F467458

General Info

Members Datasets Scaffolds Average Seq Length
595 195 1190 241

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0375994|Ga0395900_0375994_202_1047
Length 281
Sequence LRFRFCHPFALSLSKGCLQDRILKKWQGFDKLSPNGKWLVMDIRNIVILTGAGISAESGLATFRGPDGLWEGHRVEDVCTPEAFRRDPALVHAFYDARRAKLGTVGPNAAHQALARLDEEWPGELLLVTQNVDDLHERAGSKRLIHMHGELTKGWCLRCNERFAWEGPMGERAECPSCRTVAMVRPDIVWFGEMPYEMERIDEALRTCDLFVSIGTSGAVYPAAGFVQTAKYCGANTLEMNLEPSLGSYMFDESRVGRAGELVPLWVEEVLQSAHSSPISR

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
164 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
173 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
174 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
193 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
194 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
195 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 3.7
Rhizosphere 95.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0375994 3300037418 Bacteria 1390
2 JGI24739J22299_10004251 3300001989 Bacteria 5483
3 JGI24737J22298_10021633 3300001990 Bacteria 2048
4 JGI24737J22298_10074508 3300001990 Bacteria 1012
5 JGI24743J22301_10003287 3300001991 Bacteria 2543
6 JGI24738J21930_10015427 3300002075 Bacteria 1625
7 JGI24744J21845_10005272 3300002077 Bacteria 2675
8 Ga0065712_10145574 3300005290 Bacteria 1412
9 Ga0065715_10186739 3300005293 Bacteria 1440
10 Ga0070658_10005105 3300005327 Bacteria 10683
11 Ga0070658_10014602 3300005327 Bacteria 6303
12 Ga0070658_10036686 3300005327 Bacteria 3951
13 Ga0070658_10149549 3300005327 Bacteria 1954
14 Ga0070658_10259871 3300005327 Bacteria 1474
15 Ga0070658_10504328 3300005327 Bacteria 1045
16 Ga0070658_10737902 3300005327 Bacteria 855
17 Ga0070676_10046184 3300005328 Bacteria 2539
18 Ga0070676_10049064 3300005328 Bacteria 2470
19 Ga0070676_10097028 3300005328 Bacteria 1815
20 Ga0070676_10373587 3300005328 Bacteria 985
21 Ga0070683_100005109 3300005329 Bacteria 10911
22 Ga0070683_100021802 3300005329 Bacteria 5719
23 Ga0070683_100308916 3300005329 Bacteria 1504
24 Ga0070683_100477661 3300005329 Bacteria 1190
25 Ga0070690_100002718 3300005330 Bacteria 9548
26 Ga0070690_100160848 3300005330 Bacteria 1538
27 Ga0070670_100005590 3300005331 Bacteria 10605
28 Ga0070670_100014793 3300005331 Bacteria 6694
29 Ga0070670_100018265 3300005331 Bacteria 6016
30 Ga0070670_100048670 3300005331 Bacteria 3647
31 Ga0070677_10008366 3300005333 Bacteria 3479
32 Ga0068869_100334848 3300005334 Bacteria 1230
33 Ga0070666_10000342 3300005335 Bacteria 29324
34 Ga0070666_10017178 3300005335 Bacteria 4636
35 Ga0070666_10017759 3300005335 Bacteria 4564
36 Ga0070666_10091693 3300005335 Bacteria 2088
37 Ga0070666_10164940 3300005335 Bacteria 1549
38 Ga0070680_100073506 3300005336 Bacteria 2812
39 Ga0070680_100092568 3300005336 Bacteria 2503
40 Ga0068868_100002389 3300005338 Bacteria 12993
41 Ga0068868_100002494 3300005338 Bacteria 12783
42 Ga0068868_100198824 3300005338 Bacteria 1670
43 Ga0068868_100519306 3300005338 Bacteria 1045
44 Ga0070660_100043328 3300005339 Bacteria 3439
45 Ga0070660_100046787 3300005339 Bacteria 3317
46 Ga0070660_100083027 3300005339 Bacteria 2516
47 Ga0070660_100126334 3300005339 Bacteria 2044
48 Ga0070660_100210607 3300005339 Bacteria 1578
49 Ga0070660_100218556 3300005339 Bacteria 1548
50 Ga0070660_100224972 3300005339 Bacteria 1526
51 Ga0070660_100242488 3300005339 Bacteria 1468
52 Ga0070660_100286706 3300005339 Bacteria 1348
53 Ga0070660_100531698 3300005339 Bacteria 980
54 Ga0070689_100092496 3300005340 Bacteria 2385
55 Ga0070687_100093585 3300005343 Bacteria 1667
56 Ga0070687_100095944 3300005343 Bacteria 1650
57 Ga0070661_100012399 3300005344 Bacteria 5963
58 Ga0070661_100033078 3300005344 Bacteria 3745
59 Ga0070661_100058436 3300005344 Bacteria 2826
60 Ga0070661_100084925 3300005344 Bacteria 2339
61 Ga0070661_100086099 3300005344 Bacteria 2323
62 Ga0070661_100125430 3300005344 Bacteria 1926
63 Ga0070661_100205157 3300005344 Bacteria 1507
64 Ga0070661_100433354 3300005344 Bacteria 1044
65 Ga0070692_10095951 3300005345 Bacteria 1619
66 Ga0070669_100065653 3300005353 Bacteria 2673
67 Ga0070669_100077955 3300005353 Bacteria 2462
68 Ga0070669_100350758 3300005353 Bacteria 1198
69 Ga0070669_100361797 3300005353 Bacteria 1180
70 Ga0070675_100014011 3300005354 Bacteria 6314
71 Ga0070675_100024479 3300005354 Bacteria 4834
72 Ga0070675_100024582 3300005354 Bacteria 4824
73 Ga0070675_100615850 3300005354 Bacteria 985
74 Ga0070671_100003050 3300005355 Bacteria 13026
75 Ga0070671_100011680 3300005355 Bacteria 7063
76 Ga0070671_100031754 3300005355 Bacteria 4365
77 Ga0070671_100164158 3300005355 Bacteria 1878
78 Ga0070671_100194559 3300005355 Bacteria 1719
79 Ga0070671_100202283 3300005355 Bacteria 1684
80 Ga0070671_100255596 3300005355 Bacteria 1488
81 Ga0070674_100005255 3300005356 Bacteria 7455
82 Ga0070674_100033626 3300005356 Bacteria 3415
83 Ga0070674_100054157 3300005356 Bacteria 2773
84 Ga0070673_100007550 3300005364 Bacteria 7186
85 Ga0070673_100034497 3300005364 Bacteria 3830
86 Ga0070673_100065260 3300005364 Bacteria 2903
87 Ga0070673_100302941 3300005364 Bacteria 1407
88 Ga0070659_100010863 3300005366 Bacteria 6713
89 Ga0070659_100074807 3300005366 Bacteria 2699
90 Ga0070659_100182772 3300005366 Bacteria 1721
91 Ga0070659_100435310 3300005366 Bacteria 1110
92 Ga0070667_100000656 3300005367 Bacteria 33607
93 Ga0070667_100001032 3300005367 Bacteria 25440
94 Ga0070667_100002148 3300005367 Bacteria 17364
95 Ga0070667_100208437 3300005367 Bacteria 1737
96 Ga0070667_100436153 3300005367 Bacteria 1196
97 Ga0070709_10006855 3300005434 Bacteria 6224
98 Ga0070714_100014682 3300005435 Bacteria 6294
