F467445
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 595 | 284 | 592 | 290 |
Family's Representative Sequence
| Representative Sequence | 3300025944|Ga0207661_10456742|Ga0207661_104567421 |
| Length | 342 |
| Sequence | LENRKTNMTWVDYLRSANWNQASGIGFCAYLLGCFAAGYYLVRSRLGEDVRELGSGSVGARNVGRILGKTGFLITLLCDFGKGALAVWIANHFTKDPRIVAFAMVAVVAGPFVYRVPIDEIDFKAKLKGPSGAHPLGTDDLGQDLLARMLYGGRISLAVGVTAMLIAITLFLCLPQLPLLLLLVYLFRDTLKKVLGPEMGVFMLVVVVIGGLRWMPVARLVRAQFLSLREKEFVEAARGLGAPPLRQVLRHILPNAVGPVIVAGTIDVAAAIIAESSLSFLGLGFPPDIPTWGRILFDAKDNLDFAPHWAIFPGTAIFLAVLSINYIGDGLRDALDPRKVLS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 2 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 88 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 154 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 155 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 156 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 187 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 188 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 189 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 190 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 191 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 192 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 193 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 194 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 233 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 274 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 276 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 277 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 278 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 279 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 280 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 284 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.5 |
| Metatranscriptomes | 0 |
| Isolates | 0.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.51 |
| Nodule | 0.34 |
| Rhizoplane | 1.01 |
| Rhizosphere | 95.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10001308 | 3300003215 | Bacteria | 14903 |
| 2 | JGI26128J50194_1002768 | 3300003347 | Bacteria | 1153 |
| 3 | Ga0065707_10209494 | 3300005295 | Bacteria | 1272 |
| 4 | Ga0070658_10038297 | 3300005327 | Bacteria | 3867 |
| 5 | Ga0070676_10031847 | 3300005328 | Bacteria | 3017 |
| 6 | Ga0070676_10245427 | 3300005328 | Bacteria | 1193 |
| 7 | Ga0070683_100044869 | 3300005329 | Bacteria | 4078 |
| 8 | Ga0070670_100005552 | 3300005331 | Bacteria | 10639 |
| 9 | Ga0068869_100001553 | 3300005334 | Bacteria | 13640 |
| 10 | Ga0070680_100002617 | 3300005336 | Bacteria | 13323 |
| 11 | Ga0070680_100010196 | 3300005336 | Bacteria | 7246 |
| 12 | Ga0070680_100014854 | 3300005336 | Bacteria | 6091 |
| 13 | Ga0070680_100055722 | 3300005336 | Bacteria | 3231 |
| 14 | Ga0070680_100388472 | 3300005336 | Bacteria | 1189 |
| 15 | Ga0070682_100001981 | 3300005337 | Bacteria | 11419 |
| 16 | Ga0070660_100001885 | 3300005339 | Bacteria | 14442 |
| 17 | Ga0070691_10005786 | 3300005341 | Bacteria | 5643 |
| 18 | Ga0070691_10023890 | 3300005341 | Bacteria | 2839 |
| 19 | Ga0070661_100002131 | 3300005344 | Bacteria | 13640 |
| 20 | Ga0070661_100017942 | 3300005344 | Bacteria | 5026 |
| 21 | Ga0070692_10001426 | 3300005345 | Bacteria | 8665 |
| 22 | Ga0070673_100004910 | 3300005364 | Bacteria | 8518 |
| 23 | Ga0070659_100005878 | 3300005366 | Bacteria | 8840 |
| 24 | Ga0070659_100058363 | 3300005366 | Bacteria | 3045 |
| 25 | Ga0070703_10004356 | 3300005406 | Bacteria | 3988 |
| 26 | Ga0070714_100394417 | 3300005435 | Bacteria | 1307 |
| 27 | Ga0070701_10016367 | 3300005438 | Bacteria | 3446 |
| 28 | Ga0070711_100274400 | 3300005439 | Bacteria | 1332 |
| 29 | Ga0070705_100002327 | 3300005440 | Bacteria | 9587 |
| 30 | Ga0070705_100002757 | 3300005440 | Bacteria | 8765 |
| 31 | Ga0070705_100006694 | 3300005440 | Bacteria | 5666 |
| 32 | Ga0070705_100038426 | 3300005440 | Bacteria | 2708 |
| 33 | Ga0070694_100008439 | 3300005444 | Bacteria | 6302 |
| 34 | Ga0070694_100009548 | 3300005444 | Bacteria | 5952 |
| 35 | Ga0070694_100018940 | 3300005444 | Bacteria | 4374 |
| 36 | Ga0070708_100004512 | 3300005445 | Bacteria | 10956 |
| 37 | Ga0070708_100039979 | 3300005445 | Bacteria | 4106 |
| 38 | Ga0070708_100041712 | 3300005445 | Bacteria | 4024 |
| 39 | Ga0070708_100095959 | 3300005445 | Bacteria | 2708 |
| 40 | Ga0070663_100011705 | 3300005455 | Bacteria | 5519 |
| 41 | Ga0070662_100030082 | 3300005457 | Bacteria | 3796 |
| 42 | Ga0070662_100031994 | 3300005457 | Bacteria | 3696 |
| 43 | Ga0070681_10018023 | 3300005458 | Bacteria | 7054 |
| 44 | Ga0070681_10037353 | 3300005458 | Bacteria | 4874 |
| 45 | Ga0070706_100011007 | 3300005467 | Bacteria | 8400 |
| 46 | Ga0070706_100027880 | 3300005467 | Bacteria | 5194 |
| 47 | Ga0070706_100062940 | 3300005467 | Bacteria | 3428 |
| 48 | Ga0070706_100154277 | 3300005467 | Bacteria | 2143 |
| 49 | Ga0070706_100221601 | 3300005467 | Bacteria | 1766 |
| 50 | Ga0070707_100010096 | 3300005468 | Bacteria | 8787 |
| 51 | Ga0070707_100040474 | 3300005468 | Bacteria | 4459 |
| 52 | Ga0070707_100054661 | 3300005468 | Bacteria | 3828 |
| 53 | Ga0070698_100009734 | 3300005471 | Bacteria | 10274 |
| 54 | Ga0070698_100020081 | 3300005471 | Bacteria | 7003 |
