586 3300006042 Bacteria 7296
103 Ga0075363_100000345 3300006048 Bacteria 13918
104 Ga0075363_100005271 3300006048 Bacteria 5737
105 Ga0075363_100009618 3300006048 Bacteria 4551
106 Ga0075363_100028665 3300006048 Bacteria 2866
107 Ga0075363_100110077 3300006048 Bacteria 1530
108 Ga0075363_100111770 3300006048 Bacteria 1519
109 Ga0075363_100202029 3300006048 Bacteria 1136
110 Ga0075364_10012942 3300006051 Bacteria 5120
111 Ga0075364_10055277 3300006051 Bacteria 2597
112 Ga0075364_10070518 3300006051 Bacteria 2301
113 Ga0075364_10079144 3300006051 Bacteria 2171
114 Ga0075364_10140259 3300006051 Bacteria 1625
115 Ga0075364_10167921 3300006051 Bacteria 1483
116 Ga0075364_10749874 3300006051 Bacteria 666
117 Ga0075432_10002266 3300006058 Bacteria 6398
118 Ga0075362_10007420 3300006177 Bacteria 4152
119 Ga0075367_10012972 3300006178 Bacteria 4465
120 Ga0075367_10020721 3300006178 Bacteria 3666
121 Ga0075367_10057610 3300006178 Bacteria 2310
122 Ga0097621_100583027 3300006237 Bacteria 1021
123 Ga0075370_10007923 3300006353 Bacteria 5439
124 Ga0075370_10026260 3300006353 Bacteria 3225
125 Ga0075370_10153352 3300006353 Bacteria 1350
126 Ga0075370_10257159 3300006353 Bacteria 1035
127 Ga0075428_100014025 3300006844 Bacteria 8919
128 Ga0075428_101288312 3300006844 Bacteria 769
129 Ga0075431_100710670 3300006847 Unclassified 982
130 Ga0075433_10010549 3300006852 Bacteria 7424
131 Ga0075433_10013070 3300006852 Bacteria 6734
132 Ga0075434_100004227 3300006871 Bacteria 12872
133 Ga0075434_100064387 3300006871 Bacteria 3650
134 Ga0068865_100108008 3300006881 Bacteria 2047
135 Ga0068865_100287623 3300006881 Bacteria 1311
136 Ga0075436_100009075 3300006914 Bacteria 6804
137 Ga0075436_100165065 3300006914 Bacteria 1562
138 Ga0075435_100002623 3300007076 Bacteria 11975
139 Ga0075435_100020712 3300007076 Bacteria 5046
140 Ga0105245_10029848 3300009098 Bacteria 4820
141 Ga0105245_10047452 3300009098 Bacteria 3840
142 Ga0105245_10700452 3300009098 Bacteria 1046
143 Ga0105245_11117090 3300009098 Bacteria 835
144 Ga0114129_10005929 3300009147 Bacteria 17292
145 Ga0114129_10595970 3300009147 Bacteria 1432
146 Ga0105243_10038740 3300009148 Bacteria 3713
147 Ga0105243_10051455 3300009148 Unclassified 3258
148 Ga0105243_10057005 3300009148 Bacteria 3110
149 Ga0105243_10334532 3300009148 Bacteria 1385
150 Ga0105243_10492838 3300009148 Bacteria 1159
151 Ga0105242_10023969 3300009176 Bacteria 4816
152 Ga0105242_10440641 3300009176 Bacteria 1225
153 Ga0105248_10100498 3300009177 Bacteria 3259
154 Ga0105237_10489548 3300009545 Bacteria 1236
155 Ga0105238_10078331 3300009551 Bacteria 3295
156 Ga0105238_10757339 3300009551 Unclassified 985
157 Ga0105238_10834770 3300009551 Bacteria 938
158 Ga0105249_10042287 3300009553 Bacteria 4144
159 Ga0105249_10411955 3300009553 Bacteria 1384
160 Ga0105249_10720702 3300009553 Bacteria 1058
161 Ga0105239_10023970 3300010375 Bacteria 6721
162 Ga0105239_10040949 3300010375 Bacteria 5077
163 Ga0105239_10186601 3300010375 Bacteria 2321
164 Ga0105246_10259121 3300011119 Bacteria 1385
165 Ga0105246_10791727 3300011119 Bacteria 840
166 Ga0105246_11366826 3300011119 Bacteria 659
167 Ga0157322_1008725 3300012490 Bacteria 781
168 Ga0157371_10038724 3300013102 Bacteria 3410
169 Ga0157371_10319388 3300013102 Bacteria 1127
170 Ga0157369_10380293 3300013105 Bacteria 1465
171 Ga0157374_11537217 3300013296 Bacteria 689
172 Ga0157378_10552020 3300013297 Bacteria 1157
173 Ga0163162_10036679 3300013306 Bacteria 4888
174 Ga0163162_10752636 3300013306 Bacteria 1093
175 Ga0157372_10035876 3300013307 Bacteria 5461
176 Ga0157372_10036668 3300013307 Bacteria 5405
177 Ga0157372_10251503 3300013307 Bacteria 2051
178 Ga0157372_10257516 3300013307 Bacteria 2026
179 Ga0157372_10585674 3300013307 Bacteria 1300
180 Ga0157372_11001790 3300013307 Bacteria 968
181 Ga0157375_10082072 3300013308 Bacteria 3265
182 Ga0157375_10142598 3300013308 Bacteria 2524
183 Ga0157375_10419804 3300013308 Bacteria 1504
184 Ga0157375_12026513 3300013308 Bacteria 684
185 Ga0163163_10048030 3300014325 Bacteria 4196
186 Ga0157380_10291892 3300014326 Bacteria 1498
187 Ga0157380_11159117 3300014326 Bacteria 815
188 Ga0157377_10026002 3300014745 Bacteria 3127
189 Ga0157377_10144192 3300014745 Bacteria 1466
190 Ga0157379_10107519 3300014968 Bacteria 2504
191 Ga0157376_11095400 3300014969 Bacteria 822
192 Ga0163161_10070947 3300017792 Bacteria 2548
193 Ga0163161_10262634 3300017792 Bacteria 1349
194 Ga0163161_10380416 3300017792 Unclassified 1128
195 Ga0207642_10011993 3300025899 Unclassified 3114
196 Ga0207688_10042479 3300025901 Bacteria 2531
197 Ga0207688_10075733 3300025901 Bacteria 1916
198 Ga0207688_10342596 3300025901 Bacteria 920
199 Ga0207688_10529962 3300025901 Bacteria 739
200 Ga0207647_10053537 3300025904 Bacteria 2486
201 Ga0207705_10036835 3300025909 Bacteria 3500
202 Ga0207707_10190058 3300025912 Bacteria 1791