99 Ga0070714_100119420 3300005435 Bacteria 2343
100 Ga0070714_100191045 3300005435 Bacteria 1869
101 Ga0070713_100231058 3300005436 Bacteria 1681
102 Ga0070705_100458498 3300005440 Bacteria 958
103 Ga0070694_100009895 3300005444 Bacteria 5860
104 Ga0070663_100015825 3300005455 Bacteria 4880
105 Ga0070663_100055140 3300005455 Bacteria 2843
106 Ga0070663_100059943 3300005455 Bacteria 2736
107 Ga0070663_100062435 3300005455 Bacteria 2686
108 Ga0070663_100082477 3300005455 Bacteria 2365
109 Ga0070678_100000515 3300005456 Bacteria 18701
110 Ga0070678_100007809 3300005456 Bacteria 6365
111 Ga0070678_100033926 3300005456 Bacteria 3548
112 Ga0070678_100127293 3300005456 Bacteria 2018
113 Ga0070678_100251160 3300005456 Bacteria 1483
114 Ga0070662_100009181 3300005457 Bacteria 6456
115 Ga0070662_100026033 3300005457 Bacteria 4047
116 Ga0070662_100041945 3300005457 Bacteria 3267
117 Ga0070662_100176514 3300005457 Bacteria 1681
118 Ga0070662_100320671 3300005457 Bacteria 1263
119 Ga0068867_100017519 3300005459 Bacteria 5088
120 Ga0070684_100005397 3300005535 Bacteria 9794
121 Ga0070684_100075845 3300005535 Bacteria 2967
122 Ga0068853_100046194 3300005539 Bacteria 3733
123 Ga0068853_100062034 3300005539 Bacteria 3234
124 Ga0068853_100157913 3300005539 Bacteria 2044
125 Ga0068853_100214000 3300005539 Bacteria 1757
126 Ga0070672_100001525 3300005543 Bacteria 14350
127 Ga0070672_100002340 3300005543 Bacteria 11982
128 Ga0070672_100002538 3300005543 Bacteria 11635
129 Ga0070672_100033346 3300005543 Bacteria 3899
130 Ga0070672_100382998 3300005543 Bacteria 1203
131 Ga0070686_100330086 3300005544 Bacteria 1140
132 Ga0070665_100014710 3300005548 Bacteria 7850
133 Ga0070665_100018646 3300005548 Bacteria 6954
134 Ga0070665_100109674 3300005548 Bacteria 2762
135 Ga0070665_100154753 3300005548 Bacteria 2294
136 Ga0070665_100247597 3300005548 Bacteria 1783
137 Ga0070704_100274604 3300005549 Bacteria 1394
138 Ga0068855_100097210 3300005563 Bacteria 3392
139 Ga0068855_100127360 3300005563 Bacteria 2910
140 Ga0070664_100003402 3300005564 Bacteria 12844
141 Ga0070664_100003720 3300005564 Bacteria 12293
142 Ga0070664_100013852 3300005564 Bacteria 6573
143 Ga0070664_100037066 3300005564 Bacteria 4097
144 Ga0068857_100007710 3300005577 Bacteria 9274
145 Ga0068857_100040774 3300005577 Bacteria 4116
146 Ga0068857_100097745 3300005577 Bacteria 2632
147 Ga0068857_100240143 3300005577 Bacteria 1658
148 Ga0068854_100009980 3300005578 Bacteria 6147
149 Ga0068854_100020435 3300005578 Bacteria 4480
150 Ga0068854_100073331 3300005578 Bacteria 2509
151 Ga0068854_100113085 3300005578 Bacteria 2050
152 Ga0068854_100156714 3300005578 Bacteria 1760
153 Ga0068854_100448019 3300005578 Bacteria 1077
154 Ga0068856_100087371 3300005614 Bacteria 3099
155 Ga0068856_100378140 3300005614 Bacteria 1435
156 Ga0068856_100748265 3300005614 Bacteria 997
157 Ga0070702_100078832 3300005615 Bacteria 1967
158 Ga0068852_100001822 3300005616 Bacteria 14491
159 Ga0068852_100005877 3300005616 Bacteria 8819
160 Ga0068852_100011351 3300005616 Bacteria 6702
161 Ga0068852_100069369 3300005616 Bacteria 3089
162 Ga0068852_100118991 3300005616 Bacteria 2414
163 Ga0068852_100162902 3300005616 Bacteria 2084
164 Ga0068852_100546856 3300005616 Bacteria 1158
165 Ga0068852_100763339 3300005616 Bacteria 980
166 Ga0068852_100800457 3300005616 Bacteria 957
167 Ga0068859_100033630 3300005617 Bacteria 5149
168 Ga0068859_100048424 3300005617 Bacteria 4270
169 Ga0068859_100049241 3300005617 Bacteria 4232
170 Ga0068859_100086776 3300005617 Bacteria 3177
171 Ga0068859_101069598 3300005617 Bacteria 887
172 Ga0068864_100003157 3300005618 Bacteria 13623
173 Ga0068864_100115414 3300005618 Bacteria 2395
174 Ga0068864_100170244 3300005618 Bacteria 1985
175 Ga0068864_100248903 3300005618 Bacteria 1649
176 Ga0068864_100450954 3300005618 Bacteria 1230
177 Ga0068864_100648383 3300005618 Bacteria 1028
178 Ga0068866_10012187 3300005718 Bacteria 3743
179 Ga0068866_10109657 3300005718 Bacteria 1537
180 Ga0068861_100678846 3300005719 Bacteria 955
181 Ga0068851_10003128 3300005834 Bacteria 7336
182 Ga0068851_10003930 3300005834 Bacteria 6651
183 Ga0068870_10263144 3300005840 Bacteria 1074
184 Ga0068863_100020729 3300005841 Bacteria 6278
185 Ga0068863_100040499 3300005841 Bacteria 4430
186 Ga0068863_100086762 3300005841 Bacteria 2966
187 Ga0068863_100877392 3300005841 Bacteria 897
188 Ga0068858_100010680 3300005842 Bacteria 8686
189 Ga0068858_100173095 3300005842 Bacteria 2036
190 Ga0068858_100367747 3300005842 Bacteria 1379
191 Ga0068860_100050945 3300005843 Bacteria 3941
192 Ga0068860_100229691 3300005843 Bacteria 1803
193 Ga0068862_100020846 3300005844 Bacteria 5475
194 Ga0075364_10337438 3300006051 Bacteria 1027
195 Ga0070712_100030227 3300006175 Bacteria 3639
196 Ga0070712_100073375 3300006175 Bacteria 2454
197 Ga0097621_100015122 3300006237 Bacteria 5797
198 Ga0097621_100027072 3300006237 Bacteria 4505
199 Ga0097621_100156244 3300006237 Bacteria 1958
200 Ga0068871_100002519 3300006358 Bacteria 12491
201 Ga0068871_100011605 3300006358 Bacteria 6467
202 Ga0068871_100202583 3300006358 Bacteria 1714
203 Ga0068865_100013480 3300006881 Bacteria 5166
204 Ga0068865_100083541 3300006881 Bacteria 2299
205 Ga0097620_100033627 3300006931 Bacteria 5149
206 Ga0097620_100048424 3300006931 Bacteria 4270
207 Ga0097620_100049240 3300006931 Bacteria 4232
208 Ga0097620_100086778 3300006931 Bacteria 3177
209 Ga0097620_101069668 3300006931 Bacteria 887
210 Ga0105240_10531005 3300009093 Bacteria 1304
211 Ga0111539_10122246 3300009094 Bacteria 3051
212 Ga0111539_10979993 3300009094 Bacteria 983
213 Ga0105245_10032162 3300009098 Bacteria 4644
