F467478

General Info

Members Datasets Scaffolds Average Seq Length
595 261 1190 226

Family's Representative Sequence

Representative Sequence 3300046660|Ga0495625_0132397|Ga0495625_0132397_877_1662
Length 261
Sequence MHDVLSVQSYWTLGPATTPLFWSGKEMPHNGRLESNSTLPMHVLLVEDDAVLADGLTRVLQGHGMQVEVAGDGLLADQLLQRGSVAVAVLDIGLPGIDGFEVVRRLRARGATVPVLLLTARDAVEDRVRGLELGADDYLVKPFATAELVARIRALARRNAPPAKLLALGQLTLDVAARRARVGERALELSVREWAVLEYLLQHAGRVVSKQQIIDAIQPWGDDLTLNAVEVYVSRLRLKLAGAGIAIRTIRGFGYLLEAGA

Samples

Sample ID Description Type Environment
1 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
18 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
28 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
29 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
41 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
42 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
43 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
49 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
58 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
60 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
69 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
70 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
71 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
73 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
101 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
102 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
103 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
104 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
105 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
106 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
118 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
121 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
139 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
156 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
165 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
166 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
197 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
198 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
199 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
200 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
201 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
202 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
203 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
213 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
216 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
220 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
221 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
222 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
223 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
227 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
228 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
229 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
230 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
231 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
232 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
233 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
234 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
235 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
236 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
237 2643221638 Duganella sp. Root336D2 Isolate Unclassified
238 2643221645 Massilia sp. Root351 Isolate Unclassified
239 2643221664 Massilia sp. Root418 Isolate Unclassified
240 2738541280 Massilia sp. GV090 Isolate Unclassified
241 2738541297 Duganella sp. GV083 Isolate Unclassified
242 2738541300 Massilia sp. GV016 Isolate Unclassified
243 2738541357 Duganella sp. GV053 Isolate Unclassified
244 2738543003 Duganella sp. GV066 Isolate Unclassified
245 2738543018 Massilia sp. GV045 Isolate Unclassified
246 2738543026 Duganella sp. GV089 Isolate Unclassified
247 2738543029 Duganella sp. GV039 Isolate Unclassified
248 2738543030 Massilia sp. GV097 Isolate Unclassified
249 2818991436 Collimonas arenae 515 Isolate Unclassified
250 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
251 2821131069 Duganella sp. 1224 Isolate Unclassified
252 2842711865 Duganella sp. R-73148 Isolate Unclassified
253 2857553236 Duganella sp. R-74557 Isolate Unclassified
254 2857558681 Duganella sp. R-74565 Isolate Unclassified
255 2857564685 Duganella sp. R-74599 Isolate Unclassified
256 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
257 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
258 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
259 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
260 2904424332 Duganella sp. 1411 Isolate Rhizosphere
261 2919476304 Duganella sp. 3397 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.13
Metatranscriptomes 0
Isolates 4.87

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.32
Nodule 0.84
Rhizoplane 1.01
Rhizosphere 70.25
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495625_0132397 3300046660 Bacteria 1688
2 JGI25155J39150_1000204 3300002704 Bacteria 24399
3 JGI25156J39149_1000154 3300002705 Bacteria 50528
4 JGI25156J39149_1004191 3300002705 Bacteria 4461
5 JGI25162J39368_1000001 3300002737 Bacteria 740113
6 JGI25154J39366_1000401 3300002738 Bacteria 23593
7 JGI25154J39366_1000462 3300002738 Bacteria 21234
8 JGI25154J39366_1000482 3300002738 Bacteria 20741
9 JGI25158J39367_1001396 3300002739 Bacteria 4255
10 JGI25157J39369_1000169 3300002741 Bacteria 55047
11 JGI25150J39212_1000493 3300002774 Bacteria 16569
12 JGI25150J39212_1002117 3300002774 Bacteria 5134
13 JGI25159J45721_1002464 3300002987 Bacteria 7021
14 JGI25159J45721_1009549 3300002987 Bacteria 2550
15 JGI25165J46597_1000001 3300003214 Bacteria 1111887
16 JGI25153J46596_10007526 3300003215 Bacteria 5336
17 JGI25153J46596_10018805 3300003215 Bacteria 2669
18 JGI25160J50197_1009016 3300003354 Bacteria 3740
19 JGI25161J50226_1000550 3300003374 Bacteria 16009
