F467478
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 595 | 261 | 1190 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300046660|Ga0495625_0132397|Ga0495625_0132397_877_1662 |
| Length | 261 |
| Sequence | MHDVLSVQSYWTLGPATTPLFWSGKEMPHNGRLESNSTLPMHVLLVEDDAVLADGLTRVLQGHGMQVEVAGDGLLADQLLQRGSVAVAVLDIGLPGIDGFEVVRRLRARGATVPVLLLTARDAVEDRVRGLELGADDYLVKPFATAELVARIRALARRNAPPAKLLALGQLTLDVAARRARVGERALELSVREWAVLEYLLQHAGRVVSKQQIIDAIQPWGDDLTLNAVEVYVSRLRLKLAGAGIAIRTIRGFGYLLEAGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 3 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 4 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 6 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 9 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 22 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 24 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 25 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 26 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 28 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 29 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 39 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 40 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 41 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 42 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 54 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 55 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 56 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 57 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 58 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 69 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 70 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 73 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 76 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 101 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 102 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 103 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 104 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 105 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 106 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 107 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 108 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 109 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 110 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 112 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 113 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 114 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 115 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 116 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 117 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 118 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 119 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 120 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 121 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 122 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 123 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 124 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 125 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 126 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 127 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 205 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 206 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 207 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 208 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 209 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 210 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 211 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 212 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 213 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 214 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 215 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 220 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 221 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 222 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 223 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 224 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 227 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 228 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 229 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 230 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 231 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 232 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 233 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 234 | 2548876994 | Herbaspirillum lusitanum P6-12 | Isolate | Nodule |
| 235 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 236 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 237 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 238 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 239 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 240 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 241 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 242 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 243 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 244 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 245 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 246 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 247 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 248 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 249 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 250 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 251 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 252 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 253 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 254 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 255 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 256 | 2884811622 | Herbaspirillum sp. 3C11 | Isolate | Unclassified |
| 257 | 2884836552 | Herbaspirillum sp. 3R-11 | Isolate | Unclassified |
| 258 | 2884852848 | Herbaspirillum sp. 3R11 | Isolate | Unclassified |
| 259 | 2896154374 | Herbaspirillum sp. 3R-3a1 | Isolate | Nodule |
| 260 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 261 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.13 |
| Metatranscriptomes | 0 |
| Isolates | 4.87 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.32 |
| Nodule | 0.84 |
| Rhizoplane | 1.01 |
| Rhizosphere | 70.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495625_0132397 | 3300046660 | Bacteria | 1688 |
| 2 | JGI25155J39150_1000204 | 3300002704 | Bacteria | 24399 |
| 3 | JGI25156J39149_1000154 | 3300002705 | Bacteria | 50528 |
| 4 | JGI25156J39149_1004191 | 3300002705 | Bacteria | 4461 |
| 5 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 6 | JGI25154J39366_1000401 | 3300002738 | Bacteria | 23593 |
| 7 | JGI25154J39366_1000462 | 3300002738 | Bacteria | 21234 |
| 8 | JGI25154J39366_1000482 | 3300002738 | Bacteria | 20741 |
| 9 | JGI25158J39367_1001396 | 3300002739 | Bacteria | 4255 |
| 10 | JGI25157J39369_1000169 | 3300002741 | Bacteria | 55047 |
| 11 | JGI25150J39212_1000493 | 3300002774 | Bacteria | 16569 |
| 12 | JGI25150J39212_1002117 | 3300002774 | Bacteria | 5134 |
| 13 | JGI25159J45721_1002464 | 3300002987 | Bacteria | 7021 |
| 14 | JGI25159J45721_1009549 | 3300002987 | Bacteria | 2550 |
| 15 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 16 | JGI25153J46596_10007526 | 3300003215 | Bacteria | 5336 |
| 17 | JGI25153J46596_10018805 | 3300003215 | Bacteria | 2669 |
| 18 | JGI25160J50197_1009016 | 3300003354 | Bacteria | 3740 |
| 19 | JGI25161J50226_1000550 | 3300003374 | Bacteria | 16009 |
| 20 | JGI25161J50226_1002442 | 3300003374 | Bacteria | 4768 |