203 Ga0207707_10260544 3300025912 Bacteria 1505
204 Ga0207660_10333446 3300025917 Bacteria 1213
205 Ga0207662_10116696 3300025918 Bacteria 1669
206 Ga0207662_10123208 3300025918 Bacteria 1627
207 Ga0207657_10202790 3300025919 Bacteria 1595
208 Ga0207649_10603269 3300025920 Bacteria 844
209 Ga0207649_10819848 3300025920 Bacteria 727
210 Ga0207652_10030146 3300025921 Bacteria 4540
211 Ga0207652_10351981 3300025921 Bacteria 1329
212 Ga0207694_10249025 3300025924 Unclassified 1453
213 Ga0207694_10620239 3300025924 Unclassified 910
214 Ga0207659_10329689 3300025926 Bacteria 1261
215 Ga0207687_10027949 3300025927 Bacteria 3787
216 Ga0207687_10029485 3300025927 Bacteria 3692
217 Ga0207687_10877334 3300025927 Bacteria 767
218 Ga0207664_10027585 3300025929 Bacteria 4307
219 Ga0207690_10033049 3300025932 Bacteria 3324
220 Ga0207706_10006460 3300025933 Bacteria 10886
221 Ga0207686_10314558 3300025934 Bacteria 1167
222 Ga0207709_10044866 3300025935 Bacteria 2674
223 Ga0207709_10045632 3300025935 Bacteria 2655
224 Ga0207709_10211824 3300025935 Bacteria 1391
225 Ga0207704_10102678 3300025938 Bacteria 1910
226 Ga0207691_10237328 3300025940 Bacteria 1577
227 Ga0207711_10156993 3300025941 Bacteria 2057
228 Ga0207661_10011093 3300025944 Bacteria 6512
229 Ga0207661_10032139 3300025944 Bacteria 4063
230 Ga0207661_10056173 3300025944 Bacteria 3160
231 Ga0207661_10083113 3300025944 Bacteria 2649
232 Ga0207667_10356748 3300025949 Bacteria 1491
233 Ga0207667_10557602 3300025949 Bacteria 1158
234 Ga0207712_10409437 3300025961 Bacteria 1142
235 Ga0207640_10034839 3300025981 Bacteria 3146
236 Ga0207658_10022763 3300025986 Bacteria 4365
237 Ga0207658_10520173 3300025986 Bacteria 1062
238 Ga0207677_10069906 3300026023 Bacteria 2471
239 Ga0207677_10328135 3300026023 Bacteria 1274
240 Ga0207677_10637622 3300026023 Unclassified 939
241 Ga0207703_10369188 3300026035 Bacteria 1325
242 Ga0207639_10096120 3300026041 Bacteria 2383
243 Ga0207678_10227403 3300026067 Bacteria 1597
244 Ga0207641_10662352 3300026088 Bacteria 1026
245 Ga0207648_10048534 3300026089 Bacteria 3716
246 Ga0207676_10013119 3300026095 Bacteria 5949
247 Ga0207674_10010236 3300026116 Bacteria 10652
248 Ga0207675_100008587 3300026118 Bacteria 9607
249 Ga0207675_100101448 3300026118 Bacteria 2711
250 Ga0207675_100520964 3300026118 Bacteria 1185
251 Ga0207683_10177755 3300026121 Bacteria 1929
252 Ga0207683_11298442 3300026121 Bacteria 674
253 Ga0207698_10093955 3300026142 Bacteria 2464
254 Ga0207698_10936799 3300026142 Bacteria 875
255 Ga0209813_10000696 3300027866 Bacteria 7671
256 Ga0209813_10000702 3300027866 Bacteria 7653
257 Ga0207428_10000752 3300027907 Bacteria 37021
258 Ga0207428_10003453 3300027907 Bacteria 15343
259 Ga0268266_10019890 3300028379 Bacteria 5721
260 Ga0268266_10514816 3300028379 Bacteria 1144
261 Ga0268265_10723060 3300028380 Unclassified 964
262 Ga0268264_10000808 3300028381 Bacteria 33720
263 Ga0268264_10360629 3300028381 Bacteria 1386
264 Ga0316182_1003868 3300030745 Bacteria 6985
265 Ga0307408_100003697 3300031548 Bacteria 10418
266 Ga0307408_100304926 3300031548 Bacteria 1335
267 Ga0307408_100820160 3300031548 Bacteria 846
268 Ga0307405_10024951 3300031731 Bacteria 3425
269 Ga0307405_10057693 3300031731 Bacteria 2440
270 Ga0307405_10766433 3300031731 Bacteria 805
271 Ga0307413_10045218 3300031824 Unclassified 2608
272 Ga0307410_10000663 3300031852 Bacteria 14246
273 Ga0307410_10128330 3300031852 Bacteria 1859
274 Ga0307410_10492931 3300031852 Bacteria 1007
275 Ga0307410_10783151 3300031852 Bacteria 810
276 Ga0307406_10000224 3300031901 Bacteria 34452
277 Ga0307406_10160341 3300031901 Unclassified 1616
278 Ga0307406_10549294 3300031901 Bacteria 945
279 Ga0307407_10004352 3300031903 Bacteria 5996
280 Ga0307407_10018417 3300031903 Bacteria 3532
281 Ga0307407_10046151 3300031903 Bacteria 2466
282 Ga0307407_10071474 3300031903 Bacteria 2066
283 Ga0307407_10120743 3300031903 Bacteria 1661
284 Ga0307412_10025099 3300031911 Bacteria 3687
285 Ga0307412_10084909 3300031911 Bacteria 2199
286 Ga0307409_100000129 3300031995 Bacteria 28229
287 Ga0307409_100138708 3300031995 Bacteria 2091
288 Ga0307409_100314247 3300031995 Bacteria 1463
289 Ga0307409_100491339 3300031995 Bacteria 1193
290 Ga0307416_100000359 3300032002 Bacteria 23730
291 Ga0307416_100665207 3300032002 Unclassified 1127
292 Ga0307416_101630508 3300032002 Unclassified 750
293 Ga0307414_10035195 3300032004 Bacteria 3330
294 Ga0307414_10311232 3300032004 Bacteria 1337
295 Ga0307414_10377065 3300032004 Bacteria 1225
296 Ga0307411_10020714 3300032005 Bacteria 3832
297 Ga0307411_10063692 3300032005 Bacteria 2465
298 Ga0307411_10146817 3300032005 Bacteria 1747
299 Ga0307411_10396845 3300032005 Bacteria 1139
300 Ga0307411_10634526 3300032005 Bacteria 923
301 Ga0307411_10655069 3300032005 Bacteria 910
302 Ga0307415_100001245 3300032126 Bacteria 11957
303 Ga0307415_100001778 3300032126 Bacteria 10544