20 JGI25161J50226_1002442 3300003374 Bacteria 4768
21 Ga0055538_1000001 3300003751 Bacteria 1111887
22 Ga0055539_1000001 3300003752 Bacteria 1111887
23 Ga0055533_1000003 3300003756 Bacteria 1111887
24 Ga0055532_1000017 3300003758 Bacteria 306880
25 Ga0055525_1000003 3300003759 Bacteria 962094
26 Ga0055525_1000100 3300003759 Bacteria 136467
27 Ga0055535_1007304 3300003761 Bacteria 2126
28 Ga0055526_1000320 3300003771 Bacteria 39805
29 Ga0055526_1000430 3300003771 Bacteria 33723
30 Ga0055526_1002009 3300003771 Bacteria 14004
31 Ga0055526_1002659 3300003771 Bacteria 11927
32 Ga0055526_1006278 3300003771 Bacteria 6501
33 Ga0055537_1000291 3300003773 Bacteria 35541
34 Ga0055537_1002731 3300003773 Bacteria 5734
35 Ga0055537_1008826 3300003773 Bacteria 2282
36 Ga0055524_1000003 3300003775 Bacteria 399748
37 Ga0055524_1002404 3300003775 Bacteria 9694
38 Ga0055524_1007652 3300003775 Bacteria 4565
39 Ga0055524_1010991 3300003775 Bacteria 3565
40 Ga0055524_1013748 3300003775 Bacteria 3037
41 Ga0055534_1000582 3300003784 Bacteria 19190
42 Ga0055534_1004125 3300003784 Bacteria 4321
43 Ga0055534_1007277 3300003784 Bacteria 2663
44 Ga0055528_1000218 3300003790 Bacteria 48330
45 Ga0055528_1004693 3300003790 Bacteria 6528
46 Ga0055530_10002483 3300003791 Bacteria 11819
47 Ga0055530_10002831 3300003791 Bacteria 10628
48 Ga0055530_10007493 3300003791 Bacteria 4582
49 Ga0055531_10007225 3300003794 Bacteria 6107
50 Ga0055541_1000001 3300003841 Bacteria 1111887
51 Ga0055543_1000314 3300004625 Bacteria 33695
52 Ga0065165_1000454 3300005262 Bacteria 64290
53 Ga0065165_1001037 3300005262 Bacteria 33702
54 Ga0065165_1064477 3300005262 Bacteria 992
55 Ga0070658_10010301 3300005327 Bacteria 7500
56 Ga0070658_10159703 3300005327 Bacteria 1891
57 Ga0070683_100318471 3300005329 Bacteria 1480
58 Ga0070659_100661457 3300005366 Bacteria 901
59 Ga0070663_100061283 3300005455 Bacteria 2709
60 Ga0070663_100352312 3300005455 Bacteria 1192
61 Ga0070681_10000012 3300005458 Bacteria 137191
62 Ga0068855_100016126 3300005563 Bacteria 8984
63 Ga0068852_100037622 3300005616 Bacteria 4059
64 Ga0070717_10080506 3300006028 Bacteria 2733
65 Ga0068871_100786782 3300006358 Bacteria 876
66 Ga0075434_100163867 3300006871 Bacteria 2243
67 Ga0079104_1012347 3300006946 Bacteria 2692
68 Ga0099826_10000002 3300006948 Bacteria 1125830
69 Ga0105251_10126942 3300009011 Bacteria 1157
70 Ga0105244_10001942 3300009036 Bacteria 16057
71 Ga0105244_10026718 3300009036 Bacteria 3120
72 Ga0105240_10001581 3300009093 Bacteria 38647
73 Ga0105240_10014926 3300009093 Bacteria 10583
74 Ga0105242_10086220 3300009176 Bacteria 2635
75 Ga0105237_10067442 3300009545 Bacteria 3572
76 Ga0105238_10010636 3300009551 Bacteria 9242
77 Ga0105238_10857344 3300009551 Bacteria 926
78 Ga0105246_10231970 3300011119 Bacteria 1454
79 Ga0157327_1008995 3300012512 Bacteria 909
80 Ga0157370_10039292 3300013104 Bacteria 4573
81 Ga0157374_10134605 3300013296 Bacteria 2395
82 Ga0157372_10250907 3300013307 Bacteria 2054
83 Ga0182008_10020209 3300014497 Bacteria 3431
84 Ga0182008_10168864 3300014497 Bacteria 1104
85 Ga0182006_1000029 3300015261 Bacteria 247579
86 Ga0182005_1000037 3300015265 Bacteria 166102
87 Ga0182005_1000809 3300015265 Bacteria 14168
88 Ga0213872_10000001 3300021361 Bacteria 662532
89 Ga0213872_10000023 3300021361 Bacteria 157443
90 Ga0213872_10000125 3300021361 Bacteria 71792
91 Ga0213872_10001662 3300021361 Bacteria 14019
92 Ga0213872_10002143 3300021361 Bacteria 11835
93 Ga0213872_10019670 3300021361 Bacteria 3110
94 Ga0213872_10047170 3300021361 Bacteria 1959
95 Ga0209435_100015 3300025206 Bacteria 321177
96 Ga0209435_100162 3300025206 Bacteria 21364
97 Ga0209760_100884 3300025207 Bacteria 3807
98 Ga0209436_100229 3300025208 Bacteria 25613
99 Ga0209436_100383 3300025208 Bacteria 19985
100 Ga0209784_100004 3300025224 Bacteria 1378156
101 Ga0209566_100004 3300025225 Bacteria 1531866
102 Ga0209674_100006 3300025226 Bacteria 1531866
103 Ga0209147_100004 3300025229 Bacteria 1371850
104 Ga0209563_100009 3300025230 Bacteria 1378156
105 Ga0209563_100112 3300025230 Bacteria 136524
106 Ga0207427_100832 3300025231 Bacteria 13790
107 Ga0209437_100004 3300025233 Bacteria 1378156
108 Ga0209437_100045 3300025233 Bacteria 429809
109 Ga0209258_100226 3300025242 Bacteria 106588
110 Ga0207425_1000001 3300025245 Bacteria 2525432
111 Ga0207425_1000356 3300025245 Bacteria 31718
112 Ga0209646_1000020 3300025246 Bacteria 462204
113 Ga0209646_1000040 3300025246 Bacteria 347867
114 Ga0209646_1000051 3300025246 Bacteria 296525
115 Ga0209026_1000034 3300025250 Bacteria 306953
116 Ga0209026_1000808 3300025250 Bacteria 16967
117 Ga0209677_100005 3300025253 Bacteria 1378156
118 Ga0209759_1000049 3300025256 Bacteria 221692
119 Ga0209759_1000809 3300025256 Bacteria 25105
120 Ga0209129_1000001 3300025258 Bacteria 1452436
121 Ga0209233_1000005 3300025261 Bacteria 1531866
122 Ga0209233_1015716 3300025261 Bacteria 2101
123 Ga0209565_1000408 3300025263 Bacteria 35839
124 Ga0209565_1001250 3300025263 Bacteria 11868
125 Ga0209565_1001343 3300025263 Bacteria 11190
126 Ga0209565_1001685 3300025263 Bacteria 9155
127 Ga0209565_1020643 3300025263 Bacteria 1387
128 Ga0209455_1001266 3300025272 Bacteria 11834
129 Ga0209673_1000007 3300025273 Bacteria 634477
130 Ga0209673_1028291 3300025273 Bacteria 1807
131 Ga0209130_1000156 3300025284 Bacteria 101929
132 Ga0209130_1000552 3300025284 Bacteria 37318
133 Ga0209130_1001534 3300025284 Bacteria 14779
134 Ga0209675_1000009 3300025291 Bacteria 562872
135 Ga0209675_1000952 3300025291 Bacteria 18424
136 Ga0209675_1002271 3300025291 Bacteria 10018
137 Ga0209675_1006483 3300025291 Bacteria 4679
138 Ga0209025_1002964 3300025294 Bacteria 16864
139 Ga0209564_1000011 3300025295 Bacteria 822327
140 Ga0209564_1000055 3300025295 Bacteria 343782
141 Ga0209564_1001834 3300025295 Bacteria 19466
142 Ga0209564_1007870 3300025295 Bacteria 5395
143 Ga0209564_1008164 3300025295 Bacteria 5232
144 Ga0209564_1027983 3300025295 Bacteria 1815