214 Ga0105245_10210913 3300009098 Bacteria 1869
215 Ga0105245_10731545 3300009098 Bacteria 1024
216 Ga0105241_10359240 3300009174 Bacteria 1267
217 Ga0105242_10033577 3300009176 Bacteria 4109
218 Ga0105242_10082968 3300009176 Bacteria 2683
219 Ga0105242_10679344 3300009176 Bacteria 1005
220 Ga0105248_10001099 3300009177 Bacteria 29952
221 Ga0105248_10021512 3300009177 Bacteria 7145
222 Ga0105248_10025875 3300009177 Bacteria 6527
223 Ga0105248_10114274 3300009177 Bacteria 3045
224 Ga0105248_10199250 3300009177 Bacteria 2256
225 Ga0105248_10317551 3300009177 Bacteria 1754
226 Ga0105248_10488611 3300009177 Bacteria 1388
227 Ga0105248_10578905 3300009177 Bacteria 1267
228 Ga0105238_10008144 3300009551 Bacteria 10483
229 Ga0105249_10141702 3300009553 Bacteria 2306
230 Ga0157373_10028733 3300013100 Bacteria 4010
231 Ga0157373_10043319 3300013100 Bacteria 3215
232 Ga0157373_10100233 3300013100 Bacteria 2038
233 Ga0157373_10166776 3300013100 Bacteria 1550
234 Ga0157371_10002411 3300013102 Bacteria 17884
235 Ga0157371_10006284 3300013102 Bacteria 9839
236 Ga0157371_10014442 3300013102 Bacteria 5958
237 Ga0157371_10028010 3300013102 Bacteria 4083
238 Ga0157371_10530597 3300013102 Bacteria 871
239 Ga0157370_10002132 3300013104 Bacteria 24152
240 Ga0157370_10052615 3300013104 Bacteria 3887
241 Ga0157370_10119187 3300013104 Bacteria 2464
242 Ga0157369_10027645 3300013105 Bacteria 6285
243 Ga0157369_10049163 3300013105 Bacteria 4572
244 Ga0157369_10273224 3300013105 Bacteria 1761
245 Ga0157369_11235010 3300013105 Bacteria 762
246 Ga0157374_10025083 3300013296 Bacteria 5349
247 Ga0157374_10032457 3300013296 Bacteria 4754
248 Ga0157374_10057345 3300013296 Bacteria 3637
249 Ga0157374_10177931 3300013296 Bacteria 2077
250 Ga0157374_10782570 3300013296 Bacteria 969
251 Ga0157378_10009310 3300013297 Bacteria 8556
252 Ga0163162_10019478 3300013306 Bacteria 6657
253 Ga0163162_10035032 3300013306 Bacteria 4998
254 Ga0163162_10469332 3300013306 Bacteria 1390
255 Ga0157372_10088675 3300013307 Bacteria 3512
256 Ga0157372_10281854 3300013307 Bacteria 1932
257 Ga0157372_10569863 3300013307 Bacteria 1320
258 Ga0157375_10007721 3300013308 Bacteria 9415
259 Ga0157375_10022406 3300013308 Bacteria 5814
260 Ga0163163_10092920 3300014325 Bacteria 3033
261 Ga0157380_10009759 3300014326 Bacteria 6888
262 Ga0157377_10175122 3300014745 Bacteria 1345
263 Ga0157379_10114483 3300014968 Bacteria 2424
264 Ga0157376_10015984 3300014969 Bacteria 5686
265 Ga0163161_10193636 3300017792 Bacteria 1564
266 Ga0213876_10005484 3300021384 Bacteria 6966
267 Ga0207697_10025327 3300025315 Bacteria 2425
268 Ga0207697_10057651 3300025315 Bacteria 1612
269 Ga0207656_10009080 3300025321 Bacteria 3684
270 Ga0207656_10058217 3300025321 Bacteria 1687
271 Ga0207682_10006415 3300025893 Bacteria 4740
272 Ga0207682_10028260 3300025893 Bacteria 2238
273 Ga0207642_10009253 3300025899 Bacteria 3420
274 Ga0207688_10029168 3300025901 Bacteria 3037
275 Ga0207680_10134764 3300025903 Bacteria 1631
276 Ga0207680_10176134 3300025903 Bacteria 1443
277 Ga0207647_10015410 3300025904 Bacteria 5241
278 Ga0207647_10025437 3300025904 Bacteria 3889
279 Ga0207647_10064058 3300025904 Bacteria 2234
280 Ga0207645_10014638 3300025907 Bacteria 5240
281 Ga0207645_10076233 3300025907 Bacteria 2147
282 Ga0207645_10122435 3300025907 Bacteria 1689
283 Ga0207645_10143692 3300025907 Bacteria 1555
284 Ga0207643_10335165 3300025908 Bacteria 947
285 Ga0207705_10000169 3300025909 Bacteria 69941
286 Ga0207705_10042178 3300025909 Bacteria 3276
287 Ga0207705_10110989 3300025909 Bacteria 2026
288 Ga0207705_10196303 3300025909 Bacteria 1528
289 Ga0207705_10397002 3300025909 Bacteria 1066
290 Ga0207707_10604530 3300025912 Bacteria 928
291 Ga0207660_10000397 3300025917 Bacteria 28599
292 Ga0207660_10144839 3300025917 Bacteria 1820
293 Ga0207662_10041631 3300025918 Bacteria 2705
294 Ga0207662_10047490 3300025918 Bacteria 2543
295 Ga0207662_10075972 3300025918 Bacteria 2041
296 Ga0207657_10001497 3300025919 Bacteria 24993
297 Ga0207657_10004781 3300025919 Bacteria 14283
298 Ga0207657_10020824 3300025919 Bacteria 6188
299 Ga0207657_10054838 3300025919 Bacteria 3445
300 Ga0207657_10061577 3300025919 Bacteria 3217
301 Ga0207657_10061851 3300025919 Bacteria 3207
302 Ga0207657_10070264 3300025919 Bacteria 2968
303 Ga0207657_10179118 3300025919 Bacteria 1714
304 Ga0207657_10212417 3300025919 Bacteria 1552
305 Ga0207657_10427905 3300025919 Bacteria 1040
306 Ga0207649_10007213 3300025920 Bacteria 6043
307 Ga0207649_10409545 3300025920 Bacteria 1016
308 Ga0207681_10130951 3300025923 Bacteria 1854
309 Ga0207694_10048295 3300025924 Bacteria 3293
310 Ga0207650_10003728 3300025925 Bacteria 10424
311 Ga0207650_10007235 3300025925 Bacteria 7559
312 Ga0207650_10016626 3300025925 Bacteria 5143
313 Ga0207650_10163595 3300025925 Bacteria 1764
314 Ga0207659_10022041 3300025926 Bacteria 4238
315 Ga0207659_10031979 3300025926 Bacteria 3607
316 Ga0207659_10288984 3300025926 Bacteria 1343
317 Ga0207659_10351847 3300025926 Bacteria 1222
318 Ga0207687_10004771 3300025927 Bacteria 9017
319 Ga0207687_10090649 3300025927 Bacteria 2228
320 Ga0207664_10035908 3300025929 Bacteria 3827
321 Ga0207664_10048720 3300025929 Bacteria 3333
322 Ga0207644_10000744 3300025931 Bacteria 20651
323 Ga0207644_10001832 3300025931 Bacteria 13807
324 Ga0207644_10002415 3300025931 Bacteria 12033
325 Ga0207644_10002824 3300025931 Bacteria 11190
326 Ga0207644_10202977 3300025931 Bacteria 1564
327 Ga0207690_10088105 3300025932 Bacteria 2186
328 Ga0207690_10100531 3300025932 Bacteria 2064
329 Ga0207690_10328248 3300025932 Bacteria 1204
330 Ga0207690_10615101 3300025932 Bacteria 888
331 Ga0207706_10001627 3300025933 Bacteria 22270