| 21 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 22 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 23 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 24 | Ga0055532_1000017 | 3300003758 | Bacteria | 306880 |
| 25 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 26 | Ga0055525_1000100 | 3300003759 | Bacteria | 136467 |
| 27 | Ga0055535_1007304 | 3300003761 | Bacteria | 2126 |
| 28 | Ga0055526_1000320 | 3300003771 | Bacteria | 39805 |
| 29 | Ga0055526_1000430 | 3300003771 | Bacteria | 33723 |
| 30 | Ga0055526_1002009 | 3300003771 | Bacteria | 14004 |
| 31 | Ga0055526_1002659 | 3300003771 | Bacteria | 11927 |
| 32 | Ga0055526_1006278 | 3300003771 | Bacteria | 6501 |
| 33 | Ga0055537_1000291 | 3300003773 | Bacteria | 35541 |
| 34 | Ga0055537_1002731 | 3300003773 | Bacteria | 5734 |
| 35 | Ga0055537_1008826 | 3300003773 | Bacteria | 2282 |
| 36 | Ga0055524_1000003 | 3300003775 | Bacteria | 399748 |
| 37 | Ga0055524_1002404 | 3300003775 | Bacteria | 9694 |
| 38 | Ga0055524_1007652 | 3300003775 | Bacteria | 4565 |
| 39 | Ga0055524_1010991 | 3300003775 | Bacteria | 3565 |
| 40 | Ga0055524_1013748 | 3300003775 | Bacteria | 3037 |
| 41 | Ga0055534_1000582 | 3300003784 | Bacteria | 19190 |
| 42 | Ga0055534_1004125 | 3300003784 | Bacteria | 4321 |
| 43 | Ga0055534_1007277 | 3300003784 | Bacteria | 2663 |
| 44 | Ga0055528_1000218 | 3300003790 | Bacteria | 48330 |
| 45 | Ga0055528_1004693 | 3300003790 | Bacteria | 6528 |
| 46 | Ga0055530_10002483 | 3300003791 | Bacteria | 11819 |
| 47 | Ga0055530_10002831 | 3300003791 | Bacteria | 10628 |
| 48 | Ga0055530_10007493 | 3300003791 | Bacteria | 4582 |
| 49 | Ga0055531_10007225 | 3300003794 | Bacteria | 6107 |
| 50 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 51 | Ga0055543_1000314 | 3300004625 | Bacteria | 33695 |
| 52 | Ga0065165_1000454 | 3300005262 | Bacteria | 64290 |
| 53 | Ga0065165_1001037 | 3300005262 | Bacteria | 33702 |
| 54 | Ga0065165_1064477 | 3300005262 | Bacteria | 992 |
| 55 | Ga0070658_10010301 | 3300005327 | Bacteria | 7500 |
| 56 | Ga0070658_10159703 | 3300005327 | Bacteria | 1891 |
| 57 | Ga0070683_100318471 | 3300005329 | Bacteria | 1480 |
| 58 | Ga0070659_100661457 | 3300005366 | Bacteria | 901 |
| 59 | Ga0070663_100061283 | 3300005455 | Bacteria | 2709 |
| 60 | Ga0070663_100352312 | 3300005455 | Bacteria | 1192 |
| 61 | Ga0070681_10000012 | 3300005458 | Bacteria | 137191 |
| 62 | Ga0068855_100016126 | 3300005563 | Bacteria | 8984 |
| 63 | Ga0068852_100037622 | 3300005616 | Bacteria | 4059 |
| 64 | Ga0070717_10080506 | 3300006028 | Bacteria | 2733 |
| 65 | Ga0068871_100786782 | 3300006358 | Bacteria | 876 |
| 66 | Ga0075434_100163867 | 3300006871 | Bacteria | 2243 |
| 67 | Ga0079104_1012347 | 3300006946 | Bacteria | 2692 |
| 68 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 69 | Ga0105251_10126942 | 3300009011 | Bacteria | 1157 |
| 70 | Ga0105244_10001942 | 3300009036 | Bacteria | 16057 |
| 71 | Ga0105244_10026718 | 3300009036 | Bacteria | 3120 |
| 72 | Ga0105240_10001581 | 3300009093 | Bacteria | 38647 |
| 73 | Ga0105240_10014926 | 3300009093 | Bacteria | 10583 |
| 74 | Ga0105242_10086220 | 3300009176 | Bacteria | 2635 |
| 75 | Ga0105237_10067442 | 3300009545 | Bacteria | 3572 |
| 76 | Ga0105238_10010636 | 3300009551 | Bacteria | 9242 |
| 77 | Ga0105238_10857344 | 3300009551 | Bacteria | 926 |
| 78 | Ga0105246_10231970 | 3300011119 | Bacteria | 1454 |
| 79 | Ga0157327_1008995 | 3300012512 | Bacteria | 909 |
| 80 | Ga0157370_10039292 | 3300013104 | Bacteria | 4573 |
| 81 | Ga0157374_10134605 | 3300013296 | Bacteria | 2395 |
| 82 | Ga0157372_10250907 | 3300013307 | Bacteria | 2054 |
| 83 | Ga0182008_10020209 | 3300014497 | Bacteria | 3431 |
| 84 | Ga0182008_10168864 | 3300014497 | Bacteria | 1104 |
| 85 | Ga0182006_1000029 | 3300015261 | Bacteria | 247579 |
| 86 | Ga0182005_1000037 | 3300015265 | Bacteria | 166102 |
| 87 | Ga0182005_1000809 | 3300015265 | Bacteria | 14168 |
| 88 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 89 | Ga0213872_10000023 | 3300021361 | Bacteria | 157443 |
| 90 | Ga0213872_10000125 | 3300021361 | Bacteria | 71792 |
| 91 | Ga0213872_10001662 | 3300021361 | Bacteria | 14019 |
| 92 | Ga0213872_10002143 | 3300021361 | Bacteria | 11835 |
| 93 | Ga0213872_10019670 | 3300021361 | Bacteria | 3110 |
| 94 | Ga0213872_10047170 | 3300021361 | Bacteria | 1959 |
| 95 | Ga0209435_100015 | 3300025206 | Bacteria | 321177 |
| 96 | Ga0209435_100162 | 3300025206 | Bacteria | 21364 |
| 97 | Ga0209760_100884 | 3300025207 | Bacteria | 3807 |
| 98 | Ga0209436_100229 | 3300025208 | Bacteria | 25613 |
| 99 | Ga0209436_100383 | 3300025208 | Bacteria | 19985 |
| 100 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 101 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 102 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 103 | Ga0209147_100004 | 3300025229 | Bacteria | 1371850 |
| 104 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 105 | Ga0209563_100112 | 3300025230 | Bacteria | 136524 |
| 106 | Ga0207427_100832 | 3300025231 | Bacteria | 13790 |
| 107 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 108 | Ga0209437_100045 | 3300025233 | Bacteria | 429809 |
| 109 | Ga0209258_100226 | 3300025242 | Bacteria | 106588 |
| 110 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 111 | Ga0207425_1000356 | 3300025245 | Bacteria | 31718 |
| 112 | Ga0209646_1000020 | 3300025246 | Bacteria | 462204 |
| 113 | Ga0209646_1000040 | 3300025246 | Bacteria | 347867 |
| 114 | Ga0209646_1000051 | 3300025246 | Bacteria | 296525 |
| 115 | Ga0209026_1000034 | 3300025250 | Bacteria | 306953 |
| 116 | Ga0209026_1000808 | 3300025250 | Bacteria | 16967 |
| 117 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 118 | Ga0209759_1000049 | 3300025256 | Bacteria | 221692 |
| 119 | Ga0209759_1000809 | 3300025256 | Bacteria | 25105 |
| 120 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 121 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 122 | Ga0209233_1015716 | 3300025261 | Bacteria | 2101 |
| 123 | Ga0209565_1000408 | 3300025263 | Bacteria | 35839 |
| 124 | Ga0209565_1001250 | 3300025263 | Bacteria | 11868 |
| 125 | Ga0209565_1001343 | 3300025263 | Bacteria | 11190 |
| 126 | Ga0209565_1001685 | 3300025263 | Bacteria | 9155 |
| 127 | Ga0209565_1020643 | 3300025263 | Bacteria | 1387 |
| 128 | Ga0209455_1001266 | 3300025272 | Bacteria | 11834 |
| 129 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 130 | Ga0209673_1028291 | 3300025273 | Bacteria | 1807 |
| 131 | Ga0209130_1000156 | 3300025284 | Bacteria | 101929 |
| 132 | Ga0209130_1000552 | 3300025284 | Bacteria | 37318 |
| 133 | Ga0209130_1001534 | 3300025284 | Bacteria | 14779 |
| 134 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 135 | Ga0209675_1000952 | 3300025291 | Bacteria | 18424 |
| 136 | Ga0209675_1002271 | 3300025291 | Bacteria | 10018 |
| 137 | Ga0209675_1006483 | 3300025291 | Bacteria | 4679 |
| 138 | Ga0209025_1002964 | 3300025294 | Bacteria | 16864 |
| 139 | Ga0209564_1000011 | 3300025295 | Bacteria | 822327 |
| 140 | Ga0209564_1000055 | 3300025295 | Bacteria | 343782 |
| 141 | Ga0209564_1001834 | 3300025295 | Bacteria | 19466 |
| 142 | Ga0209564_1007870 | 3300025295 | Bacteria | 5395 |
| 143 | Ga0209564_1008164 | 3300025295 | Bacteria | 5232 |
| 144 | Ga0209564_1027983 | 3300025295 | Bacteria | 1815 |
| 145 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 146 | Ga0209758_1002686 | 3300025297 | Bacteria | 17535 |
| 147 | Ga0209050_1000116 | 3300025298 | Bacteria | 204164 |
| 148 | Ga0209050_1001137 | 3300025298 | Bacteria | 32035 |
| 149 | Ga0209050_1001518 | 3300025298 | Bacteria | 24484 |
| 150 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 151 | Ga0209256_1000774 | 3300025299 | Bacteria | 41416 |
| 152 | Ga0209256_1000849 | 3300025299 | Bacteria | 38168 |