145 Ga0209758_1000020 3300025297 Bacteria 734220
146 Ga0209758_1002686 3300025297 Bacteria 17535
147 Ga0209050_1000116 3300025298 Bacteria 204164
148 Ga0209050_1001137 3300025298 Bacteria 32035
149 Ga0209050_1001518 3300025298 Bacteria 24484
150 Ga0209256_1000007 3300025299 Bacteria 1136599
151 Ga0209256_1000774 3300025299 Bacteria 41416
152 Ga0209256_1000849 3300025299 Bacteria 38168
153 Ga0209256_1003155 3300025299 Bacteria 11967
154 Ga0209256_1003851 3300025299 Bacteria 10017
155 Ga0209256_1006694 3300025299 Bacteria 5985
156 Ga0207426_1001185 3300025302 Bacteria 23278
157 Ga0209257_1000003 3300025304 Bacteria 1702593
158 Ga0207655_1020069 3300025728 Bacteria 3458
159 Ga0207655_1022356 3300025728 Bacteria 3173
160 Ga0207705_10010940 3300025909 Bacteria 6587
161 Ga0207707_10000544 3300025912 Bacteria 38374
162 Ga0207695_10004388 3300025913 Bacteria 19283
163 Ga0207695_10577052 3300025913 Bacteria 1006
164 Ga0207660_10248580 3300025917 Bacteria 1403
165 Ga0207657_10064103 3300025919 Bacteria 3138
166 Ga0207652_10320550 3300025921 Bacteria 1399
167 Ga0207694_10024768 3300025924 Bacteria 4559
168 Ga0207694_10473486 3300025924 Bacteria 1047
169 Ga0207661_10391596 3300025944 Bacteria 1259
170 Ga0207667_10065764 3300025949 Bacteria 3780
171 Ga0207678_10228370 3300026067 Bacteria 1594
172 Ga0207702_10047357 3300026078 Bacteria 3623
173 Ga0207698_10026355 3300026142 Bacteria 4112
174 Ga0209282_1000001 3300027666 Bacteria 2450367
175 Ga0307515_10121718 3300028794 Bacteria 2950
176 Ga0316177_1004308 3300030731 Bacteria 5231
177 Ga0314311_1236610 3300030733 Bacteria 2438
178 Ga0316180_1127622 3300030736 Bacteria 5640
179 Ga0316182_1273087 3300030745 Bacteria 1344
180 Ga0265328_10001305 3300031239 Bacteria 11503
181 Ga0265331_10002913 3300031250 Bacteria 11312
182 Ga0265327_10000020 3300031251 Bacteria 424552
183 Ga0265327_10028765 3300031251 Bacteria 3171
184 Ga0307408_100000991 3300031548 Bacteria 21908
185 Ga0307408_100002614 3300031548 Bacteria 12535
186 Ga0307408_100032945 3300031548 Bacteria 3616
187 Ga0265314_10206031 3300031711 Bacteria 1158
188 Ga0307518_10056211 3300031838 Bacteria 2859
189 Ga0395899_0000139 3300037312 Bacteria 110692
190 Ga0395899_0005591 3300037312 Bacteria 9748
191 Ga0395899_0128234 3300037312 Bacteria 1813
192 Ga0395900_0000059 3300037418 Bacteria 205996
193 Ga0395900_0004613 3300037418 Bacteria 14540
194 Ga0395900_0039861 3300037418 Bacteria 4841
195 Ga0395900_0072159 3300037418 Bacteria 3550
196 Ga0395900_0299397 3300037418 Bacteria 1595
197 Ga0395898_0089375 3300037466 Bacteria 2964
198 Ga0395898_0130663 3300037466 Bacteria 2406
199 Ga0395898_0356627 3300037466 Bacteria 1394
200 Ga0395898_0654509 3300037466 Bacteria 993
201 Ga0395905_0000221 3300037471 Bacteria 87203
202 Ga0395905_0004135 3300037471 Bacteria 15189
203 Ga0395905_0047256 3300037471 Bacteria 4034
204 Ga0395905_0121379 3300037471 Bacteria 2456
205 Ga0395905_0148558 3300037471 Bacteria 2205
206 Ga0395901_0001763 3300038443 Bacteria 22320
207 Ga0395901_0248565 3300038443 Bacteria 1853
208 Ga0395901_0535655 3300038443 Bacteria 1188
209 Ga0436361_0027317 3300039447 Bacteria 79578
210 Ga0436361_0060434 3300039447 Bacteria 165633
211 Ga0436361_0225876 3300039447 Bacteria 30906
212 Ga0436361_0285207 3300039447 Bacteria 30209
213 Ga0436361_0333766 3300039447 Bacteria 15231
214 Ga0436361_0609365 3300039447 Bacteria 10700
215 Ga0436361_0776182 3300039447 Bacteria 2180
216 Ga0436361_1161377 3300039447 Bacteria 2007
217 Ga0439466_0040818 3300041411 Bacteria 1551
218 Ga0439449_0000171 3300042007 Bacteria 22436
219 Ga0439450_016499 3300042008 Bacteria 1528
220 Ga0439455_0014642 3300042012 Bacteria 1793
221 Ga0439455_0027511 3300042012 Bacteria 1394
222 Ga0466972_0000088 3300044658 Bacteria 84167
223 Ga0466981_0241937 3300044669 Bacteria 1172
224 Ga0466957_0180885 3300044842 Bacteria 1377
225 Ga0466958_0246483 3300045836 Bacteria 1142
226 Ga0466967_0025712 3300045976 Bacteria 4858
227 Ga0466967_0061513 3300045976 Bacteria 3331
228 Ga0495617_005158 3300046452 Bacteria 4665
229 Ga0495617_036340 3300046452 Bacteria 1651
230 Ga0495627_000059 3300046453 Bacteria 142466
231 Ga0495627_069399 3300046453 Bacteria 1031
232 Ga0495592_0014075 3300046454 Bacteria 6078
233 Ga0495638_0001490 3300046460 Bacteria 21133
234 Ga0495638_0003710 3300046460 Bacteria 11888
235 Ga0495638_0008979 3300046460 Bacteria 7048
236 Ga0495638_0131391 3300046460 Bacteria 1470
237 Ga0495638_0135165 3300046460 Bacteria 1445
238 Ga0495651_0030753 3300046462 Bacteria 4186
239 Ga0495651_0049283 3300046462 Bacteria 3250
240 Ga0495653_0001379 3300046463 Bacteria 18872
241 Ga0495650_0000019 3300046471 Bacteria 533849
242 Ga0495650_0000224 3300046471 Bacteria 118058
243 Ga0495650_0000521 3300046471 Bacteria 56415
244 Ga0495650_0000618 3300046471 Bacteria 48166
245 Ga0495650_0000933 3300046471 Bacteria 33909
246 Ga0495650_0003036 3300046471 Bacteria 12670
247 Ga0495650_0020702 3300046471 Bacteria 3200
248 Ga0495580_0278970 3300046472 Bacteria 1140
249 Ga0495582_0061167 3300046473 Bacteria 2079
250 Ga0495605_0000028 3300046474 Bacteria 218471
251 Ga0495605_0026566 3300046474 Bacteria 3008
252 Ga0495605_0134590 3300046474 Bacteria 1112
253 Ga0495639_0012342 3300046475 Bacteria 3686
254 Ga0495584_0000133 3300046491 Bacteria 51161
255 Ga0495584_0002864 3300046491 Bacteria 9636
256 Ga0495584_0005809 3300046491 Bacteria 6504
257 Ga0495584_0006777 3300046491 Bacteria 5980
258 Ga0495584_0016209 3300046491 Bacteria 3801
259 Ga0495584_0068436 3300046491 Bacteria 1783
260 Ga0495584_0398353 3300046491 Bacteria 699
261 Ga0495585_0000005 3300046492 Bacteria 328103
262 Ga0495585_0001478 3300046492 Bacteria 18368
263 Ga0495585_0002208 3300046492 Bacteria 14125
264 Ga0495585_0002259 3300046492 Bacteria 13931
265 Ga0495585_0011077 3300046492 Bacteria 5352
266 Ga0495585_0018070 3300046492 Bacteria 4068
267 Ga0495585_0029081 3300046492 Bacteria 3148
268 Ga0495585_0030142 3300046492 Bacteria 3086
269 Ga0495585_0051043 3300046492 Bacteria 2293
270 Ga0495594_0001197 3300046499 Bacteria 13581