| 55 | Ga0070698_100057994 | 3300005471 | Bacteria | 3916 |
| 56 | Ga0070698_100148256 | 3300005471 | Bacteria | 2295 |
| 57 | Ga0070698_100409080 | 3300005471 | Bacteria | 1290 |
| 58 | Ga0070699_100000309 | 3300005518 | Bacteria | 47299 |
| 59 | Ga0070699_100028086 | 3300005518 | Bacteria | 4852 |
| 60 | Ga0070699_100062989 | 3300005518 | Bacteria | 3215 |
| 61 | Ga0070699_100114885 | 3300005518 | Bacteria | 2365 |
| 62 | Ga0070699_100330107 | 3300005518 | Bacteria | 1372 |
| 63 | Ga0070679_100006831 | 3300005530 | Bacteria | 10642 |
| 64 | Ga0070679_100016329 | 3300005530 | Bacteria | 7157 |
| 65 | Ga0070679_100030364 | 3300005530 | Bacteria | 5336 |
| 66 | Ga0070684_100030738 | 3300005535 | Bacteria | 4567 |
| 67 | Ga0070684_100084993 | 3300005535 | Bacteria | 2806 |
| 68 | Ga0070697_100037165 | 3300005536 | Bacteria | 3934 |
| 69 | Ga0070697_100331782 | 3300005536 | Bacteria | 1311 |
| 70 | Ga0068853_100007116 | 3300005539 | Bacteria | 8948 |
| 71 | Ga0068853_100108345 | 3300005539 | Bacteria | 2465 |
| 72 | Ga0070695_100001304 | 3300005545 | Bacteria | 13773 |
| 73 | Ga0070695_100015240 | 3300005545 | Bacteria | 4639 |
| 74 | Ga0070695_100017447 | 3300005545 | Bacteria | 4353 |
| 75 | Ga0070695_100020539 | 3300005545 | Bacteria | 4032 |
| 76 | Ga0070695_100069499 | 3300005545 | Bacteria | 2302 |
| 77 | Ga0070696_100012586 | 3300005546 | Bacteria | 5680 |
| 78 | Ga0070696_100013541 | 3300005546 | Bacteria | 5474 |
| 79 | Ga0070696_100052871 | 3300005546 | Bacteria | 2826 |
| 80 | Ga0070693_100000151 | 3300005547 | Bacteria | 31642 |
| 81 | Ga0070693_100104562 | 3300005547 | Bacteria | 1731 |
| 82 | Ga0070704_100001890 | 3300005549 | Bacteria | 11548 |
| 83 | Ga0070704_100002130 | 3300005549 | Bacteria | 11015 |
| 84 | Ga0070704_100002499 | 3300005549 | Bacteria | 10342 |
| 85 | Ga0070704_100003768 | 3300005549 | Bacteria | 8731 |
| 86 | Ga0068855_100035290 | 3300005563 | Bacteria | 5957 |
| 87 | Ga0070664_100085235 | 3300005564 | Bacteria | 2728 |
| 88 | Ga0068857_100195993 | 3300005577 | Bacteria | 1840 |
| 89 | Ga0068854_100015767 | 3300005578 | Bacteria | 5018 |
| 90 | Ga0068854_100022692 | 3300005578 | Bacteria | 4281 |
| 91 | Ga0068856_100006441 | 3300005614 | Bacteria | 11516 |
| 92 | Ga0070702_100157662 | 3300005615 | Bacteria | 1463 |
| 93 | Ga0070702_100278558 | 3300005615 | Bacteria | 1147 |
| 94 | Ga0068852_100073525 | 3300005616 | Bacteria | 3007 |
| 95 | Ga0068852_100440251 | 3300005616 | Bacteria | 1288 |
| 96 | Ga0068859_100008495 | 3300005617 | Bacteria | 10392 |
| 97 | Ga0068859_100039908 | 3300005617 | Bacteria | 4711 |
| 98 | Ga0068859_100093010 | 3300005617 | Bacteria | 3067 |
| 99 | Ga0068864_100007539 | 3300005618 | Bacteria | 8964 |
| 100 | Ga0068864_100119092 | 3300005618 | Bacteria | 2359 |
| 101 | Ga0068866_10009741 | 3300005718 | Bacteria | 4091 |
| 102 | Ga0068861_100001943 | 3300005719 | Bacteria | 13319 |
| 103 | Ga0068861_100016833 | 3300005719 | Bacteria | 5180 |
| 104 | Ga0068851_10027390 | 3300005834 | Bacteria | 2809 |
| 105 | Ga0068870_10003943 | 3300005840 | Bacteria | 6335 |
| 106 | Ga0068863_100003131 | 3300005841 | Bacteria | 16331 |
| 107 | Ga0068863_100009810 | 3300005841 | Bacteria | 9329 |
| 108 | Ga0068858_100001019 | 3300005842 | Bacteria | 28891 |
| 109 | Ga0068858_100258974 | 3300005842 | Bacteria | 1653 |
| 110 | Ga0068860_100000932 | 3300005843 | Bacteria | 32353 |
| 111 | Ga0068860_100014294 | 3300005843 | Bacteria | 7784 |
| 112 | Ga0068860_100040136 | 3300005843 | Bacteria | 4475 |
| 113 | Ga0068862_100030858 | 3300005844 | Bacteria | 4519 |
| 114 | Ga0081455_10000138 | 3300005937 | Bacteria | 85156 |
| 115 | Ga0081540_1000543 | 3300005983 | Bacteria | 36549 |
| 116 | Ga0081540_1006899 | 3300005983 | Bacteria | 8191 |
| 117 | Ga0081540_1008693 | 3300005983 | Bacteria | 7069 |
| 118 | Ga0081540_1022242 | 3300005983 | Bacteria | 3746 |
| 119 | Ga0081540_1094164 | 3300005983 | Bacteria | 1309 |
| 120 | Ga0081539_10000002 | 3300005985 | Bacteria | 601032 |
| 121 | Ga0081539_10062158 | 3300005985 | Bacteria | 2042 |
| 122 | Ga0070716_100001131 | 3300006173 | Bacteria | 11744 |
| 123 | Ga0070716_100027582 | 3300006173 | Bacteria | 3053 |
| 124 | Ga0068871_100026984 | 3300006358 | Bacteria | 4487 |
| 125 | Ga0075428_100000227 | 3300006844 | Bacteria | 54930 |
| 126 | Ga0075428_100058129 | 3300006844 | Bacteria | 4234 |
| 127 | Ga0075428_100098276 | 3300006844 | Bacteria | 3192 |
| 128 | Ga0075428_100102262 | 3300006844 | Bacteria | 3125 |
| 129 | Ga0075428_100442042 | 3300006844 | Bacteria | 1393 |
| 130 | Ga0075430_100000307 | 3300006846 | Bacteria | 34681 |
| 131 | Ga0075430_100005095 | 3300006846 | Bacteria | 11056 |
| 132 | Ga0075430_100031603 | 3300006846 | Bacteria | 4493 |
| 133 | Ga0075430_100117832 | 3300006846 | Bacteria | 2213 |
| 134 | Ga0075431_100000049 | 3300006847 | Bacteria | 63960 |
| 135 | Ga0075431_100000414 | 3300006847 | Bacteria | 34710 |
| 136 | Ga0075431_100005700 | 3300006847 | Bacteria | 12306 |
| 137 | Ga0075431_100025974 | 3300006847 | Bacteria | 6003 |
| 138 | Ga0075431_100026093 | 3300006847 | Bacteria | 5991 |
| 139 | Ga0075431_100196809 | 3300006847 | Bacteria | 2063 |
| 140 | Ga0075431_100517045 | 3300006847 | Bacteria | 1183 |
| 141 | Ga0075433_10008156 | 3300006852 | Bacteria | 8341 |