304 Ga0307415_100010319 3300032126 Bacteria 5284
305 Ga0307415_100014784 3300032126 Bacteria 4601
306 Ga0307415_100090012 3300032126 Bacteria 2218
307 Ga0307415_100607739 3300032126 Bacteria 974
308 Ga0373947_0398232 3300035725 Bacteria 928
309 Ga0395900_0381602 3300037418 Bacteria 1377
310 Ga0395898_0524526 3300037466 Bacteria 1126
311 Ga0395898_0631245 3300037466 Bacteria 1014
312 Ga0395905_0665340 3300037471 Bacteria 943
313 Ga0395901_0632415 3300038443 Bacteria 1076
314 Ga0436365_0251476 3300039437 Bacteria 1041
315 Ga0439438_017240 3300041405 Bacteria 2083
316 Ga0439461_0026859 3300041410 Bacteria 1177
317 Ga0439465_0040075 3300041413 Bacteria 1513
318 Ga0451793_1004716 3300041452 Bacteria 2302
319 Ga0439431_0008722 3300041997 Bacteria 2283
320 Ga0439448_0080023 3300042005 Bacteria 1097
321 Ga0439457_026846 3300042014 Bacteria 1275
322 Ga0439463_005203 3300042016 Bacteria 3233
323 Ga0439434_0036133 3300042435 Bacteria 1511
324 Ga0439444_0011056 3300042437 Bacteria 1455
325 Ga0439460_0026855 3300042461 Bacteria 1613
326 Ga0439460_0038136 3300042461 Bacteria 1400
327 Ga0450893_0088616 3300042532 Bacteria 619
328 Ga0439440_0001382 3300042993 Bacteria 4404
329 Ga0439440_0001652 3300042993 Bacteria 4098
330 Ga0439440_0016115 3300042993 Bacteria 1631
331 Ga0466961_0135127 3300044693 Bacteria 1545
332 Ga0466961_0340977 3300044693 Bacteria 913
333 Ga0466963_0384072 3300044694 Bacteria 990
334 Ga0466968_0162668 3300044735 Bacteria 1031
335 Ga0466970_0002325 3300044765 Bacteria 9197
336 Ga0466970_0150429 3300044765 Bacteria 1285
337 Ga0466957_0014224 3300044842 Bacteria 4632
338 Ga0466957_0205601 3300044842 Bacteria 1295
339 Ga0466960_0182246 3300044901 Bacteria 1139
340 Ga0466967_0019964 3300045976 Bacteria 5402
341 Ga0466967_0026332 3300045976 Bacteria 4815
342 Ga0466967_0073352 3300045976 Bacteria 3070
343 Ga0466967_0127732 3300045976 Bacteria 2356
344 Ga0466967_0334583 3300045976 Bacteria 1463
345 Ga0466967_0382938 3300045976 Bacteria 1366
346 Ga0466967_1021491 3300045976 Bacteria 823
347 Ga0495651_0068460 3300046462 Bacteria 2706
348 Ga0495653_0026341 3300046463 Bacteria 4662
349 Ga0495582_0345802 3300046473 Bacteria 856
350 Ga0495596_0096887 3300046500 Bacteria 1145
351 Ga0495608_0368325 3300046511 Bacteria 882
352 Ga0495616_0202441 3300046513 Bacteria 872
353 Ga0495620_0225011 3300046515 Unclassified 718
354 Ga0495645_0464315 3300046543 Bacteria 796
355 Ga0495668_0286285 3300046616 Bacteria 903
356 Ga0495661_0372192 3300046665 Bacteria 699
357 Ga0495657_0242648 3300046675 Bacteria 1087
358 Ga0495657_0420929 3300046675 Bacteria 784
359 Ga0495613_0501432 3300046689 Bacteria 817
360 Ga0495670_0555561 3300046691 Bacteria 625
361 Ga0495600_0066467 3300046809 Bacteria 2357
362 Ga0495674_0778327 3300047319 Bacteria 746
363 Ga0495680_0217112 3300047322 Bacteria 1367
364 Ga0495677_0250729 3300047445 Bacteria 692
365 Ga0495593_0702190 3300047673 Bacteria 508
366 Ga0496100_0007513 3300048903 Bacteria 6020
367 Ga0496100_0022343 3300048903 Bacteria 3828
368 Ga0496100_0619397 3300048903 Bacteria 841
369 Ga0496100_0622415 3300048903 Bacteria 839
370 Ga0496100_0835778 3300048903 Bacteria 722
371 Ga0496101_0035400 3300048904 Bacteria 3531
372 Ga0496101_0146183 3300048904 Bacteria 1805
373 Ga0496101_0207333 3300048904 Bacteria 1517
374 Ga0496101_0882358 3300048904 Bacteria 704
375 Ga0496102_0019212 3300048905 Bacteria 6017
376 Ga0496102_0019720 3300048905 Bacteria 5943
377 Ga0496102_0073035 3300048905 Bacteria 3153
378 Ga0496103_0271757 3300048906 Bacteria 1090
379 Ga0496104_0007844 3300048907 Bacteria 9461
380 Ga0496104_0579649 3300048907 Bacteria 1032
381 Ga0496105_0020857 3300048908 Bacteria 5298
382 Ga0496105_0417679 3300048908 Bacteria 1062
383 Ga0496106_0005742 3300048909 Bacteria 9179
384 Ga0496106_0595741 3300048909 Bacteria 885
385 Ga0496107_0027174 3300048910 Bacteria 4063
386 Ga0496107_0485331 3300048910 Bacteria 917
387 Ga0496108_0091957 3300048911 Bacteria 2579
388 Ga0496108_0092330 3300048911 Bacteria 2574
389 Ga0496108_0223957 3300048911 Bacteria 1634
390 Ga0496108_0319918 3300048911 Bacteria 1353
391 Ga0496108_0328774 3300048911 Bacteria 1333
392 Ga0496108_1276852 3300048911 Bacteria 618
393 Ga0496109_0062182 3300048912 Bacteria 3414
394 Ga0496109_0078844 3300048912 Bacteria 3033
395 Ga0496109_0120944 3300048912 Bacteria 2439
396 Ga0496109_0796043 3300048912 Bacteria 883
397 Ga0496109_0927109 3300048912 Bacteria 809
398 Ga0496110_0020063 3300048913 Bacteria 5637
399 Ga0496110_0113340 3300048913 Bacteria 2439
400 Ga0496110_0139986 3300048913 Bacteria 2187
401 Ga0496110_0290978 3300048913 Bacteria 1488
402 Ga0496111_0026551 3300048914 Bacteria 4090
403 Ga0496111_0731838 3300048914 Bacteria 718
404 Ga0496112_0129754 3300048915 Bacteria 2492
405 Ga0496113_0010415 3300048916 Bacteria 6147
406 Ga0496113_0143336 3300048916 Bacteria 1881
407 Ga0496113_0154388 3300048916 Bacteria 1812