271 Ga0495594_0016797 3300046499 Bacteria 3860
272 Ga0495596_0001161 3300046500 Bacteria 15441
273 Ga0495596_0001619 3300046500 Bacteria 12813
274 Ga0495596_0007212 3300046500 Bacteria 5029
275 Ga0495607_0002450 3300046501 Bacteria 15091
276 Ga0495607_0006093 3300046501 Bacteria 8529
277 Ga0495607_0009950 3300046501 Bacteria 6403
278 Ga0495607_0010927 3300046501 Bacteria 6073
279 Ga0495607_0020281 3300046501 Bacteria 4205
280 Ga0495607_0027308 3300046501 Bacteria 3531
281 Ga0495583_0000537 3300046506 Bacteria 53610
282 Ga0495583_0001748 3300046506 Bacteria 20746
283 Ga0495583_0002111 3300046506 Bacteria 17865
284 Ga0495583_0003011 3300046506 Bacteria 13467
285 Ga0495583_0004132 3300046506 Bacteria 10639
286 Ga0495583_0008403 3300046506 Bacteria 6317
287 Ga0495583_0043044 3300046506 Bacteria 2105
288 Ga0495583_0044897 3300046506 Bacteria 2046
289 Ga0495606_0000001 3300046507 Bacteria 592123
290 Ga0495606_0000601 3300046507 Bacteria 57004
291 Ga0495606_0003006 3300046507 Bacteria 18479
292 Ga0495606_0003203 3300046507 Bacteria 17645
293 Ga0495606_0003465 3300046507 Bacteria 16733
294 Ga0495606_0006214 3300046507 Bacteria 11103
295 Ga0495606_0008710 3300046507 Bacteria 8737
296 Ga0495606_0022232 3300046507 Bacteria 4626
297 Ga0495606_0082780 3300046507 Bacteria 1991
298 Ga0495606_0135014 3300046507 Bacteria 1462
299 Ga0495606_0244236 3300046507 Bacteria 999
300 Ga0495610_0002283 3300046512 Bacteria 16194
301 Ga0495610_0002657 3300046512 Bacteria 14759
302 Ga0495610_0006367 3300046512 Bacteria 8146
303 Ga0495610_0014220 3300046512 Bacteria 4686
304 Ga0495610_0079844 3300046512 Bacteria 1505
305 Ga0495616_0000729 3300046513 Bacteria 24188
306 Ga0495616_0001200 3300046513 Bacteria 18295
307 Ga0495616_0004957 3300046513 Bacteria 8311
308 Ga0495616_0005128 3300046513 Bacteria 8134
309 Ga0495616_0016780 3300046513 Bacteria 4046
310 Ga0495616_0065863 3300046513 Bacteria 1763
311 Ga0495616_0226776 3300046513 Bacteria 811
312 Ga0495618_0014611 3300046514 Bacteria 4786
313 Ga0495620_0008352 3300046515 Bacteria 5563
314 Ga0495628_0000835 3300046516 Bacteria 28571
315 Ga0495628_0005092 3300046516 Bacteria 11550
316 Ga0495630_0118045 3300046517 Bacteria 2012
317 Ga0495631_0004286 3300046518 Bacteria 7612
318 Ga0495631_0004395 3300046518 Bacteria 7510
319 Ga0495631_0011347 3300046518 Bacteria 4384
320 Ga0495632_0008366 3300046519 Bacteria 6359
321 Ga0495632_0013816 3300046519 Bacteria 4591
322 Ga0495632_0015168 3300046519 Bacteria 4332
323 Ga0495637_0008362 3300046520 Bacteria 5087
324 Ga0495643_0000444 3300046522 Bacteria 53441
325 Ga0495643_0001965 3300046522 Bacteria 17240
326 Ga0495643_0011718 3300046522 Bacteria 5323
327 Ga0495643_0015069 3300046522 Bacteria 4580
328 Ga0495643_0075509 3300046522 Bacteria 1763
329 Ga0495643_0177163 3300046522 Bacteria 1038
330 Ga0495644_0000442 3300046523 Bacteria 18239
331 Ga0495644_0008829 3300046523 Bacteria 3875
332 Ga0495644_0010728 3300046523 Bacteria 3530
333 Ga0495644_0012240 3300046523 Bacteria 3298
334 Ga0495644_0028183 3300046523 Bacteria 2125
335 Ga0495644_0089781 3300046523 Bacteria 1159
336 Ga0495648_0000076 3300046524 Bacteria 129413
337 Ga0495648_0001719 3300046524 Bacteria 21134
338 Ga0495648_0002438 3300046524 Bacteria 17217
339 Ga0495648_0004060 3300046524 Bacteria 12633
340 Ga0495648_0019389 3300046524 Bacteria 4784
341 Ga0495648_0021351 3300046524 Bacteria 4486
342 Ga0495663_0003696 3300046525 Bacteria 4376
343 Ga0495663_0003907 3300046525 Bacteria 4247
344 Ga0495642_0002423 3300046528 Bacteria 7601
345 Ga0495642_0007890 3300046528 Bacteria 4078
346 Ga0495642_0022520 3300046528 Bacteria 2483
347 Ga0495642_0042311 3300046528 Bacteria 1855
348 Ga0495642_0043447 3300046528 Bacteria 1832
349 Ga0495642_0054249 3300046528 Bacteria 1653
350 Ga0495642_0177169 3300046528 Bacteria 927
351 Ga0495642_0193238 3300046528 Bacteria 886
352 Ga0495652_0025035 3300046529 Bacteria 5281
353 Ga0495652_0106884 3300046529 Bacteria 2258
354 Ga0495654_0000015 3300046530 Bacteria 307873
355 Ga0495654_0113740 3300046530 Bacteria 1232
356 Ga0495586_0131643 3300046535 Bacteria 1400
357 Ga0495587_0004707 3300046536 Bacteria 8954
358 Ga0495609_0000474 3300046538 Bacteria 32477
359 Ga0495609_0000945 3300046538 Bacteria 21038
360 Ga0495609_0023918 3300046538 Bacteria 2804
361 Ga0495609_0037303 3300046538 Bacteria 2193
362 Ga0495609_0046134 3300046538 Bacteria 1951
363 Ga0495609_0106475 3300046538 Bacteria 1212
364 Ga0495597_0001571 3300046542 Bacteria 16089
365 Ga0495597_0001734 3300046542 Bacteria 15028
366 Ga0495597_0001823 3300046542 Bacteria 14576
367 Ga0495597_0004860 3300046542 Bacteria 7241
368 Ga0495597_0017876 3300046542 Bacteria 3330
369 Ga0495597_0020251 3300046542 Bacteria 3100
370 Ga0495597_0064281 3300046542 Bacteria 1594
371 Ga0495597_0104297 3300046542 Bacteria 1193
372 Ga0495597_0233203 3300046542 Bacteria 728
373 Ga0495645_0177990 3300046543 Bacteria 1459
374 Ga0495622_0000169 3300046557 Bacteria 53731
375 Ga0495622_0000787 3300046557 Bacteria 17663
376 Ga0495622_0001840 3300046557 Bacteria 10471
377 Ga0495622_0021769 3300046557 Bacteria 2985
378 Ga0495622_0061400 3300046557 Bacteria 1740
379 Ga0495622_0074921 3300046557 Bacteria 1560
380 Ga0495633_0001212 3300046558 Bacteria 20769
381 Ga0495633_0001627 3300046558 Bacteria 16959
382 Ga0495633_0001865 3300046558 Bacteria 15455
383 Ga0495633_0003138 3300046558 Bacteria 11200
384 Ga0495633_0005251 3300046558 Bacteria 7987
385 Ga0495633_0006151 3300046558 Bacteria 7178
386 Ga0495633_0020774 3300046558 Bacteria 3296
387 Ga0495633_0041136 3300046558 Bacteria 2198
388 Ga0495633_0068268 3300046558 Bacteria 1659
389 Ga0495633_0072930 3300046558 Bacteria 1600
390 Ga0495633_0084972 3300046558 Bacteria 1472
391 Ga0495656_0007102 3300046615 Bacteria 3949
392 Ga0495656_0025072 3300046615 Bacteria 2360
393 Ga0495668_0000028 3300046616 Bacteria 286629
394 Ga0495668_0000241 3300046616 Bacteria 78040
395 Ga0495668_0002077 3300046616 Bacteria 17353
396 Ga0495668_0020475 3300046616 Bacteria 3805