| 142 | Ga0075433_10020195 | 3300006852 | Bacteria | 5565 |
| 143 | Ga0075433_10087235 | 3300006852 | Bacteria | 2756 |
| 144 | Ga0075433_10139106 | 3300006852 | Bacteria | 2158 |
| 145 | Ga0075433_10149641 | 3300006852 | Bacteria | 2076 |
| 146 | Ga0075434_100007335 | 3300006871 | Bacteria | 10205 |
| 147 | Ga0075434_100030642 | 3300006871 | Bacteria | 5298 |
| 148 | Ga0075434_100032026 | 3300006871 | Bacteria | 5183 |
| 149 | Ga0075434_100080138 | 3300006871 | Bacteria | 3261 |
| 150 | Ga0075434_100084090 | 3300006871 | Bacteria | 3181 |
| 151 | Ga0075429_100000032 | 3300006880 | Bacteria | 64062 |
| 152 | Ga0075429_100000080 | 3300006880 | Bacteria | 49555 |
| 153 | Ga0075429_100045351 | 3300006880 | Bacteria | 3825 |
| 154 | Ga0075429_100130750 | 3300006880 | Bacteria | 2196 |
| 155 | Ga0068865_100072769 | 3300006881 | Bacteria | 2442 |
| 156 | Ga0075436_100024505 | 3300006914 | Bacteria | 4147 |
| 157 | Ga0075436_100050078 | 3300006914 | Bacteria | 2882 |
| 158 | Ga0075436_100079284 | 3300006914 | Bacteria | 2275 |
| 159 | Ga0075436_100136418 | 3300006914 | Bacteria | 1723 |
| 160 | Ga0097620_100008495 | 3300006931 | Bacteria | 10392 |
| 161 | Ga0097620_100039908 | 3300006931 | Bacteria | 4711 |
| 162 | Ga0097620_100093016 | 3300006931 | Bacteria | 3067 |
| 163 | Ga0075435_100016916 | 3300007076 | Bacteria | 5506 |
| 164 | Ga0075435_100032114 | 3300007076 | Bacteria | 4144 |
| 165 | Ga0075435_100040810 | 3300007076 | Bacteria | 3707 |
| 166 | Ga0075435_100056712 | 3300007076 | Bacteria | 3167 |
| 167 | Ga0075435_100074962 | 3300007076 | Bacteria | 2769 |
| 168 | Ga0075435_100102142 | 3300007076 | Bacteria | 2376 |
| 169 | Ga0075435_100153526 | 3300007076 | Bacteria | 1937 |
| 170 | Ga0075435_100245671 | 3300007076 | Bacteria | 1523 |
| 171 | Ga0099794_10066651 | 3300007265 | Bacteria | 1757 |
| 172 | Ga0099794_10147116 | 3300007265 | Bacteria | 1195 |
| 173 | Ga0099794_10172291 | 3300007265 | Bacteria | 1103 |
| 174 | Ga0099794_10187721 | 3300007265 | Bacteria | 1056 |
| 175 | Ga0105240_10010045 | 3300009093 | Bacteria | 13330 |
| 176 | Ga0105240_10570672 | 3300009093 | Bacteria | 1249 |
| 177 | Ga0105240_10578691 | 3300009093 | Bacteria | 1239 |
| 178 | Ga0111539_10037354 | 3300009094 | Bacteria | 5865 |
| 179 | Ga0111539_10125193 | 3300009094 | Bacteria | 3012 |
| 180 | Ga0111539_10624416 | 3300009094 | Bacteria | 1255 |
| 181 | Ga0114129_10000479 | 3300009147 | Bacteria | 48277 |
| 182 | Ga0114129_10002723 | 3300009147 | Bacteria | 24628 |
| 183 | Ga0114129_10005731 | 3300009147 | Bacteria | 17601 |
| 184 | Ga0114129_10028104 | 3300009147 | Bacteria | 7968 |
| 185 | Ga0114129_10034512 | 3300009147 | Bacteria | 7146 |
| 186 | Ga0114129_10038302 | 3300009147 | Bacteria | 6764 |
| 187 | Ga0114129_10043947 | 3300009147 | Bacteria | 6285 |
| 188 | Ga0114129_10056587 | 3300009147 | Bacteria | 5492 |
| 189 | Ga0114129_10157112 | 3300009147 | Bacteria | 3109 |
| 190 | Ga0114129_10306203 | 3300009147 | Bacteria | 2116 |
| 191 | Ga0114129_10421519 | 3300009147 | Bacteria | 1755 |
| 192 | Ga0114129_10547089 | 3300009147 | Bacteria | 1506 |
| 193 | Ga0105241_10001720 | 3300009174 | Bacteria | 16652 |
| 194 | Ga0105248_10143623 | 3300009177 | Bacteria | 2693 |
| 195 | Ga0105248_10282859 | 3300009177 | Bacteria | 1867 |
| 196 | Ga0105248_10562011 | 3300009177 | Bacteria | 1287 |
| 197 | Ga0105238_10022379 | 3300009551 | Bacteria | 6441 |
| 198 | Ga0157373_10001536 | 3300013100 | Bacteria | 17616 |
| 199 | Ga0157370_10031729 | 3300013104 | Bacteria | 5165 |
| 200 | Ga0157370_10175127 | 3300013104 | Bacteria | 1994 |
| 201 | Ga0157378_10428147 | 3300013297 | Bacteria | 1309 |
| 202 | Ga0157372_10008094 | 3300013307 | Bacteria | 11181 |
| 203 | Ga0157372_10075034 | 3300013307 | Bacteria | 3814 |
| 204 | Ga0157380_10026243 | 3300014326 | Bacteria | 4422 |
| 205 | Ga0157380_10117120 | 3300014326 | Bacteria | 2250 |
| 206 | Ga0157380_10330684 | 3300014326 | Bacteria | 1417 |
| 207 | Ga0182008_10119018 | 3300014497 | Bacteria | 1312 |
| 208 | Ga0157379_10042544 | 3300014968 | Bacteria | 4056 |
| 209 | Ga0213874_10028151 | 3300021377 | Bacteria | 1604 |
| 210 | Ga0209025_1047681 | 3300025294 | Bacteria | 1746 |
| 211 | Ga0207656_10057804 | 3300025321 | Bacteria | 1693 |
| 212 | Ga0207653_10008663 | 3300025885 | Bacteria | 3173 |
| 213 | Ga0207688_10107031 | 3300025901 | Bacteria | 1620 |
| 214 | Ga0207680_10002621 | 3300025903 | Bacteria | 8397 |
| 215 | Ga0207685_10041883 | 3300025905 | Bacteria | 1716 |
| 216 | Ga0207699_10204338 | 3300025906 | Bacteria | 1340 |
| 217 | Ga0207645_10000858 | 3300025907 | Bacteria | 25253 |
| 218 | Ga0207645_10001649 | 3300025907 | Bacteria | 18179 |
| 219 | Ga0207643_10001314 | 3300025908 | Bacteria | 14435 |
| 220 | Ga0207684_10000105 | 3300025910 | Bacteria | 160905 |
| 221 | Ga0207684_10127474 | 3300025910 | Bacteria | 2184 |
| 222 | Ga0207684_10129732 | 3300025910 | Bacteria | 2164 |
| 223 | Ga0207684_10287016 | 3300025910 | Bacteria | 1419 |
| 224 | Ga0207684_10343765 | 3300025910 | Bacteria | 1285 |
| 225 | Ga0207707_10000169 | 3300025912 | Bacteria | 68558 |
| 226 | Ga0207707_10038106 | 3300025912 | Bacteria | 4200 |
| 227 | Ga0207707_10055003 | 3300025912 | Bacteria | 3463 |
| 228 | Ga0207695_10086041 | 3300025913 | Bacteria | 3171 |