332 Ga0207706_10006908 3300025933 Bacteria 10497
333 Ga0207706_10014562 3300025933 Bacteria 7125
334 Ga0207706_10016090 3300025933 Bacteria 6759
335 Ga0207706_10039383 3300025933 Bacteria 4190
336 Ga0207706_10345306 3300025933 Bacteria 1294
337 Ga0207670_10281988 3300025936 Bacteria 1295
338 Ga0207669_10041981 3300025937 Bacteria 2666
339 Ga0207669_10055163 3300025937 Bacteria 2405
340 Ga0207704_10007755 3300025938 Bacteria 5094
341 Ga0207665_10033347 3300025939 Bacteria 3412
342 Ga0207691_10001381 3300025940 Bacteria 24252
343 Ga0207691_10001970 3300025940 Bacteria 20068
344 Ga0207691_10006955 3300025940 Bacteria 10911
345 Ga0207691_10040577 3300025940 Bacteria 4299
346 Ga0207691_10110568 3300025940 Bacteria 2444
347 Ga0207691_10443139 3300025940 Bacteria 1105
348 Ga0207711_10006620 3300025941 Bacteria 9759
349 Ga0207711_10011392 3300025941 Bacteria 7391
350 Ga0207711_10042991 3300025941 Bacteria 3852
351 Ga0207711_10137876 3300025941 Bacteria 2193
352 Ga0207711_10152046 3300025941 Bacteria 2089
353 Ga0207711_10441315 3300025941 Bacteria 1211
354 Ga0207689_10441216 3300025942 Bacteria 1087
355 Ga0207661_10024217 3300025944 Bacteria 4597
356 Ga0207661_10635430 3300025944 Bacteria 981
357 Ga0207679_10032130 3300025945 Bacteria 3681
358 Ga0207679_10049858 3300025945 Bacteria 3056
359 Ga0207679_10056602 3300025945 Bacteria 2896
360 Ga0207679_10081145 3300025945 Bacteria 2479
361 Ga0207679_10099323 3300025945 Bacteria 2272
362 Ga0207679_10121026 3300025945 Bacteria 2083
363 Ga0207679_10134202 3300025945 Bacteria 1991
364 Ga0207679_10228578 3300025945 Bacteria 1569
365 Ga0207667_10040043 3300025949 Bacteria 4989
366 Ga0207667_10108424 3300025949 Bacteria 2865
367 Ga0207667_10163007 3300025949 Bacteria 2293
368 Ga0207667_10169865 3300025949 Bacteria 2241
369 Ga0207667_10629970 3300025949 Bacteria 1079
370 Ga0207651_10028129 3300025960 Bacteria 3541
371 Ga0207651_10033621 3300025960 Bacteria 3309
372 Ga0207651_10039113 3300025960 Bacteria 3124
373 Ga0207651_10060335 3300025960 Bacteria 2632
374 Ga0207651_10085584 3300025960 Bacteria 2288
375 Ga0207640_10005393 3300025981 Bacteria 6972
376 Ga0207640_10021146 3300025981 Bacteria 3873
377 Ga0207640_10115426 3300025981 Bacteria 1912
378 Ga0207640_10152283 3300025981 Bacteria 1700
379 Ga0207658_10007088 3300025986 Bacteria 7637
380 Ga0207658_10143860 3300025986 Bacteria 1933
381 Ga0207658_10202390 3300025986 Bacteria 1658
382 Ga0207658_10211982 3300025986 Bacteria 1624
383 Ga0207658_10438578 3300025986 Bacteria 1154
384 Ga0207677_10189640 3300026023 Bacteria 1625
385 Ga0207677_10240073 3300026023 Bacteria 1465
386 Ga0207703_10001455 3300026035 Bacteria 21592
387 Ga0207703_10003657 3300026035 Bacteria 12817
388 Ga0207703_10856490 3300026035 Bacteria 869
389 Ga0207639_10055716 3300026041 Bacteria 3027
390 Ga0207639_10120013 3300026041 Bacteria 2159
391 Ga0207639_10255493 3300026041 Bacteria 1530
392 Ga0207639_10506844 3300026041 Bacteria 1103
393 Ga0207678_10002415 3300026067 Bacteria 16979
394 Ga0207678_10003727 3300026067 Bacteria 13709
395 Ga0207678_10004478 3300026067 Bacteria 12563
396 Ga0207678_10061424 3300026067 Bacteria 3232
397 Ga0207678_10081355 3300026067 Bacteria 2772
398 Ga0207678_10091554 3300026067 Bacteria 2599
399 Ga0207702_10058372 3300026078 Bacteria 3284
400 Ga0207702_10104098 3300026078 Bacteria 2511
401 Ga0207702_10164935 3300026078 Bacteria 2026
402 Ga0207702_10770680 3300026078 Bacteria 950
403 Ga0207641_10008123 3300026088 Bacteria 8690
404 Ga0207641_10036536 3300026088 Bacteria 4101
405 Ga0207641_10064470 3300026088 Bacteria 3131
406 Ga0207648_10003247 3300026089 Bacteria 17102
407 Ga0207648_10019946 3300026089 Bacteria 6049
408 Ga0207676_10006903 3300026095 Bacteria 8046
409 Ga0207676_10016828 3300026095 Bacteria 5294
410 Ga0207676_10017039 3300026095 Bacteria 5263
411 Ga0207676_10420631 3300026095 Bacteria 1253
412 Ga0207676_10996697 3300026095 Bacteria 825
413 Ga0207674_10000814 3300026116 Bacteria 40536
414 Ga0207674_10017439 3300026116 Bacteria 7836
415 Ga0207674_10021242 3300026116 Bacteria 6996
416 Ga0207674_10179449 3300026116 Bacteria 2069
417 Ga0207675_100122661 3300026118 Bacteria 2460
418 Ga0207683_10004683 3300026121 Bacteria 11787
419 Ga0207683_10004870 3300026121 Bacteria 11553
420 Ga0207683_10005436 3300026121 Bacteria 10908
421 Ga0207683_10020351 3300026121 Bacteria 5674
422 Ga0207683_10063263 3300026121 Bacteria 3259
423 Ga0207683_10606677 3300026121 Bacteria 1013
424 Ga0207698_10005095 3300026142 Bacteria 8068
425 Ga0207698_10031674 3300026142 Bacteria 3820
426 Ga0207698_10063860 3300026142 Bacteria 2884
427 Ga0207698_10126718 3300026142 Bacteria 2173
428 Ga0207698_10163902 3300026142 Bacteria 1948
429 Ga0207698_10218846 3300026142 Bacteria 1719
430 Ga0207698_10466458 3300026142 Bacteria 1222
431 Ga0207698_10681951 3300026142 Bacteria 1021
432 Ga0209974_10017312 3300027876 Bacteria 2390
433 Ga0268266_10014788 3300028379 Bacteria 6704
434 Ga0268266_10073876 3300028379 Bacteria 2960
435 Ga0268266_10115965 3300028379 Bacteria 2378
436 Ga0268266_10219966 3300028379 Bacteria 1745
437 Ga0268265_10002174 3300028380 Bacteria 15167
438 Ga0268265_10339335 3300028380 Bacteria 1367
439 Ga0268264_10047544 3300028381 Bacteria 3568
440 Ga0268264_10274461 3300028381 Bacteria 1576
441 Ga0307408_100011716 3300031548 Bacteria 5798
442 Ga0307408_100029432 3300031548 Bacteria 3805
443 Ga0307405_10023517 3300031731 Bacteria 3503
444 Ga0307405_10322192 3300031731 Bacteria 1181
445 Ga0307413_10011814 3300031824 Bacteria 4314
446 Ga0307413_10015739 3300031824 Bacteria 3884
447 Ga0307413_10457995 3300031824 Bacteria 1014
448 Ga0307410_10000261 3300031852 Bacteria 20155