| 153 | Ga0209256_1003155 | 3300025299 | Bacteria | 11967 |
| 154 | Ga0209256_1003851 | 3300025299 | Bacteria | 10017 |
| 155 | Ga0209256_1006694 | 3300025299 | Bacteria | 5985 |
| 156 | Ga0207426_1001185 | 3300025302 | Bacteria | 23278 |
| 157 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 158 | Ga0207655_1020069 | 3300025728 | Bacteria | 3458 |
| 159 | Ga0207655_1022356 | 3300025728 | Bacteria | 3173 |
| 160 | Ga0207705_10010940 | 3300025909 | Bacteria | 6587 |
| 161 | Ga0207707_10000544 | 3300025912 | Bacteria | 38374 |
| 162 | Ga0207695_10004388 | 3300025913 | Bacteria | 19283 |
| 163 | Ga0207695_10577052 | 3300025913 | Bacteria | 1006 |
| 164 | Ga0207660_10248580 | 3300025917 | Bacteria | 1403 |
| 165 | Ga0207657_10064103 | 3300025919 | Bacteria | 3138 |
| 166 | Ga0207652_10320550 | 3300025921 | Bacteria | 1399 |
| 167 | Ga0207694_10024768 | 3300025924 | Bacteria | 4559 |
| 168 | Ga0207694_10473486 | 3300025924 | Bacteria | 1047 |
| 169 | Ga0207661_10391596 | 3300025944 | Bacteria | 1259 |
| 170 | Ga0207667_10065764 | 3300025949 | Bacteria | 3780 |
| 171 | Ga0207678_10228370 | 3300026067 | Bacteria | 1594 |
| 172 | Ga0207702_10047357 | 3300026078 | Bacteria | 3623 |
| 173 | Ga0207698_10026355 | 3300026142 | Bacteria | 4112 |
| 174 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 175 | Ga0307515_10121718 | 3300028794 | Bacteria | 2950 |
| 176 | Ga0316177_1004308 | 3300030731 | Bacteria | 5231 |
| 177 | Ga0314311_1236610 | 3300030733 | Bacteria | 2438 |
| 178 | Ga0316180_1127622 | 3300030736 | Bacteria | 5640 |
| 179 | Ga0316182_1273087 | 3300030745 | Bacteria | 1344 |
| 180 | Ga0265328_10001305 | 3300031239 | Bacteria | 11503 |
| 181 | Ga0265331_10002913 | 3300031250 | Bacteria | 11312 |
| 182 | Ga0265327_10000020 | 3300031251 | Bacteria | 424552 |
| 183 | Ga0265327_10028765 | 3300031251 | Bacteria | 3171 |
| 184 | Ga0307408_100000991 | 3300031548 | Bacteria | 21908 |
| 185 | Ga0307408_100002614 | 3300031548 | Bacteria | 12535 |
| 186 | Ga0307408_100032945 | 3300031548 | Bacteria | 3616 |
| 187 | Ga0265314_10206031 | 3300031711 | Bacteria | 1158 |
| 188 | Ga0307518_10056211 | 3300031838 | Bacteria | 2859 |
| 189 | Ga0395899_0000139 | 3300037312 | Bacteria | 110692 |
| 190 | Ga0395899_0005591 | 3300037312 | Bacteria | 9748 |
| 191 | Ga0395899_0128234 | 3300037312 | Bacteria | 1813 |
| 192 | Ga0395900_0000059 | 3300037418 | Bacteria | 205996 |
| 193 | Ga0395900_0004613 | 3300037418 | Bacteria | 14540 |
| 194 | Ga0395900_0039861 | 3300037418 | Bacteria | 4841 |
| 195 | Ga0395900_0072159 | 3300037418 | Bacteria | 3550 |
| 196 | Ga0395900_0299397 | 3300037418 | Bacteria | 1595 |
| 197 | Ga0395898_0089375 | 3300037466 | Bacteria | 2964 |
| 198 | Ga0395898_0130663 | 3300037466 | Bacteria | 2406 |
| 199 | Ga0395898_0356627 | 3300037466 | Bacteria | 1394 |
| 200 | Ga0395898_0654509 | 3300037466 | Bacteria | 993 |
| 201 | Ga0395905_0000221 | 3300037471 | Bacteria | 87203 |
| 202 | Ga0395905_0004135 | 3300037471 | Bacteria | 15189 |
| 203 | Ga0395905_0047256 | 3300037471 | Bacteria | 4034 |
| 204 | Ga0395905_0121379 | 3300037471 | Bacteria | 2456 |
| 205 | Ga0395905_0148558 | 3300037471 | Bacteria | 2205 |
| 206 | Ga0395901_0001763 | 3300038443 | Bacteria | 22320 |
| 207 | Ga0395901_0248565 | 3300038443 | Bacteria | 1853 |
| 208 | Ga0395901_0535655 | 3300038443 | Bacteria | 1188 |
| 209 | Ga0436361_0027317 | 3300039447 | Bacteria | 79578 |
| 210 | Ga0436361_0060434 | 3300039447 | Bacteria | 165633 |
| 211 | Ga0436361_0225876 | 3300039447 | Bacteria | 30906 |
| 212 | Ga0436361_0285207 | 3300039447 | Bacteria | 30209 |
| 213 | Ga0436361_0333766 | 3300039447 | Bacteria | 15231 |
| 214 | Ga0436361_0609365 | 3300039447 | Bacteria | 10700 |
| 215 | Ga0436361_0776182 | 3300039447 | Bacteria | 2180 |
| 216 | Ga0436361_1161377 | 3300039447 | Bacteria | 2007 |
| 217 | Ga0439466_0040818 | 3300041411 | Bacteria | 1551 |
| 218 | Ga0439449_0000171 | 3300042007 | Bacteria | 22436 |
| 219 | Ga0439450_016499 | 3300042008 | Bacteria | 1528 |
| 220 | Ga0439455_0014642 | 3300042012 | Bacteria | 1793 |
| 221 | Ga0439455_0027511 | 3300042012 | Bacteria | 1394 |
| 222 | Ga0466972_0000088 | 3300044658 | Bacteria | 84167 |
| 223 | Ga0466981_0241937 | 3300044669 | Bacteria | 1172 |
| 224 | Ga0466957_0180885 | 3300044842 | Bacteria | 1377 |
| 225 | Ga0466958_0246483 | 3300045836 | Bacteria | 1142 |
| 226 | Ga0466967_0025712 | 3300045976 | Bacteria | 4858 |
| 227 | Ga0466967_0061513 | 3300045976 | Bacteria | 3331 |
| 228 | Ga0495617_005158 | 3300046452 | Bacteria | 4665 |
| 229 | Ga0495617_036340 | 3300046452 | Bacteria | 1651 |
| 230 | Ga0495627_000059 | 3300046453 | Bacteria | 142466 |
| 231 | Ga0495627_069399 | 3300046453 | Bacteria | 1031 |
| 232 | Ga0495592_0014075 | 3300046454 | Bacteria | 6078 |
| 233 | Ga0495638_0001490 | 3300046460 | Bacteria | 21133 |
| 234 | Ga0495638_0003710 | 3300046460 | Bacteria | 11888 |
| 235 | Ga0495638_0008979 | 3300046460 | Bacteria | 7048 |
| 236 | Ga0495638_0131391 | 3300046460 | Bacteria | 1470 |
| 237 | Ga0495638_0135165 | 3300046460 | Bacteria | 1445 |
| 238 | Ga0495651_0030753 | 3300046462 | Bacteria | 4186 |
| 239 | Ga0495651_0049283 | 3300046462 | Bacteria | 3250 |
| 240 | Ga0495653_0001379 | 3300046463 | Bacteria | 18872 |
| 241 | Ga0495650_0000019 | 3300046471 | Bacteria | 533849 |
| 242 | Ga0495650_0000224 | 3300046471 | Bacteria | 118058 |
| 243 | Ga0495650_0000521 | 3300046471 | Bacteria | 56415 |
| 244 | Ga0495650_0000618 | 3300046471 | Bacteria | 48166 |
| 245 | Ga0495650_0000933 | 3300046471 | Bacteria | 33909 |
| 246 | Ga0495650_0003036 | 3300046471 | Bacteria | 12670 |
| 247 | Ga0495650_0020702 | 3300046471 | Bacteria | 3200 |
| 248 | Ga0495580_0278970 | 3300046472 | Bacteria | 1140 |
| 249 | Ga0495582_0061167 | 3300046473 | Bacteria | 2079 |
| 250 | Ga0495605_0000028 | 3300046474 | Bacteria | 218471 |
| 251 | Ga0495605_0026566 | 3300046474 | Bacteria | 3008 |
| 252 | Ga0495605_0134590 | 3300046474 | Bacteria | 1112 |
| 253 | Ga0495639_0012342 | 3300046475 | Bacteria | 3686 |
| 254 | Ga0495584_0000133 | 3300046491 | Bacteria | 51161 |
| 255 | Ga0495584_0002864 | 3300046491 | Bacteria | 9636 |
| 256 | Ga0495584_0005809 | 3300046491 | Bacteria | 6504 |
| 257 | Ga0495584_0006777 | 3300046491 | Bacteria | 5980 |
| 258 | Ga0495584_0016209 | 3300046491 | Bacteria | 3801 |
| 259 | Ga0495584_0068436 | 3300046491 | Bacteria | 1783 |
| 260 | Ga0495584_0398353 | 3300046491 | Bacteria | 699 |
| 261 | Ga0495585_0000005 | 3300046492 | Bacteria | 328103 |
| 262 | Ga0495585_0001478 | 3300046492 | Bacteria | 18368 |
| 263 | Ga0495585_0002208 | 3300046492 | Bacteria | 14125 |
| 264 | Ga0495585_0002259 | 3300046492 | Bacteria | 13931 |
| 265 | Ga0495585_0011077 | 3300046492 | Bacteria | 5352 |
| 266 | Ga0495585_0018070 | 3300046492 | Bacteria | 4068 |
| 267 | Ga0495585_0029081 | 3300046492 | Bacteria | 3148 |
| 268 | Ga0495585_0030142 | 3300046492 | Bacteria | 3086 |
| 269 | Ga0495585_0051043 | 3300046492 | Bacteria | 2293 |
| 270 | Ga0495594_0001197 | 3300046499 | Bacteria | 13581 |
| 271 | Ga0495594_0016797 | 3300046499 | Bacteria | 3860 |
| 272 | Ga0495596_0001161 | 3300046500 | Bacteria | 15441 |
| 273 | Ga0495596_0001619 | 3300046500 | Bacteria | 12813 |
| 274 | Ga0495596_0007212 | 3300046500 | Bacteria | 5029 |
| 275 | Ga0495607_0002450 | 3300046501 | Bacteria | 15091 |
| 276 | Ga0495607_0006093 | 3300046501 | Bacteria | 8529 |
| 277 | Ga0495607_0009950 | 3300046501 | Bacteria | 6403 |
| 278 | Ga0495607_0010927 | 3300046501 | Bacteria | 6073 |
| 279 | Ga0495607_0020281 | 3300046501 | Bacteria | 4205 |
| 280 | Ga0495607_0027308 | 3300046501 | Bacteria | 3531 |
| 281 | Ga0495583_0000537 | 3300046506 | Bacteria | 53610 |
| 282 | Ga0495583_0001748 | 3300046506 | Bacteria | 20746 |
| 283 | Ga0495583_0002111 | 3300046506 | Bacteria | 17865 |