| 229 | Ga0207695_10396238 | 3300025913 | Bacteria | 1265 |
| 230 | Ga0207693_10059818 | 3300025915 | Bacteria | 2985 |
| 231 | Ga0207693_10060239 | 3300025915 | Bacteria | 2973 |
| 232 | Ga0207660_10000853 | 3300025917 | Bacteria | 20092 |
| 233 | Ga0207660_10016991 | 3300025917 | Bacteria | 4827 |
| 234 | Ga0207660_10026389 | 3300025917 | Bacteria | 3956 |
| 235 | Ga0207660_10108347 | 3300025917 | Bacteria | 2086 |
| 236 | Ga0207662_10025200 | 3300025918 | Bacteria | 3425 |
| 237 | Ga0207657_10000230 | 3300025919 | Bacteria | 58597 |
| 238 | Ga0207649_10003044 | 3300025920 | Bacteria | 9231 |
| 239 | Ga0207649_10010768 | 3300025920 | Bacteria | 5028 |
| 240 | Ga0207652_10000263 | 3300025921 | Bacteria | 54913 |
| 241 | Ga0207652_10309299 | 3300025921 | Bacteria | 1426 |
| 242 | Ga0207652_10442620 | 3300025921 | Bacteria | 1171 |
| 243 | Ga0207646_10028308 | 3300025922 | Bacteria | 5102 |
| 244 | Ga0207646_10029644 | 3300025922 | Bacteria | 4969 |
| 245 | Ga0207646_10049095 | 3300025922 | Bacteria | 3780 |
| 246 | Ga0207646_10230967 | 3300025922 | Bacteria | 1671 |
| 247 | Ga0207681_10000549 | 3300025923 | Bacteria | 25898 |
| 248 | Ga0207650_10003760 | 3300025925 | Bacteria | 10378 |
| 249 | Ga0207659_10166304 | 3300025926 | Bacteria | 1736 |
| 250 | Ga0207659_10271704 | 3300025926 | Bacteria | 1383 |
| 251 | Ga0207687_10018259 | 3300025927 | Bacteria | 4628 |
| 252 | Ga0207700_10310263 | 3300025928 | Bacteria | 1364 |
| 253 | Ga0207690_10002921 | 3300025932 | Bacteria | 10300 |
| 254 | Ga0207706_10010067 | 3300025933 | Bacteria | 8659 |
| 255 | Ga0207709_10164113 | 3300025935 | Bacteria | 1552 |
| 256 | Ga0207670_10154874 | 3300025936 | Bacteria | 1705 |
| 257 | Ga0207670_10265708 | 3300025936 | Bacteria | 1332 |
| 258 | Ga0207704_10003465 | 3300025938 | Bacteria | 7174 |
| 259 | Ga0207704_10065568 | 3300025938 | Bacteria | 2274 |
| 260 | Ga0207711_10049449 | 3300025941 | Bacteria | 3600 |
| 261 | Ga0207689_10000006 | 3300025942 | Bacteria | 133746 |
| 262 | Ga0207689_10001671 | 3300025942 | Bacteria | 21060 |
| 263 | Ga0207689_10005014 | 3300025942 | Bacteria | 11926 |
| 264 | Ga0207661_10038163 | 3300025944 | Bacteria | 3762 |
| 265 | Ga0207661_10456742 | 3300025944 | Bacteria | 1164 |
| 266 | Ga0207679_10001904 | 3300025945 | Bacteria | 12958 |
| 267 | Ga0207679_10038287 | 3300025945 | Bacteria | 3415 |
| 268 | Ga0207667_10010274 | 3300025949 | Bacteria | 10956 |
| 269 | Ga0207667_10104934 | 3300025949 | Bacteria | 2915 |
| 270 | Ga0207712_10001342 | 3300025961 | Bacteria | 16857 |
| 271 | Ga0207658_10000522 | 3300025986 | Bacteria | 35086 |
| 272 | Ga0207703_10000176 | 3300026035 | Bacteria | 74238 |
| 273 | Ga0207703_10009198 | 3300026035 | Bacteria | 7769 |
| 274 | Ga0207703_10361750 | 3300026035 | Bacteria | 1338 |
| 275 | Ga0207639_10009451 | 3300026041 | Bacteria | 6728 |
| 276 | Ga0207639_10061917 | 3300026041 | Bacteria | 2892 |
| 277 | Ga0207678_10112224 | 3300026067 | Bacteria | 2325 |
| 278 | Ga0207708_10043236 | 3300026075 | Bacteria | 3434 |
| 279 | Ga0207708_10185384 | 3300026075 | Bacteria | 1653 |
| 280 | Ga0207708_10274130 | 3300026075 | Bacteria | 1365 |
| 281 | Ga0207702_10003271 | 3300026078 | Bacteria | 14957 |
| 282 | Ga0207702_10039619 | 3300026078 | Bacteria | 3950 |
| 283 | Ga0207641_10004166 | 3300026088 | Bacteria | 12600 |
| 284 | Ga0207648_10121943 | 3300026089 | Bacteria | 2292 |
| 285 | Ga0207648_10158257 | 3300026089 | Bacteria | 2000 |
| 286 | Ga0207676_10008475 | 3300026095 | Bacteria | 7310 |
| 287 | Ga0207676_10068770 | 3300026095 | Bacteria | 2834 |
| 288 | Ga0207674_10183266 | 3300026116 | Bacteria | 2045 |
| 289 | Ga0207675_100000483 | 3300026118 | Bacteria | 38723 |
| 290 | Ga0207675_100031776 | 3300026118 | Bacteria | 4918 |
| 291 | Ga0207698_10016249 | 3300026142 | Bacteria | 5012 |
| 292 | Ga0209984_1000895 | 3300027424 | Bacteria | 3189 |
| 293 | Ga0209995_1000412 | 3300027471 | Bacteria | 6646 |
| 294 | Ga0209968_1001582 | 3300027526 | Bacteria | 3446 |
| 295 | Ga0209970_1000985 | 3300027614 | Bacteria | 5065 |
| 296 | Ga0209983_1000242 | 3300027665 | Bacteria | 11097 |
| 297 | Ga0209971_1000034 | 3300027682 | Bacteria | 47898 |
| 298 | Ga0209966_1000109 | 3300027695 | Bacteria | 36391 |
| 299 | Ga0209998_10000010 | 3300027717 | Bacteria | 98452 |
| 300 | Ga0209998_10032290 | 3300027717 | Bacteria | 1163 |
| 301 | Ga0209974_10001764 | 3300027876 | Bacteria | 7885 |
| 302 | Ga0209974_10027690 | 3300027876 | Bacteria | 1875 |
| 303 | Ga0207428_10013876 | 3300027907 | Bacteria | 7018 |
| 304 | Ga0268265_10002714 | 3300028380 | Bacteria | 13103 |
| 305 | Ga0268265_10082636 | 3300028380 | Bacteria | 2540 |
| 306 | Ga0268265_10189844 | 3300028380 | Bacteria | 1773 |
| 307 | Ga0268264_10000951 | 3300028381 | Bacteria | 29911 |
| 308 | Ga0268264_10074115 | 3300028381 | Bacteria | 2890 |
| 309 | Ga0265325_10125297 | 3300031241 | Bacteria | 1235 |
| 310 | Ga0265340_10014560 | 3300031247 | Bacteria | 4104 |
| 311 | Ga0307509_10198022 | 3300031507 | Bacteria | 1850 |
| 312 | Ga0307408_100090312 | 3300031548 | Bacteria | 2311 |
| 313 | Ga0307408_100149550 | 3300031548 | Bacteria | 1842 |
| 314 | Ga0265314_10000822 | 3300031711 | Bacteria | 36961 |
| 315 | Ga0265342_10085635 | 3300031712 | Bacteria | 1813 |
| 316 | Ga0307516_10072372 | 3300031730 | Bacteria | 3307 |