408 Ga0496113_0183069 3300048916 Bacteria 1661
409 Ga0496114_0011613 3300048917 Bacteria 7042
410 Ga0496114_0021705 3300048917 Bacteria 5226
411 Ga0496114_0055122 3300048917 Bacteria 3315
412 Ga0496114_0157288 3300048917 Bacteria 1974
413 Ga0496114_0351741 3300048917 Bacteria 1303
414 Ga0496115_0004989 3300048918 Bacteria 9637
415 Ga0496115_0043621 3300048918 Bacteria 3577
416 Ga0501031_0000577 3300049568 Bacteria 21539
417 Ga0501031_0013758 3300049568 Bacteria 5275
418 Ga0501031_0014464 3300049568 Bacteria 5128
419 Ga0501032_0000432 3300049569 Bacteria 34501
420 Ga0501032_0071553 3300049569 Bacteria 2311
421 Ga0501033_0001452 3300049570 Bacteria 20996
422 Ga0501033_0030820 3300049570 Bacteria 4031
423 Ga0501033_0051478 3300049570 Bacteria 3052
424 Ga0501033_0145734 3300049570 Bacteria 1710
425 Ga0501034_0005805 3300049571 Bacteria 13423
426 Ga0501034_0007308 3300049571 Bacteria 11772
427 Ga0501034_0026056 3300049571 Bacteria 5956
428 Ga0501036_0000108 3300049572 Bacteria 51067
429 Ga0501036_0003611 3300049572 Bacteria 12365
430 Ga0501036_0007232 3300049572 Bacteria 9040
431 Ga0501036_0030081 3300049572 Bacteria 4588
432 Ga0501036_0422952 3300049572 Bacteria 1111
433 Ga0501037_0001254 3300049573 Bacteria 18693
434 Ga0501037_0002261 3300049573 Bacteria 13916
435 Ga0501037_0295735 3300049573 Bacteria 1125
436 Ga0501038_0000130 3300049574 Bacteria 63940
437 Ga0501038_0021356 3300049574 Bacteria 5811
438 Ga0501038_0023173 3300049574 Bacteria 5554
439 Ga0501038_0180089 3300049574 Bacteria 1706
440 Ga0501039_0001896 3300049575 Bacteria 15463
441 Ga0501039_0008612 3300049575 Bacteria 7775
442 Ga0501039_0036336 3300049575 Bacteria 3801
443 Ga0501040_0004213 3300049576 Bacteria 9362
444 Ga0501040_0046839 3300049576 Bacteria 2952
445 Ga0501040_0186858 3300049576 Bacteria 1470
446 Ga0501041_0003615 3300049577 Bacteria 8891
447 Ga0501042_0067467 3300049578 Bacteria 2557
448 Ga0501042_0102282 3300049578 Bacteria 2061
449 Ga0501043_0000147 3300049579 Bacteria 65326
450 Ga0501043_0006882 3300049579 Bacteria 9074
451 Ga0501043_0015526 3300049579 Bacteria 5968
452 Ga0501043_0324872 3300049579 Bacteria 1172
453 Ga0501046_0000067 3300049580 Bacteria 114617
454 Ga0501046_0012682 3300049580 Bacteria 7167
455 Ga0501046_0015083 3300049580 Bacteria 6498
456 Ga0501046_0040387 3300049580 Bacteria 3728
457 Ga0501046_0424858 3300049580 Bacteria 958
458 Ga0501047_0003345 3300049581 Bacteria 15193
459 Ga0501047_0048868 3300049581 Bacteria 4085
460 Ga0501047_0188880 3300049581 Bacteria 1924
461 Ga0501047_0291326 3300049581 Bacteria 1476
462 Ga0501047_0464717 3300049581 Bacteria 1094
463 Ga0501048_0000007 3300049582 Bacteria 86855
464 Ga0501048_0005697 3300049582 Bacteria 9468
465 Ga0501048_0568896 3300049582 Bacteria 813
466 Ga0501067_0001510 3300049583 Bacteria 12667
467 Ga0501067_0003198 3300049583 Bacteria 9034
468 Ga0501067_0013543 3300049583 Bacteria 4517
469 Ga0501067_0107170 3300049583 Bacteria 1553
470 Ga0501067_0117375 3300049583 Bacteria 1480
471 Ga0501067_0242696 3300049583 Bacteria 1003
472 Ga0501068_0003848 3300049584 Bacteria 8146
473 Ga0501068_0016683 3300049584 Bacteria 4236
474 Ga0501068_0019942 3300049584 Bacteria 3901
475 Ga0501068_0048280 3300049584 Bacteria 2569
476 Ga0501069_0013428 3300049585 Bacteria 4368
477 Ga0501069_0028927 3300049585 Bacteria 3039
478 Ga0501069_0164193 3300049585 Bacteria 1279
479 Ga0501069_0183438 3300049585 Bacteria 1210
480 Ga0501069_0235607 3300049585 Bacteria 1066
481 Ga0501069_0244219 3300049585 Bacteria 1047
482 Ga0501069_0292616 3300049585 Bacteria 954
483 Ga0501070_0000171 3300049586 Bacteria 59820
484 Ga0501070_0001780 3300049586 Bacteria 19033
485 Ga0501070_0110273 3300049586 Bacteria 2274
486 Ga0501070_0191067 3300049586 Bacteria 1683
487 Ga0501070_0280913 3300049586 Bacteria 1358
488 Ga0501070_0444701 3300049586 Bacteria 1045
489 Ga0501070_0525199 3300049586 Bacteria 949
490 Ga0501070_0552686 3300049586 Bacteria 921
491 Ga0501071_0016265 3300049587 Bacteria 5115
492 Ga0501071_0025850 3300049587 Bacteria 4115
493 Ga0501071_0110951 3300049587 Bacteria 2027
494 Ga0501071_0249317 3300049587 Bacteria 1340
495 Ga0501071_0493140 3300049587 Bacteria 939
496 Ga0501072_0010378 3300049588 Bacteria 7096
497 Ga0501072_0022214 3300049588 Bacteria 4922
498 Ga0501072_0052360 3300049588 Bacteria 3214
499 Ga0501072_0168204 3300049588 Bacteria 1749
500 Ga0501073_0002199 3300049589 Bacteria 14595
501 Ga0501073_0003368 3300049589 Bacteria 12012
502 Ga0501074_0000506 3300049590 Bacteria 23867
503 Ga0501074_0002964 3300049590 Bacteria 11931
504 Ga0501074_0013200 3300049590 Bacteria 6006
505 Ga0501074_0040715 3300049590 Bacteria 3364
506 Ga0501074_0085786 3300049590 Bacteria 2256
507 Ga0501074_0640748 3300049590 Bacteria 751
508 Ga0501075_0035642 3300049591 Bacteria 3711
509 Ga0501076_0085822 3300049592 Bacteria 2530
510 Ga0501077_0011204 3300049593 Bacteria 5594
511 Ga0501077_0016695 3300049593 Bacteria 4628