| 284 | Ga0495583_0003011 | 3300046506 | Bacteria | 13467 |
| 285 | Ga0495583_0004132 | 3300046506 | Bacteria | 10639 |
| 286 | Ga0495583_0008403 | 3300046506 | Bacteria | 6317 |
| 287 | Ga0495583_0043044 | 3300046506 | Bacteria | 2105 |
| 288 | Ga0495583_0044897 | 3300046506 | Bacteria | 2046 |
| 289 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 290 | Ga0495606_0000601 | 3300046507 | Bacteria | 57004 |
| 291 | Ga0495606_0003006 | 3300046507 | Bacteria | 18479 |
| 292 | Ga0495606_0003203 | 3300046507 | Bacteria | 17645 |
| 293 | Ga0495606_0003465 | 3300046507 | Bacteria | 16733 |
| 294 | Ga0495606_0006214 | 3300046507 | Bacteria | 11103 |
| 295 | Ga0495606_0008710 | 3300046507 | Bacteria | 8737 |
| 296 | Ga0495606_0022232 | 3300046507 | Bacteria | 4626 |
| 297 | Ga0495606_0082780 | 3300046507 | Bacteria | 1991 |
| 298 | Ga0495606_0135014 | 3300046507 | Bacteria | 1462 |
| 299 | Ga0495606_0244236 | 3300046507 | Bacteria | 999 |
| 300 | Ga0495610_0002283 | 3300046512 | Bacteria | 16194 |
| 301 | Ga0495610_0002657 | 3300046512 | Bacteria | 14759 |
| 302 | Ga0495610_0006367 | 3300046512 | Bacteria | 8146 |
| 303 | Ga0495610_0014220 | 3300046512 | Bacteria | 4686 |
| 304 | Ga0495610_0079844 | 3300046512 | Bacteria | 1505 |
| 305 | Ga0495616_0000729 | 3300046513 | Bacteria | 24188 |
| 306 | Ga0495616_0001200 | 3300046513 | Bacteria | 18295 |
| 307 | Ga0495616_0004957 | 3300046513 | Bacteria | 8311 |
| 308 | Ga0495616_0005128 | 3300046513 | Bacteria | 8134 |
| 309 | Ga0495616_0016780 | 3300046513 | Bacteria | 4046 |
| 310 | Ga0495616_0065863 | 3300046513 | Bacteria | 1763 |
| 311 | Ga0495616_0226776 | 3300046513 | Bacteria | 811 |
| 312 | Ga0495618_0014611 | 3300046514 | Bacteria | 4786 |
| 313 | Ga0495620_0008352 | 3300046515 | Bacteria | 5563 |
| 314 | Ga0495628_0000835 | 3300046516 | Bacteria | 28571 |
| 315 | Ga0495628_0005092 | 3300046516 | Bacteria | 11550 |
| 316 | Ga0495630_0118045 | 3300046517 | Bacteria | 2012 |
| 317 | Ga0495631_0004286 | 3300046518 | Bacteria | 7612 |
| 318 | Ga0495631_0004395 | 3300046518 | Bacteria | 7510 |
| 319 | Ga0495631_0011347 | 3300046518 | Bacteria | 4384 |
| 320 | Ga0495632_0008366 | 3300046519 | Bacteria | 6359 |
| 321 | Ga0495632_0013816 | 3300046519 | Bacteria | 4591 |
| 322 | Ga0495632_0015168 | 3300046519 | Bacteria | 4332 |
| 323 | Ga0495637_0008362 | 3300046520 | Bacteria | 5087 |
| 324 | Ga0495643_0000444 | 3300046522 | Bacteria | 53441 |
| 325 | Ga0495643_0001965 | 3300046522 | Bacteria | 17240 |
| 326 | Ga0495643_0011718 | 3300046522 | Bacteria | 5323 |
| 327 | Ga0495643_0015069 | 3300046522 | Bacteria | 4580 |
| 328 | Ga0495643_0075509 | 3300046522 | Bacteria | 1763 |
| 329 | Ga0495643_0177163 | 3300046522 | Bacteria | 1038 |
| 330 | Ga0495644_0000442 | 3300046523 | Bacteria | 18239 |
| 331 | Ga0495644_0008829 | 3300046523 | Bacteria | 3875 |
| 332 | Ga0495644_0010728 | 3300046523 | Bacteria | 3530 |
| 333 | Ga0495644_0012240 | 3300046523 | Bacteria | 3298 |
| 334 | Ga0495644_0028183 | 3300046523 | Bacteria | 2125 |
| 335 | Ga0495644_0089781 | 3300046523 | Bacteria | 1159 |
| 336 | Ga0495648_0000076 | 3300046524 | Bacteria | 129413 |
| 337 | Ga0495648_0001719 | 3300046524 | Bacteria | 21134 |
| 338 | Ga0495648_0002438 | 3300046524 | Bacteria | 17217 |
| 339 | Ga0495648_0004060 | 3300046524 | Bacteria | 12633 |
| 340 | Ga0495648_0019389 | 3300046524 | Bacteria | 4784 |
| 341 | Ga0495648_0021351 | 3300046524 | Bacteria | 4486 |
| 342 | Ga0495663_0003696 | 3300046525 | Bacteria | 4376 |
| 343 | Ga0495663_0003907 | 3300046525 | Bacteria | 4247 |
| 344 | Ga0495642_0002423 | 3300046528 | Bacteria | 7601 |
| 345 | Ga0495642_0007890 | 3300046528 | Bacteria | 4078 |
| 346 | Ga0495642_0022520 | 3300046528 | Bacteria | 2483 |
| 347 | Ga0495642_0042311 | 3300046528 | Bacteria | 1855 |
| 348 | Ga0495642_0043447 | 3300046528 | Bacteria | 1832 |
| 349 | Ga0495642_0054249 | 3300046528 | Bacteria | 1653 |
| 350 | Ga0495642_0177169 | 3300046528 | Bacteria | 927 |
| 351 | Ga0495642_0193238 | 3300046528 | Bacteria | 886 |
| 352 | Ga0495652_0025035 | 3300046529 | Bacteria | 5281 |
| 353 | Ga0495652_0106884 | 3300046529 | Bacteria | 2258 |
| 354 | Ga0495654_0000015 | 3300046530 | Bacteria | 307873 |
| 355 | Ga0495654_0113740 | 3300046530 | Bacteria | 1232 |
| 356 | Ga0495586_0131643 | 3300046535 | Bacteria | 1400 |
| 357 | Ga0495587_0004707 | 3300046536 | Bacteria | 8954 |
| 358 | Ga0495609_0000474 | 3300046538 | Bacteria | 32477 |
| 359 | Ga0495609_0000945 | 3300046538 | Bacteria | 21038 |
| 360 | Ga0495609_0023918 | 3300046538 | Bacteria | 2804 |
| 361 | Ga0495609_0037303 | 3300046538 | Bacteria | 2193 |
| 362 | Ga0495609_0046134 | 3300046538 | Bacteria | 1951 |
| 363 | Ga0495609_0106475 | 3300046538 | Bacteria | 1212 |
| 364 | Ga0495597_0001571 | 3300046542 | Bacteria | 16089 |
| 365 | Ga0495597_0001734 | 3300046542 | Bacteria | 15028 |
| 366 | Ga0495597_0001823 | 3300046542 | Bacteria | 14576 |
| 367 | Ga0495597_0004860 | 3300046542 | Bacteria | 7241 |
| 368 | Ga0495597_0017876 | 3300046542 | Bacteria | 3330 |
| 369 | Ga0495597_0020251 | 3300046542 | Bacteria | 3100 |
| 370 | Ga0495597_0064281 | 3300046542 | Bacteria | 1594 |
| 371 | Ga0495597_0104297 | 3300046542 | Bacteria | 1193 |
| 372 | Ga0495597_0233203 | 3300046542 | Bacteria | 728 |
| 373 | Ga0495645_0177990 | 3300046543 | Bacteria | 1459 |
| 374 | Ga0495622_0000169 | 3300046557 | Bacteria | 53731 |
| 375 | Ga0495622_0000787 | 3300046557 | Bacteria | 17663 |
| 376 | Ga0495622_0001840 | 3300046557 | Bacteria | 10471 |
| 377 | Ga0495622_0021769 | 3300046557 | Bacteria | 2985 |
| 378 | Ga0495622_0061400 | 3300046557 | Bacteria | 1740 |
| 379 | Ga0495622_0074921 | 3300046557 | Bacteria | 1560 |
| 380 | Ga0495633_0001212 | 3300046558 | Bacteria | 20769 |
| 381 | Ga0495633_0001627 | 3300046558 | Bacteria | 16959 |
| 382 | Ga0495633_0001865 | 3300046558 | Bacteria | 15455 |
| 383 | Ga0495633_0003138 | 3300046558 | Bacteria | 11200 |
| 384 | Ga0495633_0005251 | 3300046558 | Bacteria | 7987 |
| 385 | Ga0495633_0006151 | 3300046558 | Bacteria | 7178 |
| 386 | Ga0495633_0020774 | 3300046558 | Bacteria | 3296 |
| 387 | Ga0495633_0041136 | 3300046558 | Bacteria | 2198 |
| 388 | Ga0495633_0068268 | 3300046558 | Bacteria | 1659 |
| 389 | Ga0495633_0072930 | 3300046558 | Bacteria | 1600 |
| 390 | Ga0495633_0084972 | 3300046558 | Bacteria | 1472 |
| 391 | Ga0495656_0007102 | 3300046615 | Bacteria | 3949 |
| 392 | Ga0495656_0025072 | 3300046615 | Bacteria | 2360 |
| 393 | Ga0495668_0000028 | 3300046616 | Bacteria | 286629 |
| 394 | Ga0495668_0000241 | 3300046616 | Bacteria | 78040 |
| 395 | Ga0495668_0002077 | 3300046616 | Bacteria | 17353 |
| 396 | Ga0495668_0020475 | 3300046616 | Bacteria | 3805 |
| 397 | Ga0495668_0038170 | 3300046616 | Bacteria | 2685 |
| 398 | Ga0495668_0119351 | 3300046616 | Bacteria | 1442 |
| 399 | Ga0495668_0243873 | 3300046616 | Bacteria | 984 |
| 400 | Ga0495668_0326598 | 3300046616 | Bacteria | 841 |
| 401 | Ga0495611_0001912 | 3300046648 | Bacteria | 9903 |
| 402 | Ga0495611_0002628 | 3300046648 | Bacteria | 8135 |
| 403 | Ga0495611_0003087 | 3300046648 | Bacteria | 7394 |
| 404 | Ga0495611_0014463 | 3300046648 | Bacteria | 3371 |
| 405 | Ga0495611_0017530 | 3300046648 | Bacteria | 3064 |
| 406 | Ga0495611_0109009 | 3300046648 | Bacteria | 1288 |
| 407 | Ga0495611_0171680 | 3300046648 | Bacteria | 1013 |
| 408 | Ga0495625_0002519 | 3300046660 | Bacteria | 19715 |
| 409 | Ga0495625_0002732 | 3300046660 | Bacteria | 18701 |
| 410 | Ga0495625_0002859 | 3300046660 | Bacteria | 18117 |
| 411 | Ga0495625_0002965 | 3300046660 | Bacteria | 17642 |
| 412 | Ga0495625_0006140 | 3300046660 | Bacteria | 10760 |
| 413 | Ga0495625_0009190 | 3300046660 | Bacteria | 8302 |
| 414 | Ga0495625_0009772 | 3300046660 | Bacteria | 7982 |