| 317 | Ga0307405_10200194 | 3300031731 | Bacteria | 1450 |
| 318 | Ga0307413_10119711 | 3300031824 | Bacteria | 1781 |
| 319 | Ga0307406_10119893 | 3300031901 | Bacteria | 1827 |
| 320 | Ga0307412_10362663 | 3300031911 | Bacteria | 1167 |
| 321 | Ga0307416_100004427 | 3300032002 | Bacteria | 8466 |
| 322 | Ga0307416_100274746 | 3300032002 | Bacteria | 1657 |
| 323 | Ga0307510_10063262 | 3300033180 | Bacteria | 3770 |
| 324 | Ga0373934_0001390 | 3300035086 | Bacteria | 8823 |
| 325 | Ga0373949_0017211 | 3300035090 | Bacteria | 1627 |
| 326 | Ga0373932_0059866 | 3300035112 | Bacteria | 1154 |
| 327 | Ga0373936_0094211 | 3300035113 | Bacteria | 1258 |
| 328 | Ga0373939_0071043 | 3300035114 | Bacteria | 1133 |
| 329 | Ga0373953_0000426 | 3300035117 | Bacteria | 11483 |
| 330 | Ga0373954_0000139 | 3300035118 | Bacteria | 25320 |
| 331 | Ga0373956_0001236 | 3300035119 | Bacteria | 10570 |
| 332 | Ga0373957_0054999 | 3300035120 | Bacteria | 1529 |
| 333 | Ga0373960_0089920 | 3300035121 | Bacteria | 980 |
| 334 | Ga0373943_0036609 | 3300035170 | Bacteria | 2351 |
| 335 | Ga0373955_0000597 | 3300035172 | Bacteria | 15391 |
| 336 | Ga0373961_0017716 | 3300035241 | Bacteria | 1852 |
| 337 | Ga0373962_0055380 | 3300035242 | Bacteria | 1152 |
| 338 | Ga0373924_0012050 | 3300035410 | Bacteria | 3223 |
| 339 | Ga0373931_0002948 | 3300035691 | Bacteria | 7596 |
| 340 | Ga0373931_0012972 | 3300035691 | Bacteria | 4047 |
| 341 | Ga0373931_0038630 | 3300035691 | Bacteria | 2498 |
| 342 | Ga0373935_0249287 | 3300035692 | Bacteria | 1242 |
| 343 | Ga0373927_0007782 | 3300035695 | Bacteria | 7249 |
| 344 | Ga0373927_0014475 | 3300035695 | Bacteria | 5219 |
| 345 | Ga0373933_0000483 | 3300035724 | Bacteria | 24839 |
| 346 | Ga0373925_0045346 | 3300037068 | Bacteria | 3266 |
| 347 | Ga0373925_0135517 | 3300037068 | Bacteria | 1924 |
| 348 | Ga0395899_0009056 | 3300037312 | Bacteria | 7651 |
| 349 | Ga0395900_0008032 | 3300037418 | Bacteria | 10861 |
| 350 | Ga0395900_0012079 | 3300037418 | Bacteria | 8825 |
| 351 | Ga0395898_0001503 | 3300037466 | Bacteria | 32214 |
| 352 | Ga0395898_0172039 | 3300037466 | Bacteria | 2070 |
| 353 | Ga0395901_0020242 | 3300038443 | Bacteria | 6811 |
| 354 | Ga0395901_0274140 | 3300038443 | Bacteria | 1754 |
| 355 | Ga0436365_0212285 | 3300039437 | Bacteria | 5469 |
| 356 | Ga0436365_0821657 | 3300039437 | Bacteria | 2351 |
| 357 | Ga0436362_1210859 | 3300039453 | Bacteria | 4461 |
| 358 | Ga0439431_0002062 | 3300041997 | Bacteria | 4448 |
| 359 | Ga0439448_0000296 | 3300042005 | Bacteria | 10945 |
| 360 | Ga0439448_0010675 | 3300042005 | Bacteria | 2727 |
| 361 | Ga0439455_0044582 | 3300042012 | Bacteria | 1144 |
| 362 | Ga0450919_004622 | 3300042121 | Bacteria | 1678 |
| 363 | Ga0439435_0005572 | 3300042436 | Bacteria | 2776 |
| 364 | Ga0439459_0000355 | 3300042438 | Bacteria | 5651 |
| 365 | Ga0439464_0007748 | 3300042439 | Bacteria | 2810 |
| 366 | Ga0439460_0002563 | 3300042461 | Bacteria | 4386 |
| 367 | Ga0439460_0025397 | 3300042461 | Bacteria | 1649 |
| 368 | Ga0451577_0053645 | 3300042876 | Bacteria | 3598 |
| 369 | Ga0451577_0095818 | 3300042876 | Bacteria | 2650 |
| 370 | Ga0466972_0000124 | 3300044658 | Bacteria | 65163 |
| 371 | Ga0453683_0173520 | 3300044673 | Bacteria | 1366 |
| 372 | Ga0453683_0286187 | 3300044673 | Bacteria | 1053 |
| 373 | Ga0451576_0077245 | 3300045051 | Bacteria | 3465 |
| 374 | Ga0451576_0083244 | 3300045051 | Bacteria | 3328 |
| 375 | Ga0451576_0141592 | 3300045051 | Bacteria | 2507 |
| 376 | Ga0451576_0235333 | 3300045051 | Bacteria | 1913 |
| 377 | Ga0495592_0001466 | 3300046454 | Bacteria | 16413 |
| 378 | Ga0495603_0025030 | 3300046455 | Bacteria | 3610 |
| 379 | Ga0495629_0000548 | 3300046459 | Bacteria | 30813 |
| 380 | Ga0495651_0003160 | 3300046462 | Bacteria | 12682 |
| 381 | Ga0495653_0000621 | 3300046463 | Bacteria | 27177 |
| 382 | Ga0495580_0000443 | 3300046472 | Bacteria | 34172 |
| 383 | Ga0495594_0183542 | 3300046499 | Bacteria | 1191 |
| 384 | Ga0495608_0002190 | 3300046511 | Bacteria | 14104 |
| 385 | Ga0495618_0139786 | 3300046514 | Bacteria | 1549 |
| 386 | Ga0495628_0018073 | 3300046516 | Bacteria | 5847 |
| 387 | Ga0495648_0106702 | 3300046524 | Bacteria | 1533 |
| 388 | Ga0495642_0044113 | 3300046528 | Bacteria | 1820 |
| 389 | Ga0495652_0005425 | 3300046529 | Bacteria | 12014 |
| 390 | Ga0495640_0008049 | 3300046533 | Bacteria | 8283 |
| 391 | Ga0495587_0001777 | 3300046536 | Bacteria | 14419 |
| 392 | Ga0495645_0055831 | 3300046543 | Bacteria | 2867 |
| 393 | Ga0495667_0000853 | 3300046559 | Bacteria | 19711 |
| 394 | Ga0495634_0008025 | 3300046642 | Bacteria | 7880 |
| 395 | Ga0495635_0000485 | 3300046663 | Bacteria | 25077 |
| 396 | Ga0495657_0004077 | 3300046675 | Bacteria | 11715 |
| 397 | Ga0495599_0000942 | 3300046678 | Bacteria | 16269 |
| 398 | Ga0495623_0015435 | 3300046679 | Bacteria | 4937 |
| 399 | Ga0495646_0013023 | 3300046680 | Bacteria | 5288 |
| 400 | Ga0495613_0117506 | 3300046689 | Bacteria | 1912 |
| 401 | Ga0495600_0002111 | 3300046809 | Bacteria | 11243 |
| 402 | Ga0495604_0003566 | 3300047317 | Bacteria | 12406 |
| 403 | Ga0495674_0054183 | 3300047319 | Bacteria | 3523 |
| 404 | Ga0495680_0001218 | 3300047322 | Bacteria | 28201 |