512 Ga0501079_0012719 3300049741 Bacteria 6429
513 Ga0501079_0021752 3300049741 Bacteria 4909
514 Ga0501079_0047850 3300049741 Bacteria 3300
515 Ga0501079_0184389 3300049741 Bacteria 1629
516 Ga0501080_0001760 3300049742 Bacteria 18573
517 Ga0501080_0023405 3300049742 Bacteria 5726
518 Ga0501080_0024281 3300049742 Bacteria 5620
519 Ga0501080_0059601 3300049742 Bacteria 3552
520 Ga0501080_0065119 3300049742 Bacteria 3390
521 Ga0501081_0043273 3300049743 Bacteria 3088
522 Ga0501083_0002246 3300049744 Bacteria 13197
523 Ga0501083_0010565 3300049744 Bacteria 6498
524 Ga0501083_0043393 3300049744 Bacteria 3047
525 Ga0501083_0071511 3300049744 Bacteria 2306
526 Ga0501035_0009180 3300049822 Bacteria 9195
527 Ga0501035_0051210 3300049822 Bacteria 3697
528 Ga0501044_0013089 3300049823 Bacteria 8979
529 Ga0501044_0290144 3300049823 Bacteria 1567
530 Ga0501044_0307034 3300049823 Bacteria 1514
531 Ga0501044_0857125 3300049823 Bacteria 785
532 Ga0501045_0010906 3300049824 Bacteria 6364
533 Ga0501045_0232056 3300049824 Bacteria 1374
534 Ga0501045_0388349 3300049824 Bacteria 1039
535 nmdc:mga03n38_26870_c1 3300050490 Bacteria 2382
536 nmdc:mga03n38_39398_c1 3300050490 Bacteria 2049
537 nmdc:mga03n38_47666_c1 3300050490 Bacteria 1898
538 nmdc:mga03n38_49207_c1 3300050490 Bacteria 1873
539 nmdc:mga03n38_64501_c1 3300050490 Bacteria 1677
540 nmdc:mga00v17_163187_c1 3300050491 Bacteria 1435
541 nmdc:mga00v17_17529_c1 3300050491 Bacteria 4056
542 nmdc:mga00v17_38058_c1 3300050491 Bacteria 2875
543 nmdc:mga00v17_49351_c1 3300050491 Bacteria 2553
544 nmdc:mga00v17_51722_c1 3300050491 Bacteria 2498
545 nmdc:mga00v17_80096_c1 3300050491 Bacteria 2038
546 nmdc:mga0yw44_141364_c1 3300050492 Bacteria 1565
547 nmdc:mga0yw44_148222_c1 3300050492 Bacteria 1090
548 nmdc:mga0yw44_202946_c1 3300050492 Bacteria 1310
549 nmdc:mga0yw44_22909_c1 3300050492 Bacteria 3510
550 nmdc:mga0yw44_241705_c1 3300050492 Bacteria 1200
551 nmdc:mga0yw44_30434_c1 3300050492 Bacteria 3128
552 nmdc:mga0yw44_359232_c1 3300050492 Bacteria 981
553 nmdc:mga0yw44_367359_c1 3300050492 Bacteria 970
554 nmdc:mga0yw44_37743_c1 3300050492 Bacteria 2854
555 nmdc:mga0yw44_48376_c1 3300050492 Bacteria 2564
556 nmdc:mga06z11_55283_c1 3300050494 Bacteria 2049
557 nmdc:mga04h51_19179_c1 3300050495 Bacteria 2025
558 nmdc:mga04h51_749_c1 3300050495 Bacteria 7517
559 nmdc:mga07m45_320399_c1 3300050496 Bacteria 901
560 nmdc:mga07m45_390685_c1 3300050496 Bacteria 808
561 nmdc:mga07m45_47117_c1 3300050496 Bacteria 2423
562 nmdc:mga07m45_84712_c1 3300050496 Bacteria 1812
563 nmdc:mga05p37_98688_c1 3300050507 Bacteria 3598
564 nmdc:mga09592_63443_c1 3300050508 Bacteria 3127
565 nmdc:mga0qj67_249487_c1 3300050509 Bacteria 1440
566 nmdc:mga08y16_199676_c1 3300050511 Bacteria 2073
567 nmdc:mga0n895_102349_c1 3300050512 Bacteria 2875
568 nmdc:mga0rr50_95590_c1 3300050513 Bacteria 2323
569 nmdc:mga08x19_67908_c1 3300050514 Bacteria 2319
570 nmdc:mga0a205_88277_c1 3300050515 Bacteria 2997
571 Ga0495601_0276996 3300053077 Bacteria 1094
572 Ga0495595_0078876 3300053084 Bacteria 1566
573 Ga0495595_0161347 3300053084 Bacteria 1106
574 Ga0495619_0632131 3300053085 Bacteria 731
575 Ga0500593_000024 3300053117 Bacteria 52015
576 Ga0500573_0009020 3300053140 Bacteria 5517
577 Ga0501084_0001403 3300054114 Bacteria 19059
578 Ga0501084_0020970 3300054114 Bacteria 5449
579 Ga0501084_0028061 3300054114 Bacteria 4704
580 Ga0501084_0063790 3300054114 Bacteria 3085
581 Ga0501084_0079069 3300054114 Bacteria 2756
582 Ga0501084_0279503 3300054114 Bacteria 1410
583 Ga0501082_0008218 3300060353 Bacteria 9001
584 Ga0501082_0035626 3300060353 Bacteria 4289
585 Ga0501082_0038695 3300060353 Bacteria 4113
586 Ga0501082_1030576 3300060353 Bacteria 720
587 Ga0530510_0065272 3300061734 Bacteria 2637
588 Ga0530510_0186293 3300061734 Bacteria 1540
589 Ga0530510_0200408 3300061734 Bacteria 1482
590 Ga0530510_0473578 3300061734 Bacteria 948
591 2644322104 2643221657 Bacteria 5490246
592 2644534494 2643221696 Bacteria 5431823
593 2855388493 2855386786 Bacteria 4752232
594 2857483727 2857481737 Bacteria 4761446
595 2883822158 2883821847 Bacteria 5121194
596 Ga0496100_0101494
597 JGI24750J21931_1024464
598 rootH2_10147828
599 Ga0070658_10074664
600 Ga0070658_10082113
601 Ga0070683_100047670
602 Ga0070683_100072973
603 Ga0070683_100108192
604 Ga0070683_100594686
605 Ga0070670_100456163
606 Ga0070670_100528283
607 Ga0070680_100076152
608 Ga0070682_100007506
609 Ga0070682_100007958
610 Ga0070682_100071488
611 Ga0070682_100492900
612 Ga0068868_100358725
613 Ga0068868_100435844
614 Ga0070660_100201644
615 Ga0070687_100107415
616 Ga0070661_100137564
617 Ga0070661_100808921
618 Ga0070692_10239873
619 Ga0070668_100020104
620 Ga0070668_100064106
621 Ga0070675_100218338
622 Ga0070674_100419240
623 Ga0070674_100938516
624 Ga0070688_101243859
625 Ga0070659_100053664
626 Ga0070659_100129682
627 Ga0070667_100087977