| 415 | Ga0495625_0022370 | 3300046660 | Bacteria | 4848 |
| 416 | Ga0495625_0027801 | 3300046660 | Bacteria | 4250 |
| 417 | Ga0495659_0000141 | 3300046664 | Bacteria | 31709 |
| 418 | Ga0495659_0000426 | 3300046664 | Bacteria | 16062 |
| 419 | Ga0495659_0023652 | 3300046664 | Bacteria | 2089 |
| 420 | Ga0495659_0028566 | 3300046664 | Bacteria | 1931 |
| 421 | Ga0495659_0156467 | 3300046664 | Bacteria | 918 |
| 422 | Ga0495661_0003905 | 3300046665 | Bacteria | 10884 |
| 423 | Ga0495661_0018343 | 3300046665 | Bacteria | 4604 |
| 424 | Ga0495661_0023107 | 3300046665 | Bacteria | 4040 |
| 425 | Ga0495661_0043650 | 3300046665 | Bacteria | 2754 |
| 426 | Ga0495661_0044307 | 3300046665 | Bacteria | 2728 |
| 427 | Ga0495661_0092701 | 3300046665 | Bacteria | 1716 |
| 428 | Ga0495661_0143404 | 3300046665 | Bacteria | 1297 |
| 429 | Ga0495661_0290610 | 3300046665 | Bacteria | 821 |
| 430 | Ga0495588_0096012 | 3300046674 | Bacteria | 1554 |
| 431 | Ga0495588_0369808 | 3300046674 | Bacteria | 753 |
| 432 | Ga0495599_0006679 | 3300046678 | Bacteria | 6964 |
| 433 | Ga0495623_0010696 | 3300046679 | Bacteria | 5941 |
| 434 | Ga0495623_0088789 | 3300046679 | Bacteria | 1902 |
| 435 | Ga0495646_0014479 | 3300046680 | Bacteria | 5015 |
| 436 | Ga0495669_0036633 | 3300046684 | Bacteria | 2169 |
| 437 | Ga0495669_0090722 | 3300046684 | Bacteria | 1410 |
| 438 | Ga0495624_0003107 | 3300046690 | Bacteria | 12415 |
| 439 | Ga0495624_0041596 | 3300046690 | Bacteria | 2938 |
| 440 | Ga0495670_0026391 | 3300046691 | Bacteria | 2875 |
| 441 | Ga0495670_0028155 | 3300046691 | Bacteria | 2785 |
| 442 | Ga0495670_0139160 | 3300046691 | Bacteria | 1268 |
| 443 | Ga0495671_0000606 | 3300046692 | Bacteria | 26397 |
| 444 | Ga0495671_0012281 | 3300046692 | Bacteria | 4681 |
| 445 | Ga0495671_0014108 | 3300046692 | Bacteria | 4308 |
| 446 | Ga0495671_0019252 | 3300046692 | Bacteria | 3612 |
| 447 | Ga0495671_0033336 | 3300046692 | Bacteria | 2624 |
| 448 | Ga0495649_0004108 | 3300046694 | Bacteria | 9564 |
| 449 | Ga0495649_0023765 | 3300046694 | Bacteria | 3423 |
| 450 | Ga0495649_0038198 | 3300046694 | Bacteria | 2635 |
| 451 | Ga0495649_0094167 | 3300046694 | Bacteria | 1594 |
| 452 | Ga0495589_0042885 | 3300046794 | Bacteria | 2253 |
| 453 | Ga0495589_0065143 | 3300046794 | Bacteria | 1786 |
| 454 | Ga0495600_0001599 | 3300046809 | Bacteria | 12601 |
| 455 | Ga0495600_0039697 | 3300046809 | Bacteria | 3065 |
| 456 | Ga0495660_0001560 | 3300046810 | Bacteria | 15377 |
| 457 | Ga0495660_0001725 | 3300046810 | Bacteria | 14608 |
| 458 | Ga0495660_0001884 | 3300046810 | Bacteria | 13776 |
| 459 | Ga0495660_0011044 | 3300046810 | Bacteria | 5244 |
| 460 | Ga0495660_0052873 | 3300046810 | Bacteria | 2206 |
| 461 | Ga0495660_0103809 | 3300046810 | Bacteria | 1460 |
| 462 | Ga0495581_0013746 | 3300047315 | Bacteria | 4693 |
| 463 | Ga0495581_0064606 | 3300047315 | Bacteria | 2114 |
| 464 | Ga0495581_0117576 | 3300047315 | Bacteria | 1546 |
| 465 | Ga0495604_0008630 | 3300047317 | Bacteria | 8057 |
| 466 | Ga0495636_0000421 | 3300047318 | Bacteria | 15692 |
| 467 | Ga0495636_0001925 | 3300047318 | Bacteria | 7944 |
| 468 | Ga0495636_0003633 | 3300047318 | Bacteria | 5989 |
| 469 | Ga0495636_0012980 | 3300047318 | Bacteria | 3302 |
| 470 | Ga0495672_0000368 | 3300047320 | Bacteria | 57095 |
| 471 | Ga0495672_0002311 | 3300047320 | Bacteria | 17684 |
| 472 | Ga0495672_0005259 | 3300047320 | Bacteria | 10312 |
| 473 | Ga0495672_0048358 | 3300047320 | Bacteria | 2522 |
| 474 | Ga0495672_0132210 | 3300047320 | Bacteria | 1311 |
| 475 | Ga0495676_0063427 | 3300047321 | Bacteria | 2880 |
| 476 | Ga0495683_0001845 | 3300047323 | Bacteria | 13299 |
| 477 | Ga0495683_0018620 | 3300047323 | Bacteria | 3587 |
| 478 | Ga0495683_0054764 | 3300047323 | Bacteria | 1987 |
| 479 | Ga0495683_0077246 | 3300047323 | Bacteria | 1628 |
| 480 | Ga0495683_0117390 | 3300047323 | Bacteria | 1265 |
| 481 | Ga0495683_0271388 | 3300047323 | Bacteria | 737 |
| 482 | Ga0495687_000191 | 3300047443 | Bacteria | 88251 |
| 483 | Ga0495687_005228 | 3300047443 | Bacteria | 8367 |
| 484 | Ga0495687_031871 | 3300047443 | Bacteria | 2412 |
| 485 | Ga0495687_035894 | 3300047443 | Bacteria | 2223 |
| 486 | Ga0495675_0077121 | 3300047444 | Bacteria | 2100 |
| 487 | Ga0495677_0001285 | 3300047445 | Bacteria | 10028 |
| 488 | Ga0495677_0002306 | 3300047445 | Bacteria | 7521 |
| 489 | Ga0495677_0004243 | 3300047445 | Bacteria | 5521 |
| 490 | Ga0495677_0007293 | 3300047445 | Bacteria | 4136 |
| 491 | Ga0495677_0008067 | 3300047445 | Bacteria | 3910 |
| 492 | Ga0495677_0031279 | 3300047445 | Bacteria | 1937 |
| 493 | Ga0495677_0039574 | 3300047445 | Bacteria | 1723 |
| 494 | Ga0495679_011604 | 3300047446 | Bacteria | 3389 |
| 495 | Ga0495685_000033 | 3300047447 | Bacteria | 57157 |
| 496 | Ga0495685_065895 | 3300047447 | Bacteria | 1217 |
| 497 | Ga0495685_104664 | 3300047447 | Bacteria | 933 |
| 498 | Ga0495685_113266 | 3300047447 | Bacteria | 892 |
| 499 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 500 | Ga0495673_0000285 | 3300047469 | Bacteria | 68361 |
| 501 | Ga0495673_0077237 | 3300047469 | Bacteria | 1387 |
| 502 | Ga0495681_0004385 | 3300047470 | Bacteria | 9641 |
| 503 | Ga0495681_0006686 | 3300047470 | Bacteria | 7527 |
| 504 | Ga0495681_0008422 | 3300047470 | Bacteria | 6471 |
| 505 | Ga0495681_0083744 | 3300047470 | Bacteria | 1419 |
| 506 | Ga0495681_0103346 | 3300047470 | Bacteria | 1243 |
| 507 | Ga0495686_0000969 | 3300047472 | Bacteria | 35293 |
| 508 | Ga0495686_0003173 | 3300047472 | Bacteria | 14488 |
| 509 | Ga0495686_0015339 | 3300047472 | Bacteria | 5237 |
| 510 | Ga0495686_0016691 | 3300047472 | Bacteria | 4971 |
| 511 | Ga0495593_0005989 | 3300047673 | Bacteria | 7165 |
| 512 | Ga0495593_0280477 | 3300047673 | Bacteria | 833 |
| 513 | Ga0495602_0195610 | 3300048088 | Bacteria | 1547 |
| 514 | Ga0495615_0001822 | 3300048090 | Bacteria | 3266 |
| 515 | Ga0495626_0001508 | 3300048091 | Bacteria | 18371 |
| 516 | Ga0495626_0010602 | 3300048091 | Bacteria | 4905 |
| 517 | Ga0495626_0020935 | 3300048091 | Bacteria | 3253 |
| 518 | Ga0495626_0039737 | 3300048091 | Bacteria | 2225 |
| 519 | Ga0495626_0081323 | 3300048091 | Bacteria | 1438 |
| 520 | Ga0495626_0155488 | 3300048091 | Bacteria | 961 |
| 521 | Ga0496101_0282302 | 3300048904 | Bacteria | 1298 |
| 522 | Ga0496102_0000934 | 3300048905 | Bacteria | 27547 |
| 523 | Ga0496105_0120602 | 3300048908 | Bacteria | 2162 |
| 524 | Ga0496111_0399817 | 3300048914 | Bacteria | 1015 |
| 525 | Ga0496115_0000931 | 3300048918 | Bacteria | 21204 |
| 526 | Ga0496115_0691370 | 3300048918 | Bacteria | 803 |
| 527 | Ga0496116_0008717 | 3300048919 | Bacteria | 8757 |
| 528 | Ga0496116_0018376 | 3300048919 | Bacteria | 5392 |
| 529 | Ga0496116_0045258 | 3300048919 | Bacteria | 2981 |
| 530 | Ga0496118_0056773 | 3300048921 | Bacteria | 2940 |
| 531 | Ga0496121_0051558 | 3300048924 | Bacteria | 3464 |
| 532 | Ga0496121_0097357 | 3300048924 | Bacteria | 2280 |
| 533 | Ga0496122_0001290 | 3300048925 | Bacteria | 41594 |
| 534 | Ga0496123_0001053 | 3300048926 | Bacteria | 41720 |
| 535 | Ga0496124_0013336 | 3300048927 | Bacteria | 8031 |
| 536 | Ga0496124_0114290 | 3300048927 | Bacteria | 2168 |
| 537 | Ga0496124_0119712 | 3300048927 | Bacteria | 2106 |
| 538 | Ga0496125_0004104 | 3300048928 | Bacteria | 17027 |
| 539 | Ga0496125_0020679 | 3300048928 | Bacteria | 6173 |
| 540 | Ga0495678_000030 | 3300049459 | Bacteria | 217986 |
| 541 | Ga0495678_001616 | 3300049459 | Bacteria | 17222 |
| 542 | Ga0495678_001803 | 3300049459 | Bacteria | 15794 |
| 543 | Ga0495678_002839 | 3300049459 | Bacteria | 11216 |
| 544 | Ga0495678_003125 | 3300049459 | Bacteria | 10487 |
| 545 | Ga0495678_017694 | 3300049459 | Bacteria | 3221 |
| 546 | Ga0495678_021386 | 3300049459 | Bacteria | 2849 |