397 Ga0495668_0038170 3300046616 Bacteria 2685
398 Ga0495668_0119351 3300046616 Bacteria 1442
399 Ga0495668_0243873 3300046616 Bacteria 984
400 Ga0495668_0326598 3300046616 Bacteria 841
401 Ga0495611_0001912 3300046648 Bacteria 9903
402 Ga0495611_0002628 3300046648 Bacteria 8135
403 Ga0495611_0003087 3300046648 Bacteria 7394
404 Ga0495611_0014463 3300046648 Bacteria 3371
405 Ga0495611_0017530 3300046648 Bacteria 3064
406 Ga0495611_0109009 3300046648 Bacteria 1288
407 Ga0495611_0171680 3300046648 Bacteria 1013
408 Ga0495625_0002519 3300046660 Bacteria 19715
409 Ga0495625_0002732 3300046660 Bacteria 18701
410 Ga0495625_0002859 3300046660 Bacteria 18117
411 Ga0495625_0002965 3300046660 Bacteria 17642
412 Ga0495625_0006140 3300046660 Bacteria 10760
413 Ga0495625_0009190 3300046660 Bacteria 8302
414 Ga0495625_0009772 3300046660 Bacteria 7982
415 Ga0495625_0022370 3300046660 Bacteria 4848
416 Ga0495625_0027801 3300046660 Bacteria 4250
417 Ga0495659_0000141 3300046664 Bacteria 31709
418 Ga0495659_0000426 3300046664 Bacteria 16062
419 Ga0495659_0023652 3300046664 Bacteria 2089
420 Ga0495659_0028566 3300046664 Bacteria 1931
421 Ga0495659_0156467 3300046664 Bacteria 918
422 Ga0495661_0003905 3300046665 Bacteria 10884
423 Ga0495661_0018343 3300046665 Bacteria 4604
424 Ga0495661_0023107 3300046665 Bacteria 4040
425 Ga0495661_0043650 3300046665 Bacteria 2754
426 Ga0495661_0044307 3300046665 Bacteria 2728
427 Ga0495661_0092701 3300046665 Bacteria 1716
428 Ga0495661_0143404 3300046665 Bacteria 1297
429 Ga0495661_0290610 3300046665 Bacteria 821
430 Ga0495588_0096012 3300046674 Bacteria 1554
431 Ga0495588_0369808 3300046674 Bacteria 753
432 Ga0495599_0006679 3300046678 Bacteria 6964
433 Ga0495623_0010696 3300046679 Bacteria 5941
434 Ga0495623_0088789 3300046679 Bacteria 1902
435 Ga0495646_0014479 3300046680 Bacteria 5015
436 Ga0495669_0036633 3300046684 Bacteria 2169
437 Ga0495669_0090722 3300046684 Bacteria 1410
438 Ga0495624_0003107 3300046690 Bacteria 12415
439 Ga0495624_0041596 3300046690 Bacteria 2938
440 Ga0495670_0026391 3300046691 Bacteria 2875
441 Ga0495670_0028155 3300046691 Bacteria 2785
442 Ga0495670_0139160 3300046691 Bacteria 1268
443 Ga0495671_0000606 3300046692 Bacteria 26397
444 Ga0495671_0012281 3300046692 Bacteria 4681
445 Ga0495671_0014108 3300046692 Bacteria 4308
446 Ga0495671_0019252 3300046692 Bacteria 3612
447 Ga0495671_0033336 3300046692 Bacteria 2624
448 Ga0495649_0004108 3300046694 Bacteria 9564
449 Ga0495649_0023765 3300046694 Bacteria 3423
450 Ga0495649_0038198 3300046694 Bacteria 2635
451 Ga0495649_0094167 3300046694 Bacteria 1594
452 Ga0495589_0042885 3300046794 Bacteria 2253
453 Ga0495589_0065143 3300046794 Bacteria 1786
454 Ga0495600_0001599 3300046809 Bacteria 12601
455 Ga0495600_0039697 3300046809 Bacteria 3065
456 Ga0495660_0001560 3300046810 Bacteria 15377
457 Ga0495660_0001725 3300046810 Bacteria 14608
458 Ga0495660_0001884 3300046810 Bacteria 13776
459 Ga0495660_0011044 3300046810 Bacteria 5244
460 Ga0495660_0052873 3300046810 Bacteria 2206
461 Ga0495660_0103809 3300046810 Bacteria 1460
462 Ga0495581_0013746 3300047315 Bacteria 4693
463 Ga0495581_0064606 3300047315 Bacteria 2114
464 Ga0495581_0117576 3300047315 Bacteria 1546
465 Ga0495604_0008630 3300047317 Bacteria 8057
466 Ga0495636_0000421 3300047318 Bacteria 15692
467 Ga0495636_0001925 3300047318 Bacteria 7944
468 Ga0495636_0003633 3300047318 Bacteria 5989
469 Ga0495636_0012980 3300047318 Bacteria 3302
470 Ga0495672_0000368 3300047320 Bacteria 57095
471 Ga0495672_0002311 3300047320 Bacteria 17684
472 Ga0495672_0005259 3300047320 Bacteria 10312
473 Ga0495672_0048358 3300047320 Bacteria 2522
474 Ga0495672_0132210 3300047320 Bacteria 1311
475 Ga0495676_0063427 3300047321 Bacteria 2880
476 Ga0495683_0001845 3300047323 Bacteria 13299
477 Ga0495683_0018620 3300047323 Bacteria 3587
478 Ga0495683_0054764 3300047323 Bacteria 1987
479 Ga0495683_0077246 3300047323 Bacteria 1628
480 Ga0495683_0117390 3300047323 Bacteria 1265
481 Ga0495683_0271388 3300047323 Bacteria 737
482 Ga0495687_000191 3300047443 Bacteria 88251
483 Ga0495687_005228 3300047443 Bacteria 8367
484 Ga0495687_031871 3300047443 Bacteria 2412
485 Ga0495687_035894 3300047443 Bacteria 2223
486 Ga0495675_0077121 3300047444 Bacteria 2100
487 Ga0495677_0001285 3300047445 Bacteria 10028
488 Ga0495677_0002306 3300047445 Bacteria 7521
489 Ga0495677_0004243 3300047445 Bacteria 5521
490 Ga0495677_0007293 3300047445 Bacteria 4136
491 Ga0495677_0008067 3300047445 Bacteria 3910
492 Ga0495677_0031279 3300047445 Bacteria 1937
493 Ga0495677_0039574 3300047445 Bacteria 1723
494 Ga0495679_011604 3300047446 Bacteria 3389
495 Ga0495685_000033 3300047447 Bacteria 57157
496 Ga0495685_065895 3300047447 Bacteria 1217
497 Ga0495685_104664 3300047447 Bacteria 933
498 Ga0495685_113266 3300047447 Bacteria 892
499 Ga0495673_0000003 3300047469 Bacteria 1491337
500 Ga0495673_0000285 3300047469 Bacteria 68361
501 Ga0495673_0077237 3300047469 Bacteria 1387
502 Ga0495681_0004385 3300047470 Bacteria 9641
503 Ga0495681_0006686 3300047470 Bacteria 7527
504 Ga0495681_0008422 3300047470 Bacteria 6471
505 Ga0495681_0083744 3300047470 Bacteria 1419
506 Ga0495681_0103346 3300047470 Bacteria 1243
507 Ga0495686_0000969 3300047472 Bacteria 35293
508 Ga0495686_0003173 3300047472 Bacteria 14488
509 Ga0495686_0015339 3300047472 Bacteria 5237
510 Ga0495686_0016691 3300047472 Bacteria 4971
511 Ga0495593_0005989 3300047673 Bacteria 7165
512 Ga0495593_0280477 3300047673 Bacteria 833
513 Ga0495602_0195610 3300048088 Bacteria 1547
514 Ga0495615_0001822 3300048090 Bacteria 3266
515 Ga0495626_0001508 3300048091 Bacteria 18371
516 Ga0495626_0010602 3300048091 Bacteria 4905
517 Ga0495626_0020935 3300048091 Bacteria 3253
518 Ga0495626_0039737 3300048091 Bacteria 2225
519 Ga0495626_0081323 3300048091 Bacteria 1438
520 Ga0495626_0155488 3300048091 Bacteria 961
521 Ga0496101_0282302 3300048904 Bacteria 1298
522 Ga0496102_0000934 3300048905 Bacteria 27547
523 Ga0496105_0120602 3300048908 Bacteria 2162