449 Ga0307410_10003012 3300031852 Bacteria 8313
450 Ga0307410_10076279 3300031852 Bacteria 2339
451 Ga0307406_10017510 3300031901 Bacteria 4173
452 Ga0307407_10003620 3300031903 Bacteria 6389
453 Ga0307407_10027800 3300031903 Bacteria 3015
454 Ga0307412_10016478 3300031911 Bacteria 4403
455 Ga0307412_10453995 3300031911 Bacteria 1057
456 Ga0307409_100015065 3300031995 Bacteria 5056
457 Ga0307409_100042339 3300031995 Bacteria 3410
458 Ga0307409_100098512 3300031995 Bacteria 2418
459 Ga0307416_100000569 3300032002 Bacteria 18881
460 Ga0307416_100009024 3300032002 Bacteria 6489
461 Ga0307416_100019706 3300032002 Bacteria 4791
462 Ga0307416_100056004 3300032002 Bacteria 3179
463 Ga0307414_10034797 3300032004 Bacteria 3344
464 Ga0307414_10534759 3300032004 Bacteria 1042
465 Ga0307411_10014817 3300032005 Bacteria 4354
466 Ga0307411_10037020 3300032005 Bacteria 3063
467 Ga0307411_10037302 3300032005 Bacteria 3055
468 Ga0307415_100004798 3300032126 Bacteria 7088
469 Ga0307415_100029673 3300032126 Bacteria 3498
470 Ga0395899_0016019 3300037312 Bacteria 5717
471 Ga0395899_0049563 3300037312 Bacteria 3121
472 Ga0395899_0051255 3300037312 Bacteria 3063
473 Ga0395899_0063264 3300037312 Bacteria 2722
474 Ga0395899_0124814 3300037312 Bacteria 1841
475 Ga0395899_0329931 3300037312 Bacteria 1025
476 Ga0395899_0389004 3300037312 Bacteria 925
477 Ga0395900_0001148 3300037418 Bacteria 33301
478 Ga0395900_0022200 3300037418 Bacteria 6492
479 Ga0395900_0036881 3300037418 Bacteria 5039
480 Ga0395900_0039357 3300037418 Bacteria 4871
481 Ga0395900_0046981 3300037418 Bacteria 4445
482 Ga0395900_0064520 3300037418 Bacteria 3763
483 Ga0395900_0086585 3300037418 Bacteria 3219
484 Ga0395900_0091794 3300037418 Bacteria 3120
485 Ga0395900_0118880 3300037418 Bacteria 2712
486 Ga0395900_0119069 3300037418 Bacteria 2710
487 Ga0395900_0157467 3300037418 Bacteria 2319
488 Ga0395900_0193848 3300037418 Bacteria 2059
489 Ga0395900_0267194 3300037418 Bacteria 1706
490 Ga0395900_0378828 3300037418 Bacteria 1383
491 Ga0395900_0984023 3300037418 Bacteria 764
492 Ga0395898_0055064 3300037466 Bacteria 3879
493 Ga0395898_0057010 3300037466 Bacteria 3806
494 Ga0395898_0063786 3300037466 Bacteria 3575
495 Ga0395898_0119969 3300037466 Bacteria 2519
496 Ga0395898_0236554 3300037466 Bacteria 1742
497 Ga0395898_0249240 3300037466 Bacteria 1694
498 Ga0395898_0341021 3300037466 Bacteria 1429
499 Ga0395898_0445011 3300037466 Bacteria 1234
500 Ga0395898_0463389 3300037466 Bacteria 1206
501 Ga0395905_0000649 3300037471 Bacteria 46291
502 Ga0395905_0000688 3300037471 Bacteria 44764
503 Ga0395905_0005321 3300037471 Bacteria 13159
504 Ga0395905_0018584 3300037471 Bacteria 6593
505 Ga0395905_0023788 3300037471 Bacteria 5784
506 Ga0395905_0046441 3300037471 Bacteria 4072
507 Ga0395905_0123460 3300037471 Bacteria 2435
508 Ga0395905_0161672 3300037471 Bacteria 2105
509 Ga0395905_0203003 3300037471 Bacteria 1858
510 Ga0395905_0289240 3300037471 Bacteria 1525
511 Ga0395905_0296321 3300037471 Bacteria 1504
512 Ga0395905_0297814 3300037471 Bacteria 1500
513 Ga0395905_0327711 3300037471 Bacteria 1421
514 Ga0395905_0417287 3300037471 Bacteria 1238
515 Ga0395905_0445898 3300037471 Bacteria 1192
516 Ga0395905_0606527 3300037471 Bacteria 996
517 Ga0395905_0646417 3300037471 Bacteria 959
518 Ga0395905_0662880 3300037471 Bacteria 945
519 Ga0395905_0709005 3300037471 Bacteria 908
520 Ga0395901_0002158 3300038443 Bacteria 20096
521 Ga0395901_0010511 3300038443 Bacteria 9374
522 Ga0395901_0013566 3300038443 Bacteria 8287
523 Ga0395901_0016335 3300038443 Bacteria 7560
524 Ga0395901_0069994 3300038443 Bacteria 3655
525 Ga0395901_0074595 3300038443 Bacteria 3539
526 Ga0395901_0099508 3300038443 Bacteria 3049
527 Ga0395901_0116056 3300038443 Bacteria 2812
528 Ga0395901_0191343 3300038443 Bacteria 2146
529 Ga0395901_0199525 3300038443 Bacteria 2097
530 Ga0395901_0675089 3300038443 Bacteria 1034
531 Ga0395901_0758096 3300038443 Bacteria 963
532 Ga0436365_1268241 3300039437 Bacteria 8581
533 Ga0436363_1350835 3300039450 Bacteria 2465
534 Ga0450890_004194 3300042127 Bacteria 1890
535 Ga0466969_0130966 3300044656 Bacteria 1163
536 Ga0466972_0065649 3300044658 Bacteria 1736
537 Ga0466972_0110027 3300044658 Bacteria 1302
538 Ga0466966_0000039 3300044684 Bacteria 97202
539 Ga0466966_0028674 3300044684 Bacteria 3623
540 Ga0466966_0180928 3300044684 Bacteria 1279
541 Ga0466961_0027122 3300044693 Bacteria 3683
542 Ga0466963_0006397 3300044694 Bacteria 6966
543 Ga0466963_0048837 3300044694 Bacteria 2798
544 Ga0466963_0050504 3300044694 Bacteria 2752
545 Ga0466963_0068640 3300044694 Bacteria 2381
546 Ga0466963_0404863 3300044694 Bacteria 962
547 Ga0466971_0001516 3300044719 Bacteria 9787
548 Ga0466957_0008541 3300044842 Bacteria 5828
549 Ga0466957_0532073 3300044842 Bacteria 818
550 Ga0466960_0037320 3300044901 Bacteria 2279
551 Ga0466959_0129323 3300045049 Bacteria 1790
552 Ga0466959_0236210 3300045049 Bacteria 1264
553 Ga0466958_0002509 3300045836 Bacteria 9251
554 Ga0466958_0091195 3300045836 Bacteria 1886
555 Ga0466967_0019046 3300045976 Bacteria 5509
556 Ga0466967_0039189 3300045976 Bacteria 4071
557 Ga0466967_0069414 3300045976 Bacteria 3149
558 Ga0466967_0110660 3300045976 Bacteria 2523
559 Ga0466967_0134619 3300045976 Bacteria 2297
560 Ga0466967_0156656 3300045976 Bacteria 2134
561 Ga0466967_0420272 3300045976 Bacteria 1303
562 Ga0466967_0942042 3300045976 Bacteria 859
563 Ga0495668_0066257 3300046616 Bacteria 1987
564 Ga0495669_0091905 3300046684 Bacteria 1402
565 Ga0496102_0041705 3300048905 Bacteria 4158
566 Ga0496103_0037918 3300048906 Bacteria 2955
567 Ga0496104_0097699 3300048907 Bacteria 2811