| 547 | Ga0495678_033064 | 3300049459 | Bacteria | 2138 |
| 548 | Ga0495682_0000606 | 3300049460 | Bacteria | 24187 |
| 549 | Ga0495682_0000761 | 3300049460 | Bacteria | 20689 |
| 550 | Ga0495682_0006796 | 3300049460 | Bacteria | 4608 |
| 551 | Ga0501069_0001879 | 3300049585 | Bacteria | 10487 |
| 552 | Ga0501070_0162348 | 3300049586 | Bacteria | 1842 |
| 553 | Ga0501238_000291 | 3300049671 | Bacteria | 6615 |
| 554 | Ga0501249_005157 | 3300049679 | Bacteria | 2669 |
| 555 | Ga0501269_000374 | 3300049766 | Bacteria | 10942 |
| 556 | nmdc:mga03683_10327_c1 | 3300050489 | Bacteria | 3347 |
| 557 | nmdc:mga07m45_75700_c1 | 3300050496 | Bacteria | 1918 |
| 558 | nmdc:mga0n895_314019_c1 | 3300050512 | Bacteria | 1588 |
| 559 | Ga0495601_0008109 | 3300053077 | Bacteria | 6193 |
| 560 | Ga0500594_0001504 | 3300053118 | Bacteria | 5075 |
| 561 | Ga0500595_000547 | 3300053119 | Bacteria | 22560 |
| 562 | Ga0500618_000265 | 3300053125 | Bacteria | 40554 |
| 563 | Ga0500574_000118 | 3300053141 | Bacteria | 8604 |
| 564 | Ga0500586_000076 | 3300053145 | Bacteria | 16957 |
| 565 | Ga0500619_000302 | 3300053154 | Bacteria | 9757 |
| 566 | Ga0500634_0041118 | 3300053161 | Bacteria | 2511 |
| 567 | 2511250110 | 2511231003 | Bacteria | 5606035 |
| 568 | 2550693634 | 2548876994 | Bacteria | 4904866 |
| 569 | 2643790569 | 2643221554 | Bacteria | 6603920 |
| 570 | 2644031646 | 2643221603 | Bacteria | 6147767 |
| 571 | 2644211509 | 2643221638 | Bacteria | 6579467 |
| 572 | 2644253405 | 2643221645 | Bacteria | 7207331 |
| 573 | 2644355548 | 2643221664 | Bacteria | 7272945 |
| 574 | 2738737332 | 2738541280 | Bacteria | 6630198 |
| 575 | 2738830141 | 2738541297 | Bacteria | 6549566 |
| 576 | 2738841551 | 2738541300 | Bacteria | 6675882 |
| 577 | 2739153937 | 2738541357 | Bacteria | 6549408 |
| 578 | 2739195857 | 2738543003 | Bacteria | 6549560 |
| 579 | 2739272422 | 2738543018 | Bacteria | 6718814 |
| 580 | 2739322333 | 2738543026 | Bacteria | 6549408 |
| 581 | 2739340574 | 2738543029 | Bacteria | 6549249 |
| 582 | 2739341466 | 2738543030 | Bacteria | 6719714 |
| 583 | 2819540603 | 2818991436 | Bacteria | 5376622 |
| 584 | 2819592087 | 2818991445 | Bacteria | 4955017 |
| 585 | 2821132064 | 2821131069 | Bacteria | 6108407 |
| 586 | 2842712694 | 2842711865 | Bacteria | 7155354 |
| 587 | 2857557694 | 2857553236 | Bacteria | 6166726 |
| 588 | 2857563967 | 2857558681 | Bacteria | 6617694 |
| 589 | 2857568505 | 2857564685 | Bacteria | 6290584 |
| 590 | 2884812177 | 2884811622 | Bacteria | 5552861 |
| 591 | 2884840495 | 2884836552 | Bacteria | 5219991 |
| 592 | 2884855752 | 2884852848 | Bacteria | 5221161 |
| 593 | 2896157323 | 2896154374 | Bacteria | 5221518 |
| 594 | 2904425500 | 2904424332 | Bacteria | 7633521 |
| 595 | 2919477254 | 2919476304 | Bacteria | 5888696 |
| 596 | Ga0495625_0132397 | |||
| 597 | JGI25155J39150_1000204 | |||
| 598 | JGI25156J39149_1000154 | |||
| 599 | JGI25156J39149_1004191 | |||
| 600 | JGI25162J39368_1000001 | |||
| 601 | JGI25154J39366_1000401 | |||
| 602 | JGI25154J39366_1000462 | |||
| 603 | JGI25154J39366_1000482 | |||
| 604 | JGI25158J39367_1001396 | |||
| 605 | JGI25157J39369_1000169 | |||
| 606 | JGI25150J39212_1000493 | |||
| 607 | JGI25150J39212_1002117 | |||
| 608 | JGI25159J45721_1002464 | |||
| 609 | JGI25159J45721_1009549 | |||
| 610 | JGI25165J46597_1000001 | |||
| 611 | JGI25153J46596_10007526 | |||
| 612 | JGI25153J46596_10018805 | |||
| 613 | JGI25160J50197_1009016 | |||
| 614 | JGI25161J50226_1000550 | |||
| 615 | JGI25161J50226_1002442 | |||
| 616 | Ga0055538_1000001 | |||
| 617 | Ga0055539_1000001 | |||
| 618 | Ga0055533_1000003 | |||
| 619 | Ga0055532_1000017 | |||
| 620 | Ga0055525_1000003 | |||
| 621 | Ga0055525_1000100 | |||
| 622 | Ga0055535_1007304 | |||
| 623 | Ga0055526_1000320 | |||
| 624 | Ga0055526_1000430 | |||
| 625 | Ga0055526_1002009 | |||
| 626 | Ga0055526_1002659 | |||
| 627 | Ga0055526_1006278 | |||
| 628 | Ga0055537_1000291 | |||
| 629 | Ga0055537_1002731 | |||
| 630 | Ga0055537_1008826 | |||
| 631 | Ga0055524_1000003 | |||
| 632 | Ga0055524_1002404 | |||
| 633 | Ga0055524_1007652 | |||
| 634 | Ga0055524_1010991 | |||
| 635 | Ga0055524_1013748 | |||
| 636 | Ga0055534_1000582 | |||
| 637 | Ga0055534_1004125 | |||
| 638 | Ga0055534_1007277 | |||
| 639 | Ga0055528_1000218 | |||
| 640 | Ga0055528_1004693 | |||
| 641 | Ga0055530_10002483 | |||
| 642 | Ga0055530_10002831 | |||
| 643 | Ga0055530_10007493 | |||
| 644 | Ga0055531_10007225 | |||
| 645 | Ga0055541_1000001 | |||
| 646 | Ga0055543_1000314 | |||
| 647 | Ga0065165_1000454 | |||
| 648 | Ga0065165_1001037 | |||
| 649 | Ga0065165_1064477 | |||
| 650 | Ga0070658_10010301 | |||
| 651 | Ga0070658_10159703 | |||
| 652 | Ga0070683_100318471 | |||
| 653 | Ga0070659_100661457 | |||
| 654 | Ga0070663_100061283 | |||
| 655 | Ga0070663_100352312 | |||
| 656 | Ga0070681_10000012 | |||
| 657 | Ga0068855_100016126 | |||
| 658 | Ga0068852_100037622 | |||
| 659 | Ga0070717_10080506 | |||
| 660 | Ga0068871_100786782 | |||
| 661 | Ga0075434_100163867 | |||
| 662 | Ga0079104_1012347 | |||
| 663 | Ga0099826_10000002 | |||
| 664 | Ga0105251_10126942 | |||
| 665 | Ga0105244_10001942 | |||
| 666 | Ga0105244_10026718 | |||
| 667 | Ga0105240_10001581 | |||
| 668 | Ga0105240_10014926 | |||
| 669 | Ga0105242_10086220 | |||
| 670 | Ga0105237_10067442 | |||
| 671 | Ga0105238_10010636 | |||
| 672 | Ga0105238_10857344 | |||
| 673 | Ga0105246_10231970 | |||
| 674 | Ga0157327_1008995 | |||
| 675 | Ga0157370_10039292 | |||
| 676 | Ga0157374_10134605 | |||
| 677 | Ga0157372_10250907 | |||
| 678 | Ga0182008_10020209 | |||
| 679 | Ga0182008_10168864 | |||
| 680 | Ga0182006_1000029 | |||
| 681 | Ga0182005_1000037 | |||
| 682 | Ga0182005_1000809 | |||
| 683 | Ga0213872_10000001 | |||
| 684 | Ga0213872_10000023 | |||
| 685 | Ga0213872_10000125 | |||
| 686 | Ga0213872_10001662 | |||
| 687 | Ga0213872_10002143 | |||
| 688 | Ga0213872_10019670 | |||
| 689 | Ga0213872_10047170 | |||
| 690 | Ga0209435_100015 | |||
| 691 | Ga0209435_100162 | |||
| 692 | Ga0209760_100884 | |||
| 693 | Ga0209436_100229 | |||
| 694 | Ga0209436_100383 | |||
| 695 | Ga0209784_100004 | |||
| 696 | Ga0209566_100004 | |||
| 697 | Ga0209674_100006 | |||
| 698 | Ga0209147_100004 | |||
| 699 | Ga0209563_100009 | |||
| 700 | Ga0209563_100112 | |||
| 701 | Ga0207427_100832 | |||
| 702 | Ga0209437_100004 | |||
| 703 | Ga0209437_100045 | |||
| 704 | Ga0209258_100226 | |||
| 705 | Ga0207425_1000001 | |||
| 706 | Ga0207425_1000356 | |||
| 707 | Ga0209646_1000020 | |||
| 708 | Ga0209646_1000040 | |||
| 709 | Ga0209646_1000051 | |||
| 710 | Ga0209026_1000034 | |||
| 711 | Ga0209026_1000808 | |||
| 712 | Ga0209677_100005 | |||
| 713 | Ga0209759_1000049 | |||
| 714 | Ga0209759_1000809 | |||
| 715 | Ga0209129_1000001 | |||
| 716 | Ga0209233_1000005 | |||
| 717 | Ga0209233_1015716 | |||
| 718 | Ga0209565_1000408 | |||
| 719 | Ga0209565_1001250 | |||
| 720 | Ga0209565_1001343 | |||
| 721 | Ga0209565_1001685 | |||
| 722 | Ga0209565_1020643 | |||
| 723 | Ga0209455_1001266 | |||
| 724 | Ga0209673_1000007 | |||
| 725 | Ga0209673_1028291 | |||
| 726 | Ga0209130_1000156 | |||
| 727 | Ga0209130_1000552 | |||
| 728 | Ga0209130_1001534 | |||
| 729 | Ga0209675_1000009 | |||
| 730 | Ga0209675_1000952 | |||
| 731 | Ga0209675_1002271 | |||
| 732 | Ga0209675_1006483 | |||
| 733 | Ga0209025_1002964 | |||
| 734 | Ga0209564_1000011 | |||
| 735 | Ga0209564_1000055 | |||
| 736 | Ga0209564_1001834 | |||
| 737 | Ga0209564_1007870 | |||
| 738 | Ga0209564_1008164 | |||
| 739 | Ga0209564_1027983 | |||
| 740 | Ga0209758_1000020 | |||
| 741 | Ga0209758_1002686 | |||
| 742 | Ga0209050_1000116 | |||
| 743 | Ga0209050_1001137 | |||
| 744 | Ga0209050_1001518 | |||
| 745 | Ga0209256_1000007 | |||
| 746 | Ga0209256_1000774 | |||
| 747 | Ga0209256_1000849 | |||
| 748 | Ga0209256_1003155 | |||