| 405 | Ga0495675_0000987 | 3300047444 | Bacteria | 17273 |
| 406 | Ga0495684_0001700 | 3300047471 | Bacteria | 17689 |
| 407 | Ga0495593_0006674 | 3300047673 | Bacteria | 6754 |
| 408 | Ga0495602_0035011 | 3300048088 | Bacteria | 4687 |
| 409 | Ga0496102_0081173 | 3300048905 | Bacteria | 2989 |
| 410 | Ga0496102_0632047 | 3300048905 | Bacteria | 994 |
| 411 | Ga0496106_0341759 | 3300048909 | Bacteria | 1202 |
| 412 | Ga0496107_0192028 | 3300048910 | Bacteria | 1517 |
| 413 | Ga0496108_0051908 | 3300048911 | Bacteria | 3435 |
| 414 | Ga0496110_0197959 | 3300048913 | Bacteria | 1825 |
| 415 | Ga0501031_0023681 | 3300049568 | Bacteria | 4002 |
| 416 | Ga0501031_0141746 | 3300049568 | Bacteria | 1571 |
| 417 | Ga0501031_0209678 | 3300049568 | Bacteria | 1270 |
| 418 | Ga0501032_0090473 | 3300049569 | Bacteria | 2031 |
| 419 | Ga0501033_0151829 | 3300049570 | Bacteria | 1671 |
| 420 | Ga0501034_0048692 | 3300049571 | Bacteria | 4277 |
| 421 | Ga0501036_0002690 | 3300049572 | Bacteria | 14026 |
| 422 | Ga0501036_0325849 | 3300049572 | Bacteria | 1283 |
| 423 | Ga0501038_0052165 | 3300049574 | Bacteria | 3527 |
| 424 | Ga0501038_0068158 | 3300049574 | Bacteria | 3025 |
| 425 | Ga0501038_0093353 | 3300049574 | Bacteria | 2518 |
| 426 | Ga0501038_0181327 | 3300049574 | Bacteria | 1699 |
| 427 | Ga0501039_0036427 | 3300049575 | Bacteria | 3797 |
| 428 | Ga0501039_0088078 | 3300049575 | Bacteria | 2419 |
| 429 | Ga0501039_0099966 | 3300049575 | Bacteria | 2264 |
| 430 | Ga0501039_0144931 | 3300049575 | Bacteria | 1866 |
| 431 | Ga0501040_0001684 | 3300049576 | Bacteria | 14163 |
| 432 | Ga0501040_0005541 | 3300049576 | Bacteria | 8172 |
| 433 | Ga0501040_0180246 | 3300049576 | Bacteria | 1497 |
| 434 | Ga0501040_0358115 | 3300049576 | Bacteria | 1045 |
| 435 | Ga0501041_0010986 | 3300049577 | Bacteria | 5346 |
| 436 | Ga0501041_0056990 | 3300049577 | Bacteria | 2388 |
| 437 | Ga0501041_0083457 | 3300049577 | Bacteria | 1969 |
| 438 | Ga0501041_0224906 | 3300049577 | Bacteria | 1178 |
| 439 | Ga0501042_0017554 | 3300049578 | Bacteria | 4937 |
| 440 | Ga0501042_0059310 | 3300049578 | Bacteria | 2732 |
| 441 | Ga0501042_0095214 | 3300049578 | Bacteria | 2139 |
| 442 | Ga0501042_0260962 | 3300049578 | Bacteria | 1251 |
| 443 | Ga0501046_0000455 | 3300049580 | Bacteria | 40945 |
| 444 | Ga0501046_0002560 | 3300049580 | Bacteria | 17018 |
| 445 | Ga0501046_0007294 | 3300049580 | Bacteria | 9725 |
| 446 | Ga0501046_0129135 | 3300049580 | Bacteria | 1917 |
| 447 | Ga0501048_0001071 | 3300049582 | Bacteria | 20517 |
| 448 | Ga0501048_0021169 | 3300049582 | Bacteria | 4761 |
| 449 | Ga0501048_0068168 | 3300049582 | Bacteria | 2514 |
| 450 | Ga0501048_0077516 | 3300049582 | Bacteria | 2346 |
| 451 | Ga0501048_0147363 | 3300049582 | Bacteria | 1665 |
| 452 | Ga0501068_0022873 | 3300049584 | Bacteria | 3659 |
| 453 | Ga0501068_0023945 | 3300049584 | Bacteria | 3581 |
| 454 | Ga0501068_0043184 | 3300049584 | Bacteria | 2712 |
| 455 | Ga0501068_0130594 | 3300049584 | Bacteria | 1571 |
| 456 | Ga0501069_0069463 | 3300049585 | Bacteria | 1972 |
| 457 | Ga0501070_0034376 | 3300049586 | Bacteria | 4239 |
| 458 | Ga0501070_0460725 | 3300049586 | Bacteria | 1024 |
| 459 | Ga0501071_0003914 | 3300049587 | Bacteria | 9384 |
| 460 | Ga0501071_0038668 | 3300049587 | Bacteria | 3410 |
| 461 | Ga0501071_0081863 | 3300049587 | Bacteria | 2363 |
| 462 | Ga0501071_0097418 | 3300049587 | Bacteria | 2166 |
| 463 | Ga0501072_0033613 | 3300049588 | Bacteria | 4019 |
| 464 | Ga0501072_0136212 | 3300049588 | Bacteria | 1957 |
| 465 | Ga0501074_0001262 | 3300049590 | Bacteria | 16710 |
| 466 | Ga0501074_0047869 | 3300049590 | Bacteria | 3089 |
| 467 | Ga0501074_0173014 | 3300049590 | Bacteria | 1541 |
| 468 | Ga0501075_0005080 | 3300049591 | Bacteria | 8991 |
| 469 | Ga0501075_0054298 | 3300049591 | Bacteria | 3014 |
| 470 | Ga0501075_0173363 | 3300049591 | Bacteria | 1646 |
| 471 | Ga0501076_0001859 | 3300049592 | Bacteria | 14371 |
| 472 | Ga0501076_0002358 | 3300049592 | Bacteria | 12926 |
| 473 | Ga0501076_0015860 | 3300049592 | Bacteria | 5701 |
| 474 | Ga0501076_0052572 | 3300049592 | Bacteria | 3227 |
| 475 | Ga0501076_0126721 | 3300049592 | Bacteria | 2069 |
| 476 | Ga0501076_0321171 | 3300049592 | Bacteria | 1270 |
| 477 | Ga0501077_0020850 | 3300049593 | Bacteria | 4149 |
| 478 | Ga0501077_0027843 | 3300049593 | Bacteria | 3589 |
| 479 | Ga0501077_0034917 | 3300049593 | Bacteria | 3201 |
| 480 | Ga0501077_0049259 | 3300049593 | Bacteria | 2678 |
| 481 | Ga0501077_0096397 | 3300049593 | Bacteria | 1875 |
| 482 | Ga0501077_0155376 | 3300049593 | Bacteria | 1452 |
| 483 | Ga0501077_0183364 | 3300049593 | Bacteria | 1330 |
| 484 | Ga0501077_0185949 | 3300049593 | Bacteria | 1320 |
| 485 | Ga0501079_0003697 | 3300049741 | Bacteria | 11280 |
| 486 | Ga0501079_0005279 | 3300049741 | Bacteria | 9608 |
| 487 | Ga0501079_0033373 | 3300049741 | Bacteria | 3959 |
| 488 | Ga0501079_0229362 | 3300049741 | Bacteria | 1451 |
| 489 | Ga0501080_0003420 | 3300049742 | Bacteria | 14000 |
| 490 | Ga0501080_0248240 | 3300049742 | Bacteria | 1623 |
| 491 | Ga0501081_0000283 | 3300049743 | Bacteria | 26838 |
| 492 | Ga0501081_0000778 | 3300049743 | Bacteria | 18695 |
| 493 | Ga0501081_0002562 | 3300049743 | Bacteria | 11477 |
| 494 | Ga0501081_0009596 | 3300049743 | Bacteria | 6312 |