568 Ga0496105_0119850 3300048908 Bacteria 2170
569 Ga0496107_0001637 3300048910 Bacteria 13959
570 Ga0496107_0135589 3300048910 Bacteria 1818
571 Ga0496108_0007326 3300048911 Bacteria 8943
572 Ga0496109_0008301 3300048912 Bacteria 8819
573 Ga0496109_0053861 3300048912 Bacteria 3671
574 Ga0496109_0062830 3300048912 Bacteria 3396
575 Ga0496109_0202525 3300048912 Bacteria 1866
576 Ga0496109_0344412 3300048912 Bacteria 1408
577 Ga0496110_0003540 3300048913 Bacteria 11995
578 Ga0496110_0016392 3300048913 Bacteria 6186
579 Ga0496110_0045225 3300048913 Bacteria 3847
580 Ga0496110_0322982 3300048913 Bacteria 1406
581 Ga0496111_0013499 3300048914 Bacteria 5562
582 Ga0496111_0524111 3300048914 Bacteria 871
583 Ga0496112_0031781 3300048915 Bacteria 5121
584 Ga0496112_0078396 3300048915 Bacteria 3267
585 Ga0496114_0069847 3300048917 Bacteria 2950
586 Ga0496114_0152724 3300048917 Bacteria 2003
587 Ga0501040_0312391 3300049576 Bacteria 1124
588 Ga0501067_0108939 3300049583 Bacteria 1540
589 Ga0501067_0195207 3300049583 Bacteria 1128
590 Ga0501069_0275214 3300049585 Bacteria 984
591 Ga0501233_022734 3300049668 Bacteria 1357
592 Ga0501235_033993 3300049669 Bacteria 1156
593 Ga0501242_016450 3300049674 Bacteria 927
594 Ga0466962_0002209 3300061719 Bacteria 9197
595 Ga0466962_0172742 3300061719 Bacteria 1053
596 Ga0395900_0375994
597 JGI24739J22299_10004251
598 JGI24737J22298_10021633
599 JGI24737J22298_10074508
600 JGI24743J22301_10003287
601 JGI24738J21930_10015427
602 JGI24744J21845_10005272
603 Ga0065712_10145574
604 Ga0065715_10186739
605 Ga0070658_10005105
606 Ga0070658_10014602
607 Ga0070658_10036686
608 Ga0070658_10149549
609 Ga0070658_10259871
610 Ga0070658_10504328
611 Ga0070658_10737902
612 Ga0070676_10046184
613 Ga0070676_10049064
614 Ga0070676_10097028
615 Ga0070676_10373587
616 Ga0070683_100005109
617 Ga0070683_100021802
618 Ga0070683_100308916
619 Ga0070683_100477661
620 Ga0070690_100002718
621 Ga0070690_100160848
622 Ga0070670_100005590
623 Ga0070670_100014793
624 Ga0070670_100018265
625 Ga0070670_100048670
626 Ga0070677_10008366
627 Ga0068869_100334848
628 Ga0070666_10000342
629 Ga0070666_10017178
630 Ga0070666_10017759
631 Ga0070666_10091693
632 Ga0070666_10164940
633 Ga0070680_100073506
634 Ga0070680_100092568
635 Ga0068868_100002389
636 Ga0068868_100002494
637 Ga0068868_100198824
638 Ga0068868_100519306
639 Ga0070660_100043328
640 Ga0070660_100046787
641 Ga0070660_100083027
642 Ga0070660_100126334
643 Ga0070660_100210607
644 Ga0070660_100218556
645 Ga0070660_100224972
646 Ga0070660_100242488
647 Ga0070660_100286706
648 Ga0070660_100531698
649 Ga0070689_100092496
650 Ga0070687_100093585
651 Ga0070687_100095944
652 Ga0070661_100012399
653 Ga0070661_100033078
654 Ga0070661_100058436
655 Ga0070661_100084925
656 Ga0070661_100086099
657 Ga0070661_100125430
658 Ga0070661_100205157
659 Ga0070661_100433354
660 Ga0070692_10095951
661 Ga0070669_100065653
662 Ga0070669_100077955
663 Ga0070669_100350758
664 Ga0070669_100361797
665 Ga0070675_100014011
666 Ga0070675_100024479
667 Ga0070675_100024582
668 Ga0070675_100615850
669 Ga0070671_100003050
670 Ga0070671_100011680
671 Ga0070671_100031754
672 Ga0070671_100164158
673 Ga0070671_100194559
674 Ga0070671_100202283
675 Ga0070671_100255596
676 Ga0070674_100005255
677 Ga0070674_100033626
678 Ga0070674_100054157
679 Ga0070673_100007550
680 Ga0070673_100034497
681 Ga0070673_100065260
682 Ga0070673_100302941
683 Ga0070659_100010863
684 Ga0070659_100074807
685 Ga0070659_100182772
686 Ga0070659_100435310
687 Ga0070667_100000656
688 Ga0070667_100001032
689 Ga0070667_100002148
690 Ga0070667_100208437
691 Ga0070667_100436153
692 Ga0070709_10006855
693 Ga0070714_100014682
694 Ga0070714_100119420
695 Ga0070714_100191045
696 Ga0070713_100231058
697 Ga0070705_100458498
698 Ga0070694_100009895
699 Ga0070663_100015825
700 Ga0070663_100055140
701 Ga0070663_100059943
702 Ga0070663_100062435
703 Ga0070663_100082477
704 Ga0070678_100000515
705 Ga0070678_100007809
706 Ga0070678_100033926
707 Ga0070678_100127293
708 Ga0070678_100251160
709 Ga0070662_100009181
710 Ga0070662_100026033
711 Ga0070662_100041945
712 Ga0070662_100176514
713 Ga0070662_100320671
714 Ga0068867_100017519
715 Ga0070684_100005397
716 Ga0070684_100075845
717 Ga0068853_100046194
718 Ga0068853_100062034
719 Ga0068853_100157913
720 Ga0068853_100214000
721 Ga0070672_100001525
722 Ga0070672_100002340
723 Ga0070672_100002538
724 Ga0070672_100033346
725 Ga0070672_100382998
726 Ga0070686_100330086
727 Ga0070665_100014710
728 Ga0070665_100018646
729 Ga0070665_100109674
730 Ga0070665_100154753
731 Ga0070665_100247597
732 Ga0070704_100274604
733 Ga0068855_100097210
734 Ga0068855_100127360
735 Ga0070664_100003402
736 Ga0070664_100003720
737 Ga0070664_100013852
738 Ga0070664_100037066
739 Ga0068857_100007710
740 Ga0068857_100040774
741 Ga0068857_100097745
742 Ga0068857_100240143
743 Ga0068854_100009980
744 Ga0068854_100020435
745 Ga0068854_100073331
746 Ga0068854_100113085
747 Ga0068854_100156714
748 Ga0068854_100448019
749 Ga0068856_100087371
750 Ga0068856_100378140
751 Ga0068856_100748265
752 Ga0070702_100078832
753 Ga0068852_100001822
754 Ga0068852_100005877
755 Ga0068852_100011351
756 Ga0068852_100069369
757 Ga0068852_100118991
758 Ga0068852_100162902
759 Ga0068852_100546856
760 Ga0068852_100763339
761 Ga0068852_100800457
762 Ga0068859_100033630
763 Ga0068859_100048424
764 Ga0068859_100049241
765 Ga0068859_100086776
766 Ga0068859_101069598
767 Ga0068864_100003157
768 Ga0068864_100115414
769 Ga0068864_100170244
770 Ga0068864_100248903
771 Ga0068864_100450954
772 Ga0068864_100648383
773 Ga0068866_10012187
774 Ga0068866_10109657
775 Ga0068861_100678846
776 Ga0068851_10003128