524 Ga0496111_0399817 3300048914 Bacteria 1015
525 Ga0496115_0000931 3300048918 Bacteria 21204
526 Ga0496115_0691370 3300048918 Bacteria 803
527 Ga0496116_0008717 3300048919 Bacteria 8757
528 Ga0496116_0018376 3300048919 Bacteria 5392
529 Ga0496116_0045258 3300048919 Bacteria 2981
530 Ga0496118_0056773 3300048921 Bacteria 2940
531 Ga0496121_0051558 3300048924 Bacteria 3464
532 Ga0496121_0097357 3300048924 Bacteria 2280
533 Ga0496122_0001290 3300048925 Bacteria 41594
534 Ga0496123_0001053 3300048926 Bacteria 41720
535 Ga0496124_0013336 3300048927 Bacteria 8031
536 Ga0496124_0114290 3300048927 Bacteria 2168
537 Ga0496124_0119712 3300048927 Bacteria 2106
538 Ga0496125_0004104 3300048928 Bacteria 17027
539 Ga0496125_0020679 3300048928 Bacteria 6173
540 Ga0495678_000030 3300049459 Bacteria 217986
541 Ga0495678_001616 3300049459 Bacteria 17222
542 Ga0495678_001803 3300049459 Bacteria 15794
543 Ga0495678_002839 3300049459 Bacteria 11216
544 Ga0495678_003125 3300049459 Bacteria 10487
545 Ga0495678_017694 3300049459 Bacteria 3221
546 Ga0495678_021386 3300049459 Bacteria 2849
547 Ga0495678_033064 3300049459 Bacteria 2138
548 Ga0495682_0000606 3300049460 Bacteria 24187
549 Ga0495682_0000761 3300049460 Bacteria 20689
550 Ga0495682_0006796 3300049460 Bacteria 4608
551 Ga0501069_0001879 3300049585 Bacteria 10487
552 Ga0501070_0162348 3300049586 Bacteria 1842
553 Ga0501238_000291 3300049671 Bacteria 6615
554 Ga0501249_005157 3300049679 Bacteria 2669
555 Ga0501269_000374 3300049766 Bacteria 10942
556 nmdc:mga03683_10327_c1 3300050489 Bacteria 3347
557 nmdc:mga07m45_75700_c1 3300050496 Bacteria 1918
558 nmdc:mga0n895_314019_c1 3300050512 Bacteria 1588
559 Ga0495601_0008109 3300053077 Bacteria 6193
560 Ga0500594_0001504 3300053118 Bacteria 5075
561 Ga0500595_000547 3300053119 Bacteria 22560
562 Ga0500618_000265 3300053125 Bacteria 40554
563 Ga0500574_000118 3300053141 Bacteria 8604
564 Ga0500586_000076 3300053145 Bacteria 16957
565 Ga0500619_000302 3300053154 Bacteria 9757
566 Ga0500634_0041118 3300053161 Bacteria 2511
567 2511250110 2511231003 Bacteria 5606035
568 2550693634 2548876994 Bacteria 4904866
569 2643790569 2643221554 Bacteria 6603920
570 2644031646 2643221603 Bacteria 6147767
571 2644211509 2643221638 Bacteria 6579467
572 2644253405 2643221645 Bacteria 7207331
573 2644355548 2643221664 Bacteria 7272945
574 2738737332 2738541280 Bacteria 6630198
575 2738830141 2738541297 Bacteria 6549566
576 2738841551 2738541300 Bacteria 6675882
577 2739153937 2738541357 Bacteria 6549408
578 2739195857 2738543003 Bacteria 6549560
579 2739272422 2738543018 Bacteria 6718814
580 2739322333 2738543026 Bacteria 6549408
581 2739340574 2738543029 Bacteria 6549249
582 2739341466 2738543030 Bacteria 6719714
583 2819540603 2818991436 Bacteria 5376622
584 2819592087 2818991445 Bacteria 4955017
585 2821132064 2821131069 Bacteria 6108407
586 2842712694 2842711865 Bacteria 7155354
587 2857557694 2857553236 Bacteria 6166726
588 2857563967 2857558681 Bacteria 6617694
589 2857568505 2857564685 Bacteria 6290584
590 2884812177 2884811622 Bacteria 5552861
591 2884840495 2884836552 Bacteria 5219991
592 2884855752 2884852848 Bacteria 5221161
593 2896157323 2896154374 Bacteria 5221518
594 2904425500 2904424332 Bacteria 7633521
595 2919477254 2919476304 Bacteria 5888696
596 Ga0495625_0132397
597 JGI25155J39150_1000204
598 JGI25156J39149_1000154
599 JGI25156J39149_1004191
600 JGI25162J39368_1000001
601 JGI25154J39366_1000401
602 JGI25154J39366_1000462
603 JGI25154J39366_1000482
604 JGI25158J39367_1001396
605 JGI25157J39369_1000169
606 JGI25150J39212_1000493
607 JGI25150J39212_1002117
608 JGI25159J45721_1002464
609 JGI25159J45721_1009549
610 JGI25165J46597_1000001
611 JGI25153J46596_10007526
612 JGI25153J46596_10018805
613 JGI25160J50197_1009016
614 JGI25161J50226_1000550
615 JGI25161J50226_1002442
616 Ga0055538_1000001
617 Ga0055539_1000001
618 Ga0055533_1000003
619 Ga0055532_1000017
620 Ga0055525_1000003
621 Ga0055525_1000100
622 Ga0055535_1007304
623 Ga0055526_1000320
624 Ga0055526_1000430
625 Ga0055526_1002009
626 Ga0055526_1002659
627 Ga0055526_1006278
628 Ga0055537_1000291
629 Ga0055537_1002731
630 Ga0055537_1008826
631 Ga0055524_1000003
632 Ga0055524_1002404
633 Ga0055524_1007652
634 Ga0055524_1010991
635 Ga0055524_1013748
636 Ga0055534_1000582
637 Ga0055534_1004125
638 Ga0055534_1007277
639 Ga0055528_1000218
640 Ga0055528_1004693
641 Ga0055530_10002483
642 Ga0055530_10002831
643 Ga0055530_10007493
644 Ga0055531_10007225
645 Ga0055541_1000001
646 Ga0055543_1000314
647 Ga0065165_1000454
648 Ga0065165_1001037
649 Ga0065165_1064477
650 Ga0070658_10010301
651 Ga0070658_10159703
652 Ga0070683_100318471
653 Ga0070659_100661457
654 Ga0070663_100061283
655 Ga0070663_100352312
656 Ga0070681_10000012
657 Ga0068855_100016126
658 Ga0068852_100037622
659 Ga0070717_10080506
660 Ga0068871_100786782
661 Ga0075434_100163867
662 Ga0079104_1012347
663 Ga0099826_10000002
664 Ga0105251_10126942
665 Ga0105244_10001942
666 Ga0105244_10026718
667 Ga0105240_10001581
668 Ga0105240_10014926
669 Ga0105242_10086220
670 Ga0105237_10067442
671 Ga0105238_10010636
672 Ga0105238_10857344
673 Ga0105246_10231970
674 Ga0157327_1008995
675 Ga0157370_10039292
676 Ga0157374_10134605
677 Ga0157372_10250907
678 Ga0182008_10020209
679 Ga0182008_10168864
680 Ga0182006_1000029
681 Ga0182005_1000037
682 Ga0182005_1000809
683 Ga0213872_10000001
684 Ga0213872_10000023
685 Ga0213872_10000125
686 Ga0213872_10001662
687 Ga0213872_10002143
688 Ga0213872_10019670
689 Ga0213872_10047170
690 Ga0209435_100015
691 Ga0209435_100162
692 Ga0209760_100884
693 Ga0209436_100229
694 Ga0209436_100383
695 Ga0209784_100004
696 Ga0209566_100004
697 Ga0209674_100006
698 Ga0209147_100004
699 Ga0209563_100009
700 Ga0209563_100112
701 Ga0207427_100832
702 Ga0209437_100004
703 Ga0209437_100045
704 Ga0209258_100226
705 Ga0207425_1000001
706 Ga0207425_1000356
707 Ga0209646_1000020
708 Ga0209646_1000040
709 Ga0209646_1000051
710 Ga0209026_1000034