| 495 | Ga0501081_0051141 | 3300049743 | Bacteria | 2849 |
| 496 | Ga0501081_0071185 | 3300049743 | Bacteria | 2424 |
| 497 | Ga0501081_0108144 | 3300049743 | Bacteria | 1972 |
| 498 | Ga0501081_0303575 | 3300049743 | Bacteria | 1171 |
| 499 | Ga0501083_0018129 | 3300049744 | Bacteria | 4907 |
| 500 | Ga0501083_0080109 | 3300049744 | Bacteria | 2166 |
| 501 | Ga0501083_0096551 | 3300049744 | Bacteria | 1950 |
| 502 | Ga0501083_0104628 | 3300049744 | Bacteria | 1865 |
| 503 | Ga0501035_0229657 | 3300049822 | Bacteria | 1582 |
| 504 | Ga0501044_0079300 | 3300049823 | Bacteria | 3327 |
| 505 | Ga0501045_0000268 | 3300049824 | Bacteria | 30295 |
| 506 | Ga0501045_0002468 | 3300049824 | Bacteria | 12569 |
| 507 | Ga0501045_0063021 | 3300049824 | Bacteria | 2720 |
| 508 | Ga0501045_0063103 | 3300049824 | Bacteria | 2718 |
| 509 | Ga0501045_0064879 | 3300049824 | Bacteria | 2681 |
| 510 | Ga0501045_0315466 | 3300049824 | Bacteria | 1163 |
| 511 | Ga0501045_0377558 | 3300049824 | Bacteria | 1055 |
| 512 | nmdc:mga05p37_18189_c1 | 3300050507 | Bacteria | 8491 |
| 513 | nmdc:mga05p37_18838_c1 | 3300050507 | Bacteria | 8342 |
| 514 | nmdc:mga05p37_26343_c1 | 3300050507 | Bacteria | 7072 |
| 515 | nmdc:mga05p37_30562_c1 | 3300050507 | Bacteria | 6572 |
| 516 | nmdc:mga05p37_34635_c1 | 3300050507 | Bacteria | 6186 |
| 517 | nmdc:mga05p37_3869_c1 | 3300050507 | Bacteria | 17511 |
| 518 | nmdc:mga05p37_421095_c1 | 3300050507 | Bacteria | 1554 |
| 519 | nmdc:mga05p37_45318_c1 | 3300050507 | Bacteria | 5410 |
| 520 | nmdc:mga05p37_4953_c1 | 3300050507 | Bacteria | 15605 |
| 521 | nmdc:mga05p37_5718_c1 | 3300050507 | Bacteria | 14629 |
| 522 | nmdc:mga05p37_62965_c1 | 3300050507 | Bacteria | 4565 |
| 523 | nmdc:mga05p37_803_c1 | 3300050507 | Bacteria | 35042 |
| 524 | nmdc:mga05p37_9142_c1 | 3300050507 | Bacteria | 11715 |
| 525 | nmdc:mga09592_121178_c1 | 3300050508 | Bacteria | 2247 |
| 526 | nmdc:mga09592_19019_c1 | 3300050508 | Bacteria | 5637 |
| 527 | nmdc:mga09592_44_c1 | 3300050508 | Bacteria | 69981 |
| 528 | nmdc:mga09592_95622_c1 | 3300050508 | Bacteria | 2541 |
| 529 | nmdc:mga0qj67_3320_c1 | 3300050509 | Bacteria | 11598 |
| 530 | nmdc:mga0qj67_7226_c1 | 3300050509 | Bacteria | 8203 |
| 531 | nmdc:mga0qj67_99141_c1 | 3300050509 | Bacteria | 2347 |
| 532 | nmdc:mga06r32_101066_c1 | 3300050510 | Bacteria | 2830 |
| 533 | nmdc:mga06r32_104585_c1 | 3300050510 | Bacteria | 2781 |
| 534 | nmdc:mga06r32_3922_c1 | 3300050510 | Bacteria | 13341 |
| 535 | nmdc:mga06r32_7269_c2 | 3300050510 | Bacteria | 5791 |
| 536 | nmdc:mga08y16_19461_c1 | 3300050511 | Bacteria | 6151 |
| 537 | nmdc:mga08y16_616723_c1 | 3300050511 | Bacteria | 1092 |
| 538 | nmdc:mga0n895_139393_c1 | 3300050512 | Bacteria | 2453 |
| 539 | nmdc:mga0n895_153208_c1 | 3300050512 | Bacteria | 2336 |
| 540 | nmdc:mga0n895_215906_c1 | 3300050512 | Bacteria | 1948 |
| 541 | nmdc:mga0n895_33637_c1 | 3300050512 | Bacteria | 4929 |
| 542 | nmdc:mga0n895_36011_c1 | 3300050512 | Bacteria | 4776 |
| 543 | nmdc:mga0n895_5041_c1 | 3300050512 | Bacteria | 10964 |
| 544 | nmdc:mga0n895_52844_c1 | 3300050512 | Bacteria | 3990 |
| 545 | nmdc:mga0rr50_113522_c1 | 3300050513 | Bacteria | 2147 |
| 546 | nmdc:mga0rr50_1492_c1 | 3300050513 | Bacteria | 12851 |
| 547 | nmdc:mga0rr50_16374_c1 | 3300050513 | Bacteria | 4923 |
| 548 | nmdc:mga0rr50_25001_c1 | 3300050513 | Bacteria | 4147 |
| 549 | nmdc:mga0rr50_47184_c1 | 3300050513 | Bacteria | 3176 |
| 550 | nmdc:mga0rr50_71815_c1 | 3300050513 | Bacteria | 2642 |
| 551 | nmdc:mga0rr50_84476_c1 | 3300050513 | Bacteria | 2458 |
| 552 | nmdc:mga08x19_16628_c1 | 3300050514 | Bacteria | 4489 |
| 553 | nmdc:mga08x19_22684_c1 | 3300050514 | Bacteria | 3887 |
| 554 | nmdc:mga08x19_67844_c1 | 3300050514 | Bacteria | 2321 |
| 555 | nmdc:mga0a205_118610_c2 | 3300050515 | Bacteria | 1543 |
| 556 | nmdc:mga0a205_126690_c1 | 3300050515 | Bacteria | 2126 |
| 557 | nmdc:mga0a205_245018_c1 | 3300050515 | Bacteria | 1673 |
| 558 | nmdc:mga0a205_37940_c1 | 3300050515 | Bacteria | 4634 |
| 559 | nmdc:mga0a205_40853_c1 | 3300050515 | Bacteria | 4467 |
| 560 | nmdc:mga0a205_47156_c1 | 3300050515 | Bacteria | 4157 |
| 561 | nmdc:mga0a205_86822_c1 | 3300050515 | Bacteria | 3022 |
| 562 | nmdc:mga0a205_99331_c1 | 3300050515 | Bacteria | 2809 |
| 563 | Ga0495601_0034079 | 3300053077 | Bacteria | 3174 |
| 564 | Ga0500635_0006203 | 3300053080 | Bacteria | 3182 |
| 565 | Ga0495595_0000228 | 3300053084 | Bacteria | 22263 |
| 566 | Ga0500651_0239377 | 3300053093 | Bacteria | 1059 |
| 567 | Ga0500590_150388 | 3300053148 | Bacteria | 1051 |
| 568 | Ga0500603_000055 | 3300053150 | Bacteria | 28292 |
| 569 | Ga0500637_0016594 | 3300053178 | Bacteria | 3927 |
| 570 | Ga0500601_000106 | 3300053737 | Bacteria | 17299 |
| 571 | Ga0501084_0004829 | 3300054114 | Bacteria | 11017 |
| 572 | Ga0501084_0025561 | 3300054114 | Bacteria | 4926 |
| 573 | Ga0501084_0049986 | 3300054114 | Bacteria | 3500 |
| 574 | Ga0501084_0050553 | 3300054114 | Bacteria | 3479 |
| 575 | Ga0501084_0210103 | 3300054114 | Bacteria | 1642 |
| 576 | Ga0501084_0265506 | 3300054114 | Bacteria | 1449 |
| 577 | Ga0501084_0337734 | 3300054114 | Bacteria | 1272 |
| 578 | Ga0500661_012999 | 3300055283 | Bacteria | 1501 |