777 Ga0068851_10003930
778 Ga0068870_10263144
779 Ga0068863_100020729
780 Ga0068863_100040499
781 Ga0068863_100086762
782 Ga0068863_100877392
783 Ga0068858_100010680
784 Ga0068858_100173095
785 Ga0068858_100367747
786 Ga0068860_100050945
787 Ga0068860_100229691
788 Ga0068862_100020846
789 Ga0075364_10337438
790 Ga0070712_100030227
791 Ga0070712_100073375
792 Ga0097621_100015122
793 Ga0097621_100027072
794 Ga0097621_100156244
795 Ga0068871_100002519
796 Ga0068871_100011605
797 Ga0068871_100202583
798 Ga0068865_100013480
799 Ga0068865_100083541
800 Ga0097620_100033627
801 Ga0097620_100048424
802 Ga0097620_100049240
803 Ga0097620_100086778
804 Ga0097620_101069668
805 Ga0105240_10531005
806 Ga0111539_10122246
807 Ga0111539_10979993
808 Ga0105245_10032162
809 Ga0105245_10210913
810 Ga0105245_10731545
811 Ga0105241_10359240
812 Ga0105242_10033577
813 Ga0105242_10082968
814 Ga0105242_10679344
815 Ga0105248_10001099
816 Ga0105248_10021512
817 Ga0105248_10025875
818 Ga0105248_10114274
819 Ga0105248_10199250
820 Ga0105248_10317551
821 Ga0105248_10488611
822 Ga0105248_10578905
823 Ga0105238_10008144
824 Ga0105249_10141702
825 Ga0157373_10028733
826 Ga0157373_10043319
827 Ga0157373_10100233
828 Ga0157373_10166776
829 Ga0157371_10002411
830 Ga0157371_10006284
831 Ga0157371_10014442
832 Ga0157371_10028010
833 Ga0157371_10530597
834 Ga0157370_10002132
835 Ga0157370_10052615
836 Ga0157370_10119187
837 Ga0157369_10027645
838 Ga0157369_10049163
839 Ga0157369_10273224
840 Ga0157369_11235010
841 Ga0157374_10025083
842 Ga0157374_10032457
843 Ga0157374_10057345
844 Ga0157374_10177931
845 Ga0157374_10782570
846 Ga0157378_10009310
847 Ga0163162_10019478
848 Ga0163162_10035032
849 Ga0163162_10469332
850 Ga0157372_10088675
851 Ga0157372_10281854
852 Ga0157372_10569863
853 Ga0157375_10007721
854 Ga0157375_10022406
855 Ga0163163_10092920
856 Ga0157380_10009759
857 Ga0157377_10175122
858 Ga0157379_10114483
859 Ga0157376_10015984
860 Ga0163161_10193636
861 Ga0213876_10005484
862 Ga0207697_10025327
863 Ga0207697_10057651
864 Ga0207656_10009080
865 Ga0207656_10058217
866 Ga0207682_10006415
867 Ga0207682_10028260
868 Ga0207642_10009253
869 Ga0207688_10029168
870 Ga0207680_10134764
871 Ga0207680_10176134
872 Ga0207647_10015410
873 Ga0207647_10025437
874 Ga0207647_10064058
875 Ga0207645_10014638
876 Ga0207645_10076233
877 Ga0207645_10122435
878 Ga0207645_10143692
879 Ga0207643_10335165
880 Ga0207705_10000169
881 Ga0207705_10042178
882 Ga0207705_10110989
883 Ga0207705_10196303
884 Ga0207705_10397002
885 Ga0207707_10604530
886 Ga0207660_10000397
887 Ga0207660_10144839
888 Ga0207662_10041631
889 Ga0207662_10047490
890 Ga0207662_10075972
891 Ga0207657_10001497
892 Ga0207657_10004781
893 Ga0207657_10020824
894 Ga0207657_10054838
895 Ga0207657_10061577
896 Ga0207657_10061851
897 Ga0207657_10070264
898 Ga0207657_10179118
899 Ga0207657_10212417
900 Ga0207657_10427905
901 Ga0207649_10007213
902 Ga0207649_10409545
903 Ga0207681_10130951
904 Ga0207694_10048295
905 Ga0207650_10003728
906 Ga0207650_10007235
907 Ga0207650_10016626
908 Ga0207650_10163595
909 Ga0207659_10022041
910 Ga0207659_10031979
911 Ga0207659_10288984
912 Ga0207659_10351847
913 Ga0207687_10004771
914 Ga0207687_10090649
915 Ga0207664_10035908
916 Ga0207664_10048720
917 Ga0207644_10000744
918 Ga0207644_10001832
919 Ga0207644_10002415
920 Ga0207644_10002824
921 Ga0207644_10202977
922 Ga0207690_10088105
923 Ga0207690_10100531
924 Ga0207690_10328248
925 Ga0207690_10615101
926 Ga0207706_10001627
927 Ga0207706_10006908
928 Ga0207706_10014562
929 Ga0207706_10016090
930 Ga0207706_10039383
931 Ga0207706_10345306
932 Ga0207670_10281988
933 Ga0207669_10041981
934 Ga0207669_10055163
935 Ga0207704_10007755
936 Ga0207665_10033347
937 Ga0207691_10001381
938 Ga0207691_10001970
939 Ga0207691_10006955
940 Ga0207691_10040577
941 Ga0207691_10110568
942 Ga0207691_10443139
943 Ga0207711_10006620
944 Ga0207711_10011392
945 Ga0207711_10042991
946 Ga0207711_10137876
947 Ga0207711_10152046
948 Ga0207711_10441315
949 Ga0207689_10441216
950 Ga0207661_10024217
951 Ga0207661_10635430
952 Ga0207679_10032130
953 Ga0207679_10049858
954 Ga0207679_10056602
955 Ga0207679_10081145
956 Ga0207679_10099323
957 Ga0207679_10121026
958 Ga0207679_10134202
959 Ga0207679_10228578
960 Ga0207667_10040043
961 Ga0207667_10108424
962 Ga0207667_10163007
963 Ga0207667_10169865
964 Ga0207667_10629970
965 Ga0207651_10028129
966 Ga0207651_10033621
967 Ga0207651_10039113
968 Ga0207651_10060335
969 Ga0207651_10085584
970 Ga0207640_10005393
971 Ga0207640_10021146
972 Ga0207640_10115426
973 Ga0207640_10152283
974 Ga0207658_10007088
975 Ga0207658_10143860
976 Ga0207658_10202390
977 Ga0207658_10211982
978 Ga0207658_10438578
979 Ga0207677_10189640
980 Ga0207677_10240073
981 Ga0207703_10001455
982 Ga0207703_10003657
983 Ga0207703_10856490
984 Ga0207639_10055716
985 Ga0207639_10120013
986 Ga0207639_10255493
987 Ga0207639_10506844
988 Ga0207678_10002415
989 Ga0207678_10003727
990 Ga0207678_10004478
991 Ga0207678_10061424
992 Ga0207678_10081355
993 Ga0207678_10091554
994 Ga0207702_10058372
995 Ga0207702_10104098
996 Ga0207702_10164935
997 Ga0207702_10770680
998 Ga0207641_10008123
999 Ga0207641_10036536
1000 Ga0207641_10064470
1001 Ga0207648_10003247
1002 Ga0207648_10019946
1003 Ga0207676_10006903
1004 Ga0207676_10016828
1005 Ga0207676_10017039
1006 Ga0207676_10420631
1007 Ga0207676_10996697
1008 Ga0207674_10000814
1009 Ga0207674_10017439
1010 Ga0207674_10021242
1011 Ga0207674_10179449
1012 Ga0207675_100122661
1013 Ga0207683_10004683
1014 Ga0207683_10004870
1015 Ga0207683_10005436
1016 Ga0207683_10020351
1017 Ga0207683_10063263
1018 Ga0207683_10606677
1019 Ga0207698_10005095