628 Ga0070667_100461244
629 Ga0070700_100899308
630 Ga0070700_101407190
631 Ga0070694_101192762
632 Ga0070663_100158337
633 Ga0070663_100690086
634 Ga0070678_100343155
635 Ga0070662_100007456
636 Ga0070681_10072610
637 Ga0068867_100214439
638 Ga0070679_100012937
639 Ga0070679_100398125
640 Ga0070684_100006247
641 Ga0070684_100109597
642 Ga0070684_100306076
643 Ga0070684_100803075
644 Ga0068853_100220972
645 Ga0068853_101065335
646 Ga0070672_100159650
647 Ga0070693_100120212
648 Ga0070693_100984770
649 Ga0070665_100030238
650 Ga0070665_100117286
651 Ga0070704_100543216
652 Ga0068855_100436885
653 Ga0068855_101979286
654 Ga0068857_100015038
655 Ga0068857_100751769
656 Ga0068854_100043348
657 Ga0068856_100126727
658 Ga0070702_100218423
659 Ga0070702_100330155
660 Ga0068852_100067112
661 Ga0068852_100073152
662 Ga0068852_100133184
663 Ga0068852_100277723
664 Ga0068852_101303306
665 Ga0068864_100007822
666 Ga0068864_101033587
667 Ga0068866_10040192
668 Ga0068866_10268303
669 Ga0068861_100196885
670 Ga0068861_100485395
671 Ga0068851_10232860
672 Ga0068863_100865560
673 Ga0068858_101352622
674 Ga0068860_100000169
675 Ga0068860_100135251
676 Ga0068860_100875642
677 Ga0068862_100294402
678 Ga0068862_100791796
679 Ga0081455_10012750
680 Ga0081455_10039656
681 Ga0081455_10074614
682 Ga0081455_10548664
683 Ga0081538_10001122
684 Ga0081538_10123301
685 Ga0075365_10006726
686 Ga0075365_10016342
687 Ga0075365_10047312
688 Ga0075365_10061813
689 Ga0075365_10064304
690 Ga0075365_10082947
691 Ga0075365_10151026
692 Ga0075365_10232178
693 Ga0075365_10242724
694 Ga0075365_10283149
695 Ga0075365_10627585
696 Ga0075365_10735762
697 Ga0075368_10001586
698 Ga0075363_100000345
699 Ga0075363_100005271
700 Ga0075363_100009618
701 Ga0075363_100028665
702 Ga0075363_100110077
703 Ga0075363_100111770
704 Ga0075363_100202029
705 Ga0075364_10012942
706 Ga0075364_10055277
707 Ga0075364_10070518
708 Ga0075364_10079144
709 Ga0075364_10140259
710 Ga0075364_10167921
711 Ga0075364_10749874
712 Ga0075432_10002266
713 Ga0075362_10007420
714 Ga0075367_10012972
715 Ga0075367_10020721
716 Ga0075367_10057610
717 Ga0097621_100583027
718 Ga0075370_10007923
719 Ga0075370_10026260
720 Ga0075370_10153352
721 Ga0075370_10257159
722 Ga0075428_100014025
723 Ga0075428_101288312
724 Ga0075431_100710670
725 Ga0075433_10010549
726 Ga0075433_10013070
727 Ga0075434_100004227
728 Ga0075434_100064387
729 Ga0068865_100108008
730 Ga0068865_100287623
731 Ga0075436_100009075
732 Ga0075436_100165065
733 Ga0075435_100002623
734 Ga0075435_100020712
735 Ga0105245_10029848
736 Ga0105245_10047452
737 Ga0105245_10700452
738 Ga0105245_11117090
739 Ga0114129_10005929
740 Ga0114129_10595970
741 Ga0105243_10038740
742 Ga0105243_10051455
743 Ga0105243_10057005
744 Ga0105243_10334532
745 Ga0105243_10492838
746 Ga0105242_10023969
747 Ga0105242_10440641
748 Ga0105248_10100498
749 Ga0105237_10489548
750 Ga0105238_10078331
751 Ga0105238_10757339
752 Ga0105238_10834770
753 Ga0105249_10042287
754 Ga0105249_10411955
755 Ga0105249_10720702
756 Ga0105239_10023970
757 Ga0105239_10040949
758 Ga0105239_10186601
759 Ga0105246_10259121
760 Ga0105246_10791727
761 Ga0105246_11366826
762 Ga0157322_1008725
763 Ga0157371_10038724
764 Ga0157371_10319388
765 Ga0157369_10380293
766 Ga0157374_11537217
767 Ga0157378_10552020
768 Ga0163162_10036679
769 Ga0163162_10752636
770 Ga0157372_10035876
771 Ga0157372_10036668
772 Ga0157372_10251503
773 Ga0157372_10257516
774 Ga0157372_10585674
775 Ga0157372_11001790
776 Ga0157375_10082072
777 Ga0157375_10142598
778 Ga0157375_10419804
779 Ga0157375_12026513
780 Ga0163163_10048030
781 Ga0157380_10291892
782 Ga0157380_11159117
783 Ga0157377_10026002
784 Ga0157377_10144192
785 Ga0157379_10107519
786 Ga0157376_11095400
787 Ga0163161_10070947
788 Ga0163161_10262634
789 Ga0163161_10380416
790 Ga0207642_10011993
791 Ga0207688_10042479
792 Ga0207688_10075733
793 Ga0207688_10342596
794 Ga0207688_10529962
795 Ga0207647_10053537
796 Ga0207705_10036835
797 Ga0207707_10190058
798 Ga0207707_10260544
799 Ga0207660_10333446
800 Ga0207662_10116696
801 Ga0207662_10123208
802 Ga0207657_10202790
803 Ga0207649_10603269
804 Ga0207649_10819848
805 Ga0207652_10030146
806 Ga0207652_10351981
807 Ga0207694_10249025
808 Ga0207694_10620239
809 Ga0207659_10329689
810 Ga0207687_10027949
811 Ga0207687_10029485
812 Ga0207687_10877334
813 Ga0207664_10027585
814 Ga0207690_10033049
815 Ga0207706_10006460
816 Ga0207686_10314558
817 Ga0207709_10044866
818 Ga0207709_10045632
819 Ga0207709_10211824
820 Ga0207704_10102678
821 Ga0207691_10237328
822 Ga0207711_10156993
823 Ga0207661_10011093
824 Ga0207661_10032139
825 Ga0207661_10056173
826 Ga0207661_10083113
827 Ga0207667_10356748
828 Ga0207667_10557602
829 Ga0207712_10409437
830 Ga0207640_10034839
831 Ga0207658_10022763
832 Ga0207658_10520173
833 Ga0207677_10069906
834 Ga0207677_10328135
835 Ga0207677_10637622
836 Ga0207703_10369188