| 749 | Ga0209256_1003851 | |||
| 750 | Ga0209256_1006694 | |||
| 751 | Ga0207426_1001185 | |||
| 752 | Ga0209257_1000003 | |||
| 753 | Ga0207655_1020069 | |||
| 754 | Ga0207655_1022356 | |||
| 755 | Ga0207705_10010940 | |||
| 756 | Ga0207707_10000544 | |||
| 757 | Ga0207695_10004388 | |||
| 758 | Ga0207695_10577052 | |||
| 759 | Ga0207660_10248580 | |||
| 760 | Ga0207657_10064103 | |||
| 761 | Ga0207652_10320550 | |||
| 762 | Ga0207694_10024768 | |||
| 763 | Ga0207694_10473486 | |||
| 764 | Ga0207661_10391596 | |||
| 765 | Ga0207667_10065764 | |||
| 766 | Ga0207678_10228370 | |||
| 767 | Ga0207702_10047357 | |||
| 768 | Ga0207698_10026355 | |||
| 769 | Ga0209282_1000001 | |||
| 770 | Ga0307515_10121718 | |||
| 771 | Ga0316177_1004308 | |||
| 772 | Ga0314311_1236610 | |||
| 773 | Ga0316180_1127622 | |||
| 774 | Ga0316182_1273087 | |||
| 775 | Ga0265328_10001305 | |||
| 776 | Ga0265331_10002913 | |||
| 777 | Ga0265327_10000020 | |||
| 778 | Ga0265327_10028765 | |||
| 779 | Ga0307408_100000991 | |||
| 780 | Ga0307408_100002614 | |||
| 781 | Ga0307408_100032945 | |||
| 782 | Ga0265314_10206031 | |||
| 783 | Ga0307518_10056211 | |||
| 784 | Ga0395899_0000139 | |||
| 785 | Ga0395899_0005591 | |||
| 786 | Ga0395899_0128234 | |||
| 787 | Ga0395900_0000059 | |||
| 788 | Ga0395900_0004613 | |||
| 789 | Ga0395900_0039861 | |||
| 790 | Ga0395900_0072159 | |||
| 791 | Ga0395900_0299397 | |||
| 792 | Ga0395898_0089375 | |||
| 793 | Ga0395898_0130663 | |||
| 794 | Ga0395898_0356627 | |||
| 795 | Ga0395898_0654509 | |||
| 796 | Ga0395905_0000221 | |||
| 797 | Ga0395905_0004135 | |||
| 798 | Ga0395905_0047256 | |||
| 799 | Ga0395905_0121379 | |||
| 800 | Ga0395905_0148558 | |||
| 801 | Ga0395901_0001763 | |||
| 802 | Ga0395901_0248565 | |||
| 803 | Ga0395901_0535655 | |||
| 804 | Ga0436361_0027317 | |||
| 805 | Ga0436361_0060434 | |||
| 806 | Ga0436361_0225876 | |||
| 807 | Ga0436361_0285207 | |||
| 808 | Ga0436361_0333766 | |||
| 809 | Ga0436361_0609365 | |||
| 810 | Ga0436361_0776182 | |||
| 811 | Ga0436361_1161377 | |||
| 812 | Ga0439466_0040818 | |||
| 813 | Ga0439449_0000171 | |||
| 814 | Ga0439450_016499 | |||
| 815 | Ga0439455_0014642 | |||
| 816 | Ga0439455_0027511 | |||
| 817 | Ga0466972_0000088 | |||
| 818 | Ga0466981_0241937 | |||
| 819 | Ga0466957_0180885 | |||
| 820 | Ga0466958_0246483 | |||
| 821 | Ga0466967_0025712 | |||
| 822 | Ga0466967_0061513 | |||
| 823 | Ga0495617_005158 | |||
| 824 | Ga0495617_036340 | |||
| 825 | Ga0495627_000059 | |||
| 826 | Ga0495627_069399 | |||
| 827 | Ga0495592_0014075 | |||
| 828 | Ga0495638_0001490 | |||
| 829 | Ga0495638_0003710 | |||
| 830 | Ga0495638_0008979 | |||
| 831 | Ga0495638_0131391 | |||
| 832 | Ga0495638_0135165 | |||
| 833 | Ga0495651_0030753 | |||
| 834 | Ga0495651_0049283 | |||
| 835 | Ga0495653_0001379 | |||
| 836 | Ga0495650_0000019 | |||
| 837 | Ga0495650_0000224 | |||
| 838 | Ga0495650_0000521 | |||
| 839 | Ga0495650_0000618 | |||
| 840 | Ga0495650_0000933 | |||
| 841 | Ga0495650_0003036 | |||
| 842 | Ga0495650_0020702 | |||
| 843 | Ga0495580_0278970 | |||
| 844 | Ga0495582_0061167 | |||
| 845 | Ga0495605_0000028 | |||
| 846 | Ga0495605_0026566 | |||
| 847 | Ga0495605_0134590 | |||
| 848 | Ga0495639_0012342 | |||
| 849 | Ga0495584_0000133 | |||
| 850 | Ga0495584_0002864 | |||
| 851 | Ga0495584_0005809 | |||
| 852 | Ga0495584_0006777 | |||
| 853 | Ga0495584_0016209 | |||
| 854 | Ga0495584_0068436 | |||
| 855 | Ga0495584_0398353 | |||
| 856 | Ga0495585_0000005 | |||
| 857 | Ga0495585_0001478 | |||
| 858 | Ga0495585_0002208 | |||
| 859 | Ga0495585_0002259 | |||
| 860 | Ga0495585_0011077 | |||
| 861 | Ga0495585_0018070 | |||
| 862 | Ga0495585_0029081 | |||
| 863 | Ga0495585_0030142 | |||
| 864 | Ga0495585_0051043 | |||
| 865 | Ga0495594_0001197 | |||
| 866 | Ga0495594_0016797 | |||
| 867 | Ga0495596_0001161 | |||
| 868 | Ga0495596_0001619 | |||
| 869 | Ga0495596_0007212 | |||
| 870 | Ga0495607_0002450 | |||
| 871 | Ga0495607_0006093 | |||
| 872 | Ga0495607_0009950 | |||
| 873 | Ga0495607_0010927 | |||
| 874 | Ga0495607_0020281 | |||
| 875 | Ga0495607_0027308 | |||
| 876 | Ga0495583_0000537 | |||
| 877 | Ga0495583_0001748 | |||
| 878 | Ga0495583_0002111 | |||
| 879 | Ga0495583_0003011 | |||
| 880 | Ga0495583_0004132 | |||
| 881 | Ga0495583_0008403 | |||
| 882 | Ga0495583_0043044 | |||
| 883 | Ga0495583_0044897 | |||
| 884 | Ga0495606_0000001 | |||
| 885 | Ga0495606_0000601 | |||
| 886 | Ga0495606_0003006 | |||
| 887 | Ga0495606_0003203 | |||
| 888 | Ga0495606_0003465 | |||
| 889 | Ga0495606_0006214 | |||
| 890 | Ga0495606_0008710 | |||
| 891 | Ga0495606_0022232 | |||
| 892 | Ga0495606_0082780 | |||
| 893 | Ga0495606_0135014 | |||
| 894 | Ga0495606_0244236 | |||
| 895 | Ga0495610_0002283 | |||
| 896 | Ga0495610_0002657 | |||
| 897 | Ga0495610_0006367 | |||
| 898 | Ga0495610_0014220 | |||
| 899 | Ga0495610_0079844 | |||
| 900 | Ga0495616_0000729 | |||
| 901 | Ga0495616_0001200 | |||
| 902 | Ga0495616_0004957 | |||
| 903 | Ga0495616_0005128 | |||
| 904 | Ga0495616_0016780 | |||
| 905 | Ga0495616_0065863 | |||
| 906 | Ga0495616_0226776 | |||
| 907 | Ga0495618_0014611 | |||
| 908 | Ga0495620_0008352 | |||
| 909 | Ga0495628_0000835 | |||
| 910 | Ga0495628_0005092 | |||
| 911 | Ga0495630_0118045 | |||
| 912 | Ga0495631_0004286 | |||
| 913 | Ga0495631_0004395 | |||
| 914 | Ga0495631_0011347 | |||
| 915 | Ga0495632_0008366 | |||
| 916 | Ga0495632_0013816 | |||
| 917 | Ga0495632_0015168 | |||
| 918 | Ga0495637_0008362 | |||
| 919 | Ga0495643_0000444 | |||
| 920 | Ga0495643_0001965 | |||
| 921 | Ga0495643_0011718 | |||
| 922 | Ga0495643_0015069 | |||
| 923 | Ga0495643_0075509 | |||
| 924 | Ga0495643_0177163 | |||
| 925 | Ga0495644_0000442 | |||
| 926 | Ga0495644_0008829 | |||
| 927 | Ga0495644_0010728 | |||
| 928 | Ga0495644_0012240 | |||
| 929 | Ga0495644_0028183 | |||
| 930 | Ga0495644_0089781 | |||
| 931 | Ga0495648_0000076 | |||
| 932 | Ga0495648_0001719 | |||
| 933 | Ga0495648_0002438 | |||
| 934 | Ga0495648_0004060 | |||
| 935 | Ga0495648_0019389 | |||
| 936 | Ga0495648_0021351 | |||
| 937 | Ga0495663_0003696 | |||
| 938 | Ga0495663_0003907 | |||
| 939 | Ga0495642_0002423 | |||
| 940 | Ga0495642_0007890 | |||
| 941 | Ga0495642_0022520 | |||
| 942 | Ga0495642_0042311 | |||
| 943 | Ga0495642_0043447 | |||
| 944 | Ga0495642_0054249 | |||
| 945 | Ga0495642_0177169 | |||
| 946 | Ga0495642_0193238 | |||
| 947 | Ga0495652_0025035 | |||
| 948 | Ga0495652_0106884 | |||
| 949 | Ga0495654_0000015 | |||
| 950 | Ga0495654_0113740 | |||
| 951 | Ga0495586_0131643 | |||
| 952 | Ga0495587_0004707 | |||
| 953 | Ga0495609_0000474 | |||
| 954 | Ga0495609_0000945 | |||
| 955 | Ga0495609_0023918 | |||
| 956 | Ga0495609_0037303 | |||
| 957 | Ga0495609_0046134 | |||
| 958 | Ga0495609_0106475 | |||
| 959 | Ga0495597_0001571 | |||
| 960 | Ga0495597_0001734 | |||
| 961 | Ga0495597_0001823 | |||
| 962 | Ga0495597_0004860 | |||
| 963 | Ga0495597_0017876 | |||
| 964 | Ga0495597_0020251 | |||
| 965 | Ga0495597_0064281 | |||
| 966 | Ga0495597_0104297 | |||
| 967 | Ga0495597_0233203 | |||
| 968 | Ga0495645_0177990 | |||
| 969 | Ga0495622_0000169 | |||
| 970 | Ga0495622_0000787 | |||
| 971 | Ga0495622_0001840 | |||
| 972 | Ga0495622_0021769 | |||
| 973 | Ga0495622_0061400 | |||
| 974 | Ga0495622_0074921 | |||
| 975 | Ga0495633_0001212 | |||
| 976 | Ga0495633_0001627 | |||
| 977 | Ga0495633_0001865 | |||
| 978 | Ga0495633_0003138 | |||
| 979 | Ga0495633_0005251 | |||
| 980 | Ga0495633_0006151 | |||
| 981 | Ga0495633_0020774 | |||
| 982 | Ga0495633_0041136 | |||
| 983 | Ga0495633_0068268 | |||
| 984 | Ga0495633_0072930 | |||
| 985 | Ga0495633_0084972 | |||
| 986 | Ga0495656_0007102 | |||
| 987 | Ga0495656_0025072 | |||
| 988 | Ga0495668_0000028 | |||
| 989 | Ga0495668_0000241 | |||
| 990 | Ga0495668_0002077 | |||
| 991 | Ga0495668_0020475 | |||
| 992 | Ga0495668_0038170 | |||