711 Ga0209026_1000808
712 Ga0209677_100005
713 Ga0209759_1000049
714 Ga0209759_1000809
715 Ga0209129_1000001
716 Ga0209233_1000005
717 Ga0209233_1015716
718 Ga0209565_1000408
719 Ga0209565_1001250
720 Ga0209565_1001343
721 Ga0209565_1001685
722 Ga0209565_1020643
723 Ga0209455_1001266
724 Ga0209673_1000007
725 Ga0209673_1028291
726 Ga0209130_1000156
727 Ga0209130_1000552
728 Ga0209130_1001534
729 Ga0209675_1000009
730 Ga0209675_1000952
731 Ga0209675_1002271
732 Ga0209675_1006483
733 Ga0209025_1002964
734 Ga0209564_1000011
735 Ga0209564_1000055
736 Ga0209564_1001834
737 Ga0209564_1007870
738 Ga0209564_1008164
739 Ga0209564_1027983
740 Ga0209758_1000020
741 Ga0209758_1002686
742 Ga0209050_1000116
743 Ga0209050_1001137
744 Ga0209050_1001518
745 Ga0209256_1000007
746 Ga0209256_1000774
747 Ga0209256_1000849
748 Ga0209256_1003155
749 Ga0209256_1003851
750 Ga0209256_1006694
751 Ga0207426_1001185
752 Ga0209257_1000003
753 Ga0207655_1020069
754 Ga0207655_1022356
755 Ga0207705_10010940
756 Ga0207707_10000544
757 Ga0207695_10004388
758 Ga0207695_10577052
759 Ga0207660_10248580
760 Ga0207657_10064103
761 Ga0207652_10320550
762 Ga0207694_10024768
763 Ga0207694_10473486
764 Ga0207661_10391596
765 Ga0207667_10065764
766 Ga0207678_10228370
767 Ga0207702_10047357
768 Ga0207698_10026355
769 Ga0209282_1000001
770 Ga0307515_10121718
771 Ga0316177_1004308
772 Ga0314311_1236610
773 Ga0316180_1127622
774 Ga0316182_1273087
775 Ga0265328_10001305
776 Ga0265331_10002913
777 Ga0265327_10000020
778 Ga0265327_10028765
779 Ga0307408_100000991
780 Ga0307408_100002614
781 Ga0307408_100032945
782 Ga0265314_10206031
783 Ga0307518_10056211
784 Ga0395899_0000139
785 Ga0395899_0005591
786 Ga0395899_0128234
787 Ga0395900_0000059
788 Ga0395900_0004613
789 Ga0395900_0039861
790 Ga0395900_0072159
791 Ga0395900_0299397
792 Ga0395898_0089375
793 Ga0395898_0130663
794 Ga0395898_0356627
795 Ga0395898_0654509
796 Ga0395905_0000221
797 Ga0395905_0004135
798 Ga0395905_0047256
799 Ga0395905_0121379
800 Ga0395905_0148558
801 Ga0395901_0001763
802 Ga0395901_0248565
803 Ga0395901_0535655
804 Ga0436361_0027317
805 Ga0436361_0060434
806 Ga0436361_0225876
807 Ga0436361_0285207
808 Ga0436361_0333766
809 Ga0436361_0609365
810 Ga0436361_0776182
811 Ga0436361_1161377
812 Ga0439466_0040818
813 Ga0439449_0000171
814 Ga0439450_016499
815 Ga0439455_0014642
816 Ga0439455_0027511
817 Ga0466972_0000088
818 Ga0466981_0241937
819 Ga0466957_0180885
820 Ga0466958_0246483
821 Ga0466967_0025712
822 Ga0466967_0061513
823 Ga0495617_005158
824 Ga0495617_036340
825 Ga0495627_000059
826 Ga0495627_069399
827 Ga0495592_0014075
828 Ga0495638_0001490
829 Ga0495638_0003710
830 Ga0495638_0008979
831 Ga0495638_0131391
832 Ga0495638_0135165
833 Ga0495651_0030753
834 Ga0495651_0049283
835 Ga0495653_0001379
836 Ga0495650_0000019
837 Ga0495650_0000224
838 Ga0495650_0000521
839 Ga0495650_0000618
840 Ga0495650_0000933
841 Ga0495650_0003036
842 Ga0495650_0020702
843 Ga0495580_0278970
844 Ga0495582_0061167
845 Ga0495605_0000028
846 Ga0495605_0026566
847 Ga0495605_0134590
848 Ga0495639_0012342
849 Ga0495584_0000133
850 Ga0495584_0002864
851 Ga0495584_0005809
852 Ga0495584_0006777
853 Ga0495584_0016209
854 Ga0495584_0068436
855 Ga0495584_0398353
856 Ga0495585_0000005
857 Ga0495585_0001478
858 Ga0495585_0002208
859 Ga0495585_0002259
860 Ga0495585_0011077
861 Ga0495585_0018070
862 Ga0495585_0029081
863 Ga0495585_0030142
864 Ga0495585_0051043
865 Ga0495594_0001197
866 Ga0495594_0016797
867 Ga0495596_0001161
868 Ga0495596_0001619
869 Ga0495596_0007212
870 Ga0495607_0002450
871 Ga0495607_0006093
872 Ga0495607_0009950
873 Ga0495607_0010927
874 Ga0495607_0020281
875 Ga0495607_0027308
876 Ga0495583_0000537
877 Ga0495583_0001748
878 Ga0495583_0002111
879 Ga0495583_0003011
880 Ga0495583_0004132
881 Ga0495583_0008403
882 Ga0495583_0043044
883 Ga0495583_0044897
884 Ga0495606_0000001
885 Ga0495606_0000601
886 Ga0495606_0003006
887 Ga0495606_0003203
888 Ga0495606_0003465
889 Ga0495606_0006214
890 Ga0495606_0008710
891 Ga0495606_0022232
892 Ga0495606_0082780
893 Ga0495606_0135014
894 Ga0495606_0244236
895 Ga0495610_0002283
896 Ga0495610_0002657
897 Ga0495610_0006367
898 Ga0495610_0014220
899 Ga0495610_0079844
900 Ga0495616_0000729
901 Ga0495616_0001200
902 Ga0495616_0004957
903 Ga0495616_0005128
904 Ga0495616_0016780
905 Ga0495616_0065863
906 Ga0495616_0226776
907 Ga0495618_0014611
908 Ga0495620_0008352
909 Ga0495628_0000835
910 Ga0495628_0005092
911 Ga0495630_0118045
912 Ga0495631_0004286
913 Ga0495631_0004395
914 Ga0495631_0011347
915 Ga0495632_0008366
916 Ga0495632_0013816
917 Ga0495632_0015168
918 Ga0495637_0008362
919 Ga0495643_0000444
920 Ga0495643_0001965
921 Ga0495643_0011718
922 Ga0495643_0015069
923 Ga0495643_0075509
924 Ga0495643_0177163
925 Ga0495644_0000442
926 Ga0495644_0008829
927 Ga0495644_0010728
928 Ga0495644_0012240
929 Ga0495644_0028183
930 Ga0495644_0089781
931 Ga0495648_0000076
932 Ga0495648_0001719
933 Ga0495648_0002438
934 Ga0495648_0004060
935 Ga0495648_0019389
936 Ga0495648_0021351
937 Ga0495663_0003696
938 Ga0495663_0003907
939 Ga0495642_0002423
940 Ga0495642_0007890
941 Ga0495642_0022520
942 Ga0495642_0042311
943 Ga0495642_0043447
944 Ga0495642_0054249
945 Ga0495642_0177169
946 Ga0495642_0193238
947 Ga0495652_0025035
948 Ga0495652_0106884
949 Ga0495654_0000015
950 Ga0495654_0113740
951 Ga0495586_0131643
952 Ga0495587_0004707
953 Ga0495609_0000474
954 Ga0495609_0000945
955 Ga0495609_0023918
956 Ga0495609_0037303
957 Ga0495609_0046134
958 Ga0495609_0106475
959 Ga0495597_0001571
960 Ga0495597_0001734
961 Ga0495597_0001823
962 Ga0495597_0004860
963 Ga0495597_0017876
964 Ga0495597_0020251
965 Ga0495597_0064281
966 Ga0495597_0104297
967 Ga0495597_0233203
968 Ga0495645_0177990
969 Ga0495622_0000169
970 Ga0495622_0000787
971 Ga0495622_0001840
972 Ga0495622_0021769
973 Ga0495622_0061400
974 Ga0495622_0074921
975 Ga0495633_0001212
976 Ga0495633_0001627
977 Ga0495633_0001865
978 Ga0495633_0003138
979 Ga0495633_0005251
980 Ga0495633_0006151
981 Ga0495633_0020774