837 Ga0207639_10096120
838 Ga0207678_10227403
839 Ga0207641_10662352
840 Ga0207648_10048534
841 Ga0207676_10013119
842 Ga0207674_10010236
843 Ga0207675_100008587
844 Ga0207675_100101448
845 Ga0207675_100520964
846 Ga0207683_10177755
847 Ga0207683_11298442
848 Ga0207698_10093955
849 Ga0207698_10936799
850 Ga0209813_10000696
851 Ga0209813_10000702
852 Ga0207428_10000752
853 Ga0207428_10003453
854 Ga0268266_10019890
855 Ga0268266_10514816
856 Ga0268265_10723060
857 Ga0268264_10000808
858 Ga0268264_10360629
859 Ga0316182_1003868
860 Ga0307408_100003697
861 Ga0307408_100304926
862 Ga0307408_100820160
863 Ga0307405_10024951
864 Ga0307405_10057693
865 Ga0307405_10766433
866 Ga0307413_10045218
867 Ga0307410_10000663
868 Ga0307410_10128330
869 Ga0307410_10492931
870 Ga0307410_10783151
871 Ga0307406_10000224
872 Ga0307406_10160341
873 Ga0307406_10549294
874 Ga0307407_10004352
875 Ga0307407_10018417
876 Ga0307407_10046151
877 Ga0307407_10071474
878 Ga0307407_10120743
879 Ga0307412_10025099
880 Ga0307412_10084909
881 Ga0307409_100000129
882 Ga0307409_100138708
883 Ga0307409_100314247
884 Ga0307409_100491339
885 Ga0307416_100000359
886 Ga0307416_100665207
887 Ga0307416_101630508
888 Ga0307414_10035195
889 Ga0307414_10311232
890 Ga0307414_10377065
891 Ga0307411_10020714
892 Ga0307411_10063692
893 Ga0307411_10146817
894 Ga0307411_10396845
895 Ga0307411_10634526
896 Ga0307411_10655069
897 Ga0307415_100001245
898 Ga0307415_100001778
899 Ga0307415_100010319
900 Ga0307415_100014784
901 Ga0307415_100090012
902 Ga0307415_100607739
903 Ga0373947_0398232
904 Ga0395900_0381602
905 Ga0395898_0524526
906 Ga0395898_0631245
907 Ga0395905_0665340
908 Ga0395901_0632415
909 Ga0436365_0251476
910 Ga0439438_017240
911 Ga0439461_0026859
912 Ga0439465_0040075
913 Ga0451793_1004716
914 Ga0439431_0008722
915 Ga0439448_0080023
916 Ga0439457_026846
917 Ga0439463_005203
918 Ga0439434_0036133
919 Ga0439444_0011056
920 Ga0439460_0026855
921 Ga0439460_0038136
922 Ga0450893_0088616
923 Ga0439440_0001382
924 Ga0439440_0001652
925 Ga0439440_0016115
926 Ga0466961_0135127
927 Ga0466961_0340977
928 Ga0466963_0384072
929 Ga0466968_0162668
930 Ga0466970_0002325
931 Ga0466970_0150429
932 Ga0466957_0014224
933 Ga0466957_0205601
934 Ga0466960_0182246
935 Ga0466967_0019964
936 Ga0466967_0026332
937 Ga0466967_0073352
938 Ga0466967_0127732
939 Ga0466967_0334583
940 Ga0466967_0382938
941 Ga0466967_1021491
942 Ga0495651_0068460
943 Ga0495653_0026341
944 Ga0495582_0345802
945 Ga0495596_0096887
946 Ga0495608_0368325
947 Ga0495616_0202441
948 Ga0495620_0225011
949 Ga0495645_0464315
950 Ga0495668_0286285
951 Ga0495661_0372192
952 Ga0495657_0242648
953 Ga0495657_0420929
954 Ga0495613_0501432
955 Ga0495670_0555561
956 Ga0495600_0066467
957 Ga0495674_0778327
958 Ga0495680_0217112
959 Ga0495677_0250729
960 Ga0495593_0702190
961 Ga0496100_0007513
962 Ga0496100_0022343
963 Ga0496100_0619397
964 Ga0496100_0622415
965 Ga0496100_0835778
966 Ga0496101_0035400
967 Ga0496101_0146183
968 Ga0496101_0207333
969 Ga0496101_0882358
970 Ga0496102_0019212
971 Ga0496102_0019720
972 Ga0496102_0073035
973 Ga0496103_0271757
974 Ga0496104_0007844
975 Ga0496104_0579649
976 Ga0496105_0020857
977 Ga0496105_0417679
978 Ga0496106_0005742
979 Ga0496106_0595741
980 Ga0496107_0027174
981 Ga0496107_0485331
982 Ga0496108_0091957
983 Ga0496108_0092330
984 Ga0496108_0223957
985 Ga0496108_0319918
986 Ga0496108_0328774
987 Ga0496108_1276852
988 Ga0496109_0062182
989 Ga0496109_0078844
990 Ga0496109_0120944
991 Ga0496109_0796043
992 Ga0496109_0927109
993 Ga0496110_0020063
994 Ga0496110_0113340
995 Ga0496110_0139986
996 Ga0496110_0290978
997 Ga0496111_0026551
998 Ga0496111_0731838
999 Ga0496112_0129754
1000 Ga0496113_0010415
1001 Ga0496113_0143336
1002 Ga0496113_0154388
1003 Ga0496113_0183069
1004 Ga0496114_0011613
1005 Ga0496114_0021705
1006 Ga0496114_0055122
1007 Ga0496114_0157288
1008 Ga0496114_0351741
1009 Ga0496115_0004989
1010 Ga0496115_0043621
1011 Ga0501031_0000577
1012 Ga0501031_0013758
1013 Ga0501031_0014464
1014 Ga0501032_0000432
1015 Ga0501032_0071553
1016 Ga0501033_0001452
1017 Ga0501033_0030820
1018 Ga0501033_0051478
1019 Ga0501033_0145734
1020 Ga0501034_0005805
1021 Ga0501034_0007308
1022 Ga0501034_0026056
1023 Ga0501036_0000108
1024 Ga0501036_0003611
1025 Ga0501036_0007232
1026 Ga0501036_0030081
1027 Ga0501036_0422952
1028 Ga0501037_0001254
1029 Ga0501037_0002261
1030 Ga0501037_0295735
1031 Ga0501038_0000130
1032 Ga0501038_0021356
1033 Ga0501038_0023173
1034 Ga0501038_0180089
1035 Ga0501039_0001896
1036 Ga0501039_0008612
1037 Ga0501039_0036336
1038 Ga0501040_0004213
1039 Ga0501040_0046839
1040 Ga0501040_0186858
1041 Ga0501041_0003615
1042 Ga0501042_0067467
1043 Ga0501042_0102282
1044 Ga0501043_0000147
1045 Ga0501043_0006882
1046 Ga0501043_0015526
1047 Ga0501043_0324872
1048 Ga0501046_0000067
1049 Ga0501046_0012682
1050 Ga0501046_0015083
1051 Ga0501046_0040387