1020 Ga0207698_10031674
1021 Ga0207698_10063860
1022 Ga0207698_10126718
1023 Ga0207698_10163902
1024 Ga0207698_10218846
1025 Ga0207698_10466458
1026 Ga0207698_10681951
1027 Ga0209974_10017312
1028 Ga0268266_10014788
1029 Ga0268266_10073876
1030 Ga0268266_10115965
1031 Ga0268266_10219966
1032 Ga0268265_10002174
1033 Ga0268265_10339335
1034 Ga0268264_10047544
1035 Ga0268264_10274461
1036 Ga0307408_100011716
1037 Ga0307408_100029432
1038 Ga0307405_10023517
1039 Ga0307405_10322192
1040 Ga0307413_10011814
1041 Ga0307413_10015739
1042 Ga0307413_10457995
1043 Ga0307410_10000261
1044 Ga0307410_10003012
1045 Ga0307410_10076279
1046 Ga0307406_10017510
1047 Ga0307407_10003620
1048 Ga0307407_10027800
1049 Ga0307412_10016478
1050 Ga0307412_10453995
1051 Ga0307409_100015065
1052 Ga0307409_100042339
1053 Ga0307409_100098512
1054 Ga0307416_100000569
1055 Ga0307416_100009024
1056 Ga0307416_100019706
1057 Ga0307416_100056004
1058 Ga0307414_10034797
1059 Ga0307414_10534759
1060 Ga0307411_10014817
1061 Ga0307411_10037020
1062 Ga0307411_10037302
1063 Ga0307415_100004798
1064 Ga0307415_100029673
1065 Ga0395899_0016019
1066 Ga0395899_0049563
1067 Ga0395899_0051255
1068 Ga0395899_0063264
1069 Ga0395899_0124814
1070 Ga0395899_0329931
1071 Ga0395899_0389004
1072 Ga0395900_0001148
1073 Ga0395900_0022200
1074 Ga0395900_0036881
1075 Ga0395900_0039357
1076 Ga0395900_0046981
1077 Ga0395900_0064520
1078 Ga0395900_0086585
1079 Ga0395900_0091794
1080 Ga0395900_0118880
1081 Ga0395900_0119069
1082 Ga0395900_0157467
1083 Ga0395900_0193848
1084 Ga0395900_0267194
1085 Ga0395900_0378828
1086 Ga0395900_0984023
1087 Ga0395898_0055064
1088 Ga0395898_0057010
1089 Ga0395898_0063786
1090 Ga0395898_0119969
1091 Ga0395898_0236554
1092 Ga0395898_0249240
1093 Ga0395898_0341021
1094 Ga0395898_0445011
1095 Ga0395898_0463389
1096 Ga0395905_0000649
1097 Ga0395905_0000688
1098 Ga0395905_0005321
1099 Ga0395905_0018584
1100 Ga0395905_0023788
1101 Ga0395905_0046441
1102 Ga0395905_0123460
1103 Ga0395905_0161672
1104 Ga0395905_0203003
1105 Ga0395905_0289240
1106 Ga0395905_0296321
1107 Ga0395905_0297814
1108 Ga0395905_0327711
1109 Ga0395905_0417287
1110 Ga0395905_0445898
1111 Ga0395905_0606527
1112 Ga0395905_0646417
1113 Ga0395905_0662880
1114 Ga0395905_0709005
1115 Ga0395901_0002158
1116 Ga0395901_0010511
1117 Ga0395901_0013566
1118 Ga0395901_0016335
1119 Ga0395901_0069994
1120 Ga0395901_0074595
1121 Ga0395901_0099508
1122 Ga0395901_0116056
1123 Ga0395901_0191343
1124 Ga0395901_0199525
1125 Ga0395901_0675089
1126 Ga0395901_0758096
1127 Ga0436365_1268241
1128 Ga0436363_1350835
1129 Ga0450890_004194
1130 Ga0466969_0130966
1131 Ga0466972_0065649
1132 Ga0466972_0110027
1133 Ga0466966_0000039
1134 Ga0466966_0028674
1135 Ga0466966_0180928
1136 Ga0466961_0027122
1137 Ga0466963_0006397
1138 Ga0466963_0048837
1139 Ga0466963_0050504
1140 Ga0466963_0068640
1141 Ga0466963_0404863
1142 Ga0466971_0001516
1143 Ga0466957_0008541
1144 Ga0466957_0532073
1145 Ga0466960_0037320
1146 Ga0466959_0129323
1147 Ga0466959_0236210
1148 Ga0466958_0002509
1149 Ga0466958_0091195
1150 Ga0466967_0019046
1151 Ga0466967_0039189
1152 Ga0466967_0069414
1153 Ga0466967_0110660
1154 Ga0466967_0134619
1155 Ga0466967_0156656
1156 Ga0466967_0420272
1157 Ga0466967_0942042
1158 Ga0495668_0066257
1159 Ga0495669_0091905
1160 Ga0496102_0041705
1161 Ga0496103_0037918
1162 Ga0496104_0097699
1163 Ga0496105_0119850
1164 Ga0496107_0001637
1165 Ga0496107_0135589
1166 Ga0496108_0007326
1167 Ga0496109_0008301
1168 Ga0496109_0053861
1169 Ga0496109_0062830
1170 Ga0496109_0202525
1171 Ga0496109_0344412
1172 Ga0496110_0003540
1173 Ga0496110_0016392
1174 Ga0496110_0045225
1175 Ga0496110_0322982
1176 Ga0496111_0013499
1177 Ga0496111_0524111
1178 Ga0496112_0031781
1179 Ga0496112_0078396
1180 Ga0496114_0069847
1181 Ga0496114_0152724
1182 Ga0501040_0312391
1183 Ga0501067_0108939
1184 Ga0501067_0195207
1185 Ga0501069_0275214
1186 Ga0501233_022734
1187 Ga0501235_033993
1188 Ga0501242_016450
1189 Ga0466962_0002209
1190 Ga0466962_0172742

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

51

222

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rxm-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16-acetyl peptide 0.94 5 232
6rxl-assembly1.cif.gz_A crystal structure of cobb wt in complex with h4k16-crotonyl peptide 0.9399 5 232
6rxs-assembly1.cif.gz_A crystal structure of cobb ac3(a76g,y92a, i131l, v187y) in complex with h4k16-acetyl peptide 0.935 5 232
6rxr-assembly1.cif.gz_A crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.9307 5 232
6rxm-assembly1.cif.gz_A crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16-acetyl peptide 0.9286 5 232
ID Description Score Start End Superfamily
af_A4IAM7_70_238_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9684 68 233 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9662 5 232 3.40.50.1220
af_A4IAM7_70_238_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9461 68 233 3.40.50.1220
af_P75960_40_271_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9386 5 233 3.40.50.1220
af_Q68FX9_35_302_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.926 3 228 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A532EHK1-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9706 36 232 GO:0017136
GO:0046872
GO:0070403
AF-A0A7W6CE19-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9689 36 232 GO:0016787
GO:0017136
GO:0070403
AF-D0CWR9-F1-model_v4 deleted 0.9679 40 232
AF-A0A2T5FTV8-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9676 1 232 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A512J2L8-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9664 53 231 GO:0017136
GO:0046872
GO:0070403

Map