982 Ga0495633_0041136
983 Ga0495633_0068268
984 Ga0495633_0072930
985 Ga0495633_0084972
986 Ga0495656_0007102
987 Ga0495656_0025072
988 Ga0495668_0000028
989 Ga0495668_0000241
990 Ga0495668_0002077
991 Ga0495668_0020475
992 Ga0495668_0038170
993 Ga0495668_0119351
994 Ga0495668_0243873
995 Ga0495668_0326598
996 Ga0495611_0001912
997 Ga0495611_0002628
998 Ga0495611_0003087
999 Ga0495611_0014463
1000 Ga0495611_0017530
1001 Ga0495611_0109009
1002 Ga0495611_0171680
1003 Ga0495625_0002519
1004 Ga0495625_0002732
1005 Ga0495625_0002859
1006 Ga0495625_0002965
1007 Ga0495625_0006140
1008 Ga0495625_0009190
1009 Ga0495625_0009772
1010 Ga0495625_0022370
1011 Ga0495625_0027801
1012 Ga0495659_0000141
1013 Ga0495659_0000426
1014 Ga0495659_0023652
1015 Ga0495659_0028566
1016 Ga0495659_0156467
1017 Ga0495661_0003905
1018 Ga0495661_0018343
1019 Ga0495661_0023107
1020 Ga0495661_0043650
1021 Ga0495661_0044307
1022 Ga0495661_0092701
1023 Ga0495661_0143404
1024 Ga0495661_0290610
1025 Ga0495588_0096012
1026 Ga0495588_0369808
1027 Ga0495599_0006679
1028 Ga0495623_0010696
1029 Ga0495623_0088789
1030 Ga0495646_0014479
1031 Ga0495669_0036633
1032 Ga0495669_0090722
1033 Ga0495624_0003107
1034 Ga0495624_0041596
1035 Ga0495670_0026391
1036 Ga0495670_0028155
1037 Ga0495670_0139160
1038 Ga0495671_0000606
1039 Ga0495671_0012281
1040 Ga0495671_0014108
1041 Ga0495671_0019252
1042 Ga0495671_0033336
1043 Ga0495649_0004108
1044 Ga0495649_0023765
1045 Ga0495649_0038198
1046 Ga0495649_0094167
1047 Ga0495589_0042885
1048 Ga0495589_0065143
1049 Ga0495600_0001599
1050 Ga0495600_0039697
1051 Ga0495660_0001560
1052 Ga0495660_0001725
1053 Ga0495660_0001884
1054 Ga0495660_0011044
1055 Ga0495660_0052873
1056 Ga0495660_0103809
1057 Ga0495581_0013746
1058 Ga0495581_0064606
1059 Ga0495581_0117576
1060 Ga0495604_0008630
1061 Ga0495636_0000421
1062 Ga0495636_0001925
1063 Ga0495636_0003633
1064 Ga0495636_0012980
1065 Ga0495672_0000368
1066 Ga0495672_0002311
1067 Ga0495672_0005259
1068 Ga0495672_0048358
1069 Ga0495672_0132210
1070 Ga0495676_0063427
1071 Ga0495683_0001845
1072 Ga0495683_0018620
1073 Ga0495683_0054764
1074 Ga0495683_0077246
1075 Ga0495683_0117390
1076 Ga0495683_0271388
1077 Ga0495687_000191
1078 Ga0495687_005228
1079 Ga0495687_031871
1080 Ga0495687_035894
1081 Ga0495675_0077121
1082 Ga0495677_0001285
1083 Ga0495677_0002306
1084 Ga0495677_0004243
1085 Ga0495677_0007293
1086 Ga0495677_0008067
1087 Ga0495677_0031279
1088 Ga0495677_0039574
1089 Ga0495679_011604
1090 Ga0495685_000033
1091 Ga0495685_065895
1092 Ga0495685_104664
1093 Ga0495685_113266
1094 Ga0495673_0000003
1095 Ga0495673_0000285
1096 Ga0495673_0077237
1097 Ga0495681_0004385
1098 Ga0495681_0006686
1099 Ga0495681_0008422
1100 Ga0495681_0083744
1101 Ga0495681_0103346
1102 Ga0495686_0000969
1103 Ga0495686_0003173
1104 Ga0495686_0015339
1105 Ga0495686_0016691
1106 Ga0495593_0005989
1107 Ga0495593_0280477
1108 Ga0495602_0195610
1109 Ga0495615_0001822
1110 Ga0495626_0001508
1111 Ga0495626_0010602
1112 Ga0495626_0020935
1113 Ga0495626_0039737
1114 Ga0495626_0081323
1115 Ga0495626_0155488
1116 Ga0496101_0282302
1117 Ga0496102_0000934
1118 Ga0496105_0120602
1119 Ga0496111_0399817
1120 Ga0496115_0000931
1121 Ga0496115_0691370
1122 Ga0496116_0008717
1123 Ga0496116_0018376
1124 Ga0496116_0045258
1125 Ga0496118_0056773
1126 Ga0496121_0051558
1127 Ga0496121_0097357
1128 Ga0496122_0001290
1129 Ga0496123_0001053
1130 Ga0496124_0013336
1131 Ga0496124_0114290
1132 Ga0496124_0119712
1133 Ga0496125_0004104
1134 Ga0496125_0020679
1135 Ga0495678_000030
1136 Ga0495678_001616
1137 Ga0495678_001803
1138 Ga0495678_002839
1139 Ga0495678_003125
1140 Ga0495678_017694
1141 Ga0495678_021386
1142 Ga0495678_033064
1143 Ga0495682_0000606
1144 Ga0495682_0000761
1145 Ga0495682_0006796
1146 Ga0501069_0001879
1147 Ga0501070_0162348
1148 Ga0501238_000291
1149 Ga0501249_005157
1150 Ga0501269_000374
1151 nmdc:mga03683_10327_c1
1152 nmdc:mga07m45_75700_c1
1153 nmdc:mga0n895_314019_c1
1154 Ga0495601_0008109
1155 Ga0500594_0001504
1156 Ga0500595_000547
1157 Ga0500618_000265
1158 Ga0500574_000118
1159 Ga0500586_000076
1160 Ga0500619_000302
1161 Ga0500634_0041118
1162 2511250110
1163 2550693634
1164 2643790569
1165 2644031646
1166 2644211509
1167 2644253405
1168 2644355548
1169 2738737332
1170 2738830141
1171 2738841551
1172 2739153937
1173 2739195857
1174 2739272422
1175 2739322333
1176 2739340574
1177 2739341466
1178 2819540603
1179 2819592087
1180 2821132064
1181 2842712694
1182 2857557694
1183 2857563967
1184 2857568505
1185 2884812177
1186 2884840495
1187 2884855752
1188 2896157323
1189 2904425500
1190 2919477254

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

43

153

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9695 2 119
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9687 1 119
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9679 1 119
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9651 1 119
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9644 2 118
ID Description Score Start End Superfamily
af_Q2FXN6_3_86_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9837 1 82 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9785 1 77 3.40.50.2300
af_P69228_9_89_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9771 2 77 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9742 1 77 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9718 1 77 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0S6VSY2-F1-model_v4 Type IV pilus assembly protein PilB 0.9807 2 119 GO:0000160
GO:0005524
GO:0005886
GO:0016887
AF-A0A7X7DME9-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9745 1 118 GO:0000155
AF-A0A5S9IQL5-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9714 2 118 GO:0000155
GO:0005524
GO:0005886
AF-A0A2J0KYQ6-F1-model_v4 Response regulatory domain-containing protein 0.9711 2 115 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2S0VX93-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9705 2 77 GO:0000155
GO:0016020

Map