1052 Ga0501046_0424858
1053 Ga0501047_0003345
1054 Ga0501047_0048868
1055 Ga0501047_0188880
1056 Ga0501047_0291326
1057 Ga0501047_0464717
1058 Ga0501048_0000007
1059 Ga0501048_0005697
1060 Ga0501048_0568896
1061 Ga0501067_0001510
1062 Ga0501067_0003198
1063 Ga0501067_0013543
1064 Ga0501067_0107170
1065 Ga0501067_0117375
1066 Ga0501067_0242696
1067 Ga0501068_0003848
1068 Ga0501068_0016683
1069 Ga0501068_0019942
1070 Ga0501068_0048280
1071 Ga0501069_0013428
1072 Ga0501069_0028927
1073 Ga0501069_0164193
1074 Ga0501069_0183438
1075 Ga0501069_0235607
1076 Ga0501069_0244219
1077 Ga0501069_0292616
1078 Ga0501070_0000171
1079 Ga0501070_0001780
1080 Ga0501070_0110273
1081 Ga0501070_0191067
1082 Ga0501070_0280913
1083 Ga0501070_0444701
1084 Ga0501070_0525199
1085 Ga0501070_0552686
1086 Ga0501071_0016265
1087 Ga0501071_0025850
1088 Ga0501071_0110951
1089 Ga0501071_0249317
1090 Ga0501071_0493140
1091 Ga0501072_0010378
1092 Ga0501072_0022214
1093 Ga0501072_0052360
1094 Ga0501072_0168204
1095 Ga0501073_0002199
1096 Ga0501073_0003368
1097 Ga0501074_0000506
1098 Ga0501074_0002964
1099 Ga0501074_0013200
1100 Ga0501074_0040715
1101 Ga0501074_0085786
1102 Ga0501074_0640748
1103 Ga0501075_0035642
1104 Ga0501076_0085822
1105 Ga0501077_0011204
1106 Ga0501077_0016695
1107 Ga0501079_0012719
1108 Ga0501079_0021752
1109 Ga0501079_0047850
1110 Ga0501079_0184389
1111 Ga0501080_0001760
1112 Ga0501080_0023405
1113 Ga0501080_0024281
1114 Ga0501080_0059601
1115 Ga0501080_0065119
1116 Ga0501081_0043273
1117 Ga0501083_0002246
1118 Ga0501083_0010565
1119 Ga0501083_0043393
1120 Ga0501083_0071511
1121 Ga0501035_0009180
1122 Ga0501035_0051210
1123 Ga0501044_0013089
1124 Ga0501044_0290144
1125 Ga0501044_0307034
1126 Ga0501044_0857125
1127 Ga0501045_0010906
1128 Ga0501045_0232056
1129 Ga0501045_0388349
1130 nmdc:mga03n38_26870_c1
1131 nmdc:mga03n38_39398_c1
1132 nmdc:mga03n38_47666_c1
1133 nmdc:mga03n38_49207_c1
1134 nmdc:mga03n38_64501_c1
1135 nmdc:mga00v17_163187_c1
1136 nmdc:mga00v17_17529_c1
1137 nmdc:mga00v17_38058_c1
1138 nmdc:mga00v17_49351_c1
1139 nmdc:mga00v17_51722_c1
1140 nmdc:mga00v17_80096_c1
1141 nmdc:mga0yw44_141364_c1
1142 nmdc:mga0yw44_148222_c1
1143 nmdc:mga0yw44_202946_c1
1144 nmdc:mga0yw44_22909_c1
1145 nmdc:mga0yw44_241705_c1
1146 nmdc:mga0yw44_30434_c1
1147 nmdc:mga0yw44_359232_c1
1148 nmdc:mga0yw44_367359_c1
1149 nmdc:mga0yw44_37743_c1
1150 nmdc:mga0yw44_48376_c1
1151 nmdc:mga06z11_55283_c1
1152 nmdc:mga04h51_19179_c1
1153 nmdc:mga04h51_749_c1
1154 nmdc:mga07m45_320399_c1
1155 nmdc:mga07m45_390685_c1
1156 nmdc:mga07m45_47117_c1
1157 nmdc:mga07m45_84712_c1
1158 nmdc:mga05p37_98688_c1
1159 nmdc:mga09592_63443_c1
1160 nmdc:mga0qj67_249487_c1
1161 nmdc:mga08y16_199676_c1
1162 nmdc:mga0n895_102349_c1
1163 nmdc:mga0rr50_95590_c1
1164 nmdc:mga08x19_67908_c1
1165 nmdc:mga0a205_88277_c1
1166 Ga0495601_0276996
1167 Ga0495595_0078876
1168 Ga0495595_0161347
1169 Ga0495619_0632131
1170 Ga0500593_000024
1171 Ga0500573_0009020
1172 Ga0501084_0001403
1173 Ga0501084_0020970
1174 Ga0501084_0028061
1175 Ga0501084_0063790
1176 Ga0501084_0079069
1177 Ga0501084_0279503
1178 Ga0501082_0008218
1179 Ga0501082_0035626
1180 Ga0501082_0038695
1181 Ga0501082_1030576
1182 Ga0530510_0065272
1183 Ga0530510_0186293
1184 Ga0530510_0200408
1185 Ga0530510_0473578
1186 2644322104
1187 2644534494
1188 2855388493
1189 2857483727
1190 2883822158

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05258

DciA

Dna[CI] antecedent, DciA

77

172

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.8033 79 155
7ykm-assembly1.cif.gz_A structure of dcia duf721 domain from deinococcus radiodurans 0.7618 79 155
8a3v-assembly1.cif.gz_C crystal structure of the vibrio cholerae replicative helicase (vcdnab) in complex with its loader protein (vcdcia) 0.7238 65 153
7mrv-assembly1.cif.gz_A f100a mutant structure of mif2 (d-dt) 0.7216 112 153
4tps-assembly1.cif.gz_B sporulation inhibitor of dna replication, sira, in complex with domain i of dnaa 0.7196 84 154
ID Description Score Start End Superfamily
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8375 64 150 3.30.300.180
af_P9WNW3_9_100_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8242 98 152 3.30.300.180
af_P9WFL1_75_162_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8211 64 150 3.30.300.180
af_Q2G2H5_2_79_3.30.300.180 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.8057 103 152 3.30.300.180
4tpsB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;DnaA, N-terminal domain 0.7196 84 154 3.30.300.180
ID Description Score Start End GO Terms
AF-A0A1W1HV20-F1-model_v4 DUF721 domain-containing protein 0.9603 85 153
AF-A0A0K2RKS3-F1-model_v4 UPF0232 protein SCO3875 0.9301 84 156
AF-A0A7V9IBD7-F1-model_v4 DUF721 domain-containing protein 0.9125 82 153
AF-A0A7V2TVS4-F1-model_v4 DUF721 domain-containing protein 0.9111 81 153
AF-A0A1F2X971-F1-model_v4 RNA-binding protein 0.9107 83 153

Map