| 993 | Ga0495668_0119351 | |||
| 994 | Ga0495668_0243873 | |||
| 995 | Ga0495668_0326598 | |||
| 996 | Ga0495611_0001912 | |||
| 997 | Ga0495611_0002628 | |||
| 998 | Ga0495611_0003087 | |||
| 999 | Ga0495611_0014463 | |||
| 1000 | Ga0495611_0017530 | |||
| 1001 | Ga0495611_0109009 | |||
| 1002 | Ga0495611_0171680 | |||
| 1003 | Ga0495625_0002519 | |||
| 1004 | Ga0495625_0002732 | |||
| 1005 | Ga0495625_0002859 | |||
| 1006 | Ga0495625_0002965 | |||
| 1007 | Ga0495625_0006140 | |||
| 1008 | Ga0495625_0009190 | |||
| 1009 | Ga0495625_0009772 | |||
| 1010 | Ga0495625_0022370 | |||
| 1011 | Ga0495625_0027801 | |||
| 1012 | Ga0495659_0000141 | |||
| 1013 | Ga0495659_0000426 | |||
| 1014 | Ga0495659_0023652 | |||
| 1015 | Ga0495659_0028566 | |||
| 1016 | Ga0495659_0156467 | |||
| 1017 | Ga0495661_0003905 | |||
| 1018 | Ga0495661_0018343 | |||
| 1019 | Ga0495661_0023107 | |||
| 1020 | Ga0495661_0043650 | |||
| 1021 | Ga0495661_0044307 | |||
| 1022 | Ga0495661_0092701 | |||
| 1023 | Ga0495661_0143404 | |||
| 1024 | Ga0495661_0290610 | |||
| 1025 | Ga0495588_0096012 | |||
| 1026 | Ga0495588_0369808 | |||
| 1027 | Ga0495599_0006679 | |||
| 1028 | Ga0495623_0010696 | |||
| 1029 | Ga0495623_0088789 | |||
| 1030 | Ga0495646_0014479 | |||
| 1031 | Ga0495669_0036633 | |||
| 1032 | Ga0495669_0090722 | |||
| 1033 | Ga0495624_0003107 | |||
| 1034 | Ga0495624_0041596 | |||
| 1035 | Ga0495670_0026391 | |||
| 1036 | Ga0495670_0028155 | |||
| 1037 | Ga0495670_0139160 | |||
| 1038 | Ga0495671_0000606 | |||
| 1039 | Ga0495671_0012281 | |||
| 1040 | Ga0495671_0014108 | |||
| 1041 | Ga0495671_0019252 | |||
| 1042 | Ga0495671_0033336 | |||
| 1043 | Ga0495649_0004108 | |||
| 1044 | Ga0495649_0023765 | |||
| 1045 | Ga0495649_0038198 | |||
| 1046 | Ga0495649_0094167 | |||
| 1047 | Ga0495589_0042885 | |||
| 1048 | Ga0495589_0065143 | |||
| 1049 | Ga0495600_0001599 | |||
| 1050 | Ga0495600_0039697 | |||
| 1051 | Ga0495660_0001560 | |||
| 1052 | Ga0495660_0001725 | |||
| 1053 | Ga0495660_0001884 | |||
| 1054 | Ga0495660_0011044 | |||
| 1055 | Ga0495660_0052873 | |||
| 1056 | Ga0495660_0103809 | |||
| 1057 | Ga0495581_0013746 | |||
| 1058 | Ga0495581_0064606 | |||
| 1059 | Ga0495581_0117576 | |||
| 1060 | Ga0495604_0008630 | |||
| 1061 | Ga0495636_0000421 | |||
| 1062 | Ga0495636_0001925 | |||
| 1063 | Ga0495636_0003633 | |||
| 1064 | Ga0495636_0012980 | |||
| 1065 | Ga0495672_0000368 | |||
| 1066 | Ga0495672_0002311 | |||
| 1067 | Ga0495672_0005259 | |||
| 1068 | Ga0495672_0048358 | |||
| 1069 | Ga0495672_0132210 | |||
| 1070 | Ga0495676_0063427 | |||
| 1071 | Ga0495683_0001845 | |||
| 1072 | Ga0495683_0018620 | |||
| 1073 | Ga0495683_0054764 | |||
| 1074 | Ga0495683_0077246 | |||
| 1075 | Ga0495683_0117390 | |||
| 1076 | Ga0495683_0271388 | |||
| 1077 | Ga0495687_000191 | |||
| 1078 | Ga0495687_005228 | |||
| 1079 | Ga0495687_031871 | |||
| 1080 | Ga0495687_035894 | |||
| 1081 | Ga0495675_0077121 | |||
| 1082 | Ga0495677_0001285 | |||
| 1083 | Ga0495677_0002306 | |||
| 1084 | Ga0495677_0004243 | |||
| 1085 | Ga0495677_0007293 | |||
| 1086 | Ga0495677_0008067 | |||
| 1087 | Ga0495677_0031279 | |||
| 1088 | Ga0495677_0039574 | |||
| 1089 | Ga0495679_011604 | |||
| 1090 | Ga0495685_000033 | |||
| 1091 | Ga0495685_065895 | |||
| 1092 | Ga0495685_104664 | |||
| 1093 | Ga0495685_113266 | |||
| 1094 | Ga0495673_0000003 | |||
| 1095 | Ga0495673_0000285 | |||
| 1096 | Ga0495673_0077237 | |||
| 1097 | Ga0495681_0004385 | |||
| 1098 | Ga0495681_0006686 | |||
| 1099 | Ga0495681_0008422 | |||
| 1100 | Ga0495681_0083744 | |||
| 1101 | Ga0495681_0103346 | |||
| 1102 | Ga0495686_0000969 | |||
| 1103 | Ga0495686_0003173 | |||
| 1104 | Ga0495686_0015339 | |||
| 1105 | Ga0495686_0016691 | |||
| 1106 | Ga0495593_0005989 | |||
| 1107 | Ga0495593_0280477 | |||
| 1108 | Ga0495602_0195610 | |||
| 1109 | Ga0495615_0001822 | |||
| 1110 | Ga0495626_0001508 | |||
| 1111 | Ga0495626_0010602 | |||
| 1112 | Ga0495626_0020935 | |||
| 1113 | Ga0495626_0039737 | |||
| 1114 | Ga0495626_0081323 | |||
| 1115 | Ga0495626_0155488 | |||
| 1116 | Ga0496101_0282302 | |||
| 1117 | Ga0496102_0000934 | |||
| 1118 | Ga0496105_0120602 | |||
| 1119 | Ga0496111_0399817 | |||
| 1120 | Ga0496115_0000931 | |||
| 1121 | Ga0496115_0691370 | |||
| 1122 | Ga0496116_0008717 | |||
| 1123 | Ga0496116_0018376 | |||
| 1124 | Ga0496116_0045258 | |||
| 1125 | Ga0496118_0056773 | |||
| 1126 | Ga0496121_0051558 | |||
| 1127 | Ga0496121_0097357 | |||
| 1128 | Ga0496122_0001290 | |||
| 1129 | Ga0496123_0001053 | |||
| 1130 | Ga0496124_0013336 | |||
| 1131 | Ga0496124_0114290 | |||
| 1132 | Ga0496124_0119712 | |||
| 1133 | Ga0496125_0004104 | |||
| 1134 | Ga0496125_0020679 | |||
| 1135 | Ga0495678_000030 | |||
| 1136 | Ga0495678_001616 | |||
| 1137 | Ga0495678_001803 | |||
| 1138 | Ga0495678_002839 | |||
| 1139 | Ga0495678_003125 | |||
| 1140 | Ga0495678_017694 | |||
| 1141 | Ga0495678_021386 | |||
| 1142 | Ga0495678_033064 | |||
| 1143 | Ga0495682_0000606 | |||
| 1144 | Ga0495682_0000761 | |||
| 1145 | Ga0495682_0006796 | |||
| 1146 | Ga0501069_0001879 | |||
| 1147 | Ga0501070_0162348 | |||
| 1148 | Ga0501238_000291 | |||
| 1149 | Ga0501249_005157 | |||
| 1150 | Ga0501269_000374 | |||
| 1151 | nmdc:mga03683_10327_c1 | |||
| 1152 | nmdc:mga07m45_75700_c1 | |||
| 1153 | nmdc:mga0n895_314019_c1 | |||
| 1154 | Ga0495601_0008109 | |||
| 1155 | Ga0500594_0001504 | |||
| 1156 | Ga0500595_000547 | |||
| 1157 | Ga0500618_000265 | |||
| 1158 | Ga0500574_000118 | |||
| 1159 | Ga0500586_000076 | |||
| 1160 | Ga0500619_000302 | |||
| 1161 | Ga0500634_0041118 | |||
| 1162 | 2511250110 | |||
| 1163 | 2550693634 | |||
| 1164 | 2643790569 | |||
| 1165 | 2644031646 | |||
| 1166 | 2644211509 | |||
| 1167 | 2644253405 | |||
| 1168 | 2644355548 | |||
| 1169 | 2738737332 | |||
| 1170 | 2738830141 | |||
| 1171 | 2738841551 | |||
| 1172 | 2739153937 | |||
| 1173 | 2739195857 | |||
| 1174 | 2739272422 | |||
| 1175 | 2739322333 | |||
| 1176 | 2739340574 | |||
| 1177 | 2739341466 | |||
| 1178 | 2819540603 | |||
| 1179 | 2819592087 | |||
| 1180 | 2821132064 | |||
| 1181 | 2842712694 | |||
| 1182 | 2857557694 | |||
| 1183 | 2857563967 | |||
| 1184 | 2857568505 | |||
| 1185 | 2884812177 | |||
| 1186 | 2884840495 | |||
| 1187 | 2884855752 | |||
| 1188 | 2896157323 | |||
| 1189 | 2904425500 | |||
| 1190 | 2919477254 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9695 | 2 | 119 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9687 | 1 | 119 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9679 | 1 | 119 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9651 | 1 | 119 |
| 5hm6-assembly1.cif.gz_A | n-terminal domain of bfmr from acinetobacter baumannii | 0.9644 | 2 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9837 | 1 | 82 | 3.40.50.2300 |
| af_O07776_22_102_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9785 | 1 | 77 | 3.40.50.2300 |
| af_P69228_9_89_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9771 | 2 | 77 | 3.40.50.2300 |
| af_Q9KJN4_1_80_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9742 | 1 | 77 | 3.40.50.2300 |
| af_P76340_1_79_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9718 | 1 | 77 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S6VSY2-F1-model_v4 | Type IV pilus assembly protein PilB | 0.9807 | 2 | 119 |
GO:0000160
GO:0005524 GO:0005886 GO:0016887 |
| AF-A0A7X7DME9-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9745 | 1 | 118 |
GO:0000155
|
| AF-A0A5S9IQL5-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9714 | 2 | 118 |
GO:0000155
GO:0005524 GO:0005886 |
| AF-A0A2J0KYQ6-F1-model_v4 | Response regulatory domain-containing protein | 0.9711 | 2 | 115 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2S0VX93-F1-model_v4 | histidine kinase (EC 2.7.13.3) | 0.9705 | 2 | 77 |
GO:0000155
GO:0016020 |