| 579 | Ga0501082_0002933 | 3300060353 | Bacteria | 14885 |
| 580 | Ga0501082_0003776 | 3300060353 | Bacteria | 13236 |
| 581 | Ga0501082_0006448 | 3300060353 | Bacteria | 10176 |
| 582 | Ga0501082_0051435 | 3300060353 | Bacteria | 3551 |
| 583 | Ga0501082_0095716 | 3300060353 | Bacteria | 2566 |
| 584 | Ga0530510_0003893 | 3300061734 | Bacteria | 10293 |
| 585 | Ga0530510_0007383 | 3300061734 | Bacteria | 7650 |
| 586 | Ga0530510_0014446 | 3300061734 | Bacteria | 5567 |
| 587 | Ga0530510_0089589 | 3300061734 | Bacteria | 2243 |
| 588 | Ga0530510_0123608 | 3300061734 | Bacteria | 1901 |
| 589 | Ga0530510_0124207 | 3300061734 | Bacteria | 1896 |
| 590 | Ga0530510_0131915 | 3300061734 | Bacteria | 1838 |
| 591 | Ga0530510_0165802 | 3300061734 | Bacteria | 1635 |
| 592 | Ga0530510_0246265 | 3300061734 | Bacteria | 1331 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005617 | Ga0068859_100039908 | Ga0068859_1000399084 | 248 |
| 2 | 3300005718 | Ga0068866_10009741 | Ga0068866_100097414 | 248 |
| 3 | 3300005719 | Ga0068861_100001943 | Ga0068861_1000019436 | 248 |
| 4 | 3300005841 | Ga0068863_100003131 | Ga0068863_10000313112 | 248 |
| 5 | 3300005842 | Ga0068858_100001019 | Ga0068858_1000010196 | 248 |
| 6 | 3300005843 | Ga0068860_100000932 | Ga0068860_10000093215 | 248 |
| 7 | 3300006881 | Ga0068865_100072769 | Ga0068865_1000727692 | 248 |
| 8 | 3300006931 | Ga0097620_100039908 | Ga0097620_1000399084 | 248 |
| 9 | 3300025903 | Ga0207680_10002621 | Ga0207680_100026213 | 248 |
| 10 | 3300025907 | Ga0207645_10001649 | Ga0207645_100016495 | 248 |
| 11 | 3300025918 | Ga0207662_10025200 | Ga0207662_100252003 | 248 |
| 12 | 3300025923 | Ga0207681_10000549 | Ga0207681_1000054913 | 248 |
| 13 | 3300025927 | Ga0207687_10018259 | Ga0207687_100182592 | 248 |
| 14 | 3300025938 | Ga0207704_10003465 | Ga0207704_100034652 | 248 |
| 15 | 3300025942 | Ga0207689_10001671 | Ga0207689_100016712 | 248 |
| 16 | 3300025961 | Ga0207712_10001342 | Ga0207712_100013424 | 248 |
| 17 | 3300025986 | Ga0207658_10000522 | Ga0207658_1000052214 | 248 |
| 18 | 3300026035 | Ga0207703_10000176 | Ga0207703_1000017648 | 248 |
| 19 | 3300026075 | Ga0207708_10043236 | Ga0207708_100432363 | 248 |
| 20 | 3300026088 | Ga0207641_10004166 | Ga0207641_1000416611 | 248 |
| 21 | 3300026118 | Ga0207675_100000483 | Ga0207675_10000048332 | 248 |
| 22 | 3300028381 | Ga0268264_10000951 | Ga0268264_1000095121 | 248 |
| 23 | 3300025926 | Ga0207659_10271704 | Ga0207659_102717042 | 253 |
| 24 | 3300042121 | Ga0450919_004622 | Ga0450919_004622_414_1286 | 261 |
| 25 | 3300049593 | Ga0501077_0096397 | Ga0501077_0096397_787_1740 | 262 |
| 26 | 3300049742 | Ga0501080_0248240 | Ga0501080_0248240_578_1531 | 262 |
| 27 | 3300006852 | Ga0075433_10008156 | Ga0075433_100081564 | 265 |
| 28 | 3300006871 | Ga0075434_100007335 | Ga0075434_1000073352 | 265 |
| 29 | 3300007076 | Ga0075435_100074962 | Ga0075435_1000749622 | 265 |
| 30 | 3300049582 | Ga0501048_0147363 | Ga0501048_0147363_129_1082 | 265 |
| 31 | 3300049587 | Ga0501071_0038668 | Ga0501071_0038668_1348_2301 | 265 |
| 32 | 3300049593 | Ga0501077_0185949 | Ga0501077_0185949_186_1139 | 265 |
| 33 | 3300049743 | Ga0501081_0071185 | Ga0501081_0071185_633_1586 | 265 |
| 34 | 3300050507 | nmdc:mga05p37_62965_c1 | nmdc:mga05p37_62965_c1_2278_3225 | 265 |
| 35 | 3300050513 | nmdc:mga0rr50_1492_c1 | nmdc:mga0rr50_1492_c1_9864_10811 | 265 |
| 36 | 3300050515 | nmdc:mga0a205_37940_c1 | nmdc:mga0a205_37940_c1_593_1540 | 265 |
| 37 | 3300061734 | Ga0530510_0124207 | Ga0530510_0124207_923_1876 | 265 |
| 38 | 3300005327 | Ga0070658_10038297 | Ga0070658_100382973 | 266 |
| 39 | 3300005329 | Ga0070683_100044869 | Ga0070683_1000448692 | 266 |
| 40 | 3300005344 | Ga0070661_100017942 | Ga0070661_1000179422 | 266 |
| 41 | 3300005366 | Ga0070659_100058363 | Ga0070659_1000583633 | 266 |
| 42 | 3300005471 | Ga0070698_100148256 | Ga0070698_1001482561 | 266 |
| 43 | 3300005535 | Ga0070684_100030738 | Ga0070684_1000307384 | 266 |
| 44 | 3300005539 | Ga0068853_100108345 | Ga0068853_1001083452 | 266 |
| 45 | 3300005564 | Ga0070664_100085235 | Ga0070664_1000852352 | 266 |
| 46 | 3300005577 | Ga0068857_100195993 | Ga0068857_1001959932 | 266 |
| 47 | 3300005578 | Ga0068854_100022692 | Ga0068854_1000226924 | 266 |
| 48 | 3300005614 | Ga0068856_100006441 | Ga0068856_1000064412 | 266 |
| 49 | 3300005616 | Ga0068852_100073525 | Ga0068852_1000735253 | 266 |
| 50 | 3300005834 | Ga0068851_10027390 | Ga0068851_100273902 | 266 |
| 51 | 3300009551 | Ga0105238_10022379 | Ga0105238_100223793 | 266 |
| 52 | 3300013307 | Ga0157372_10075034 | Ga0157372_100750342 | 266 |
| 53 | 3300025321 | Ga0207656_10057804 | Ga0207656_100578042 | 266 |
| 54 | 3300025920 | Ga0207649_10010768 | Ga0207649_100107683 | 266 |
| 55 | 3300025944 | Ga0207661_10038163 | Ga0207661_100381633 | 266 |
| 56 | 3300025945 | Ga0207679_10038287 | Ga0207679_100382873 | 266 |
| 57 | 3300026041 | Ga0207639_10061917 | Ga0207639_100619173 | 266 |
| 58 | 3300026078 | Ga0207702_10039619 | Ga0207702_100396192 | 266 |
| 59 | 3300026116 | Ga0207674_10183266 | Ga0207674_101832662 | 266 |
| 60 | 3300026142 | Ga0207698_10016249 | Ga0207698_100162493 | 266 |
| 61 | 3300005336 | Ga0070680_100014854 | Ga0070680_1000148545 | 267 |
| 62 | 3300005341 | Ga0070691_10023890 | Ga0070691_100238902 | 267 |
| 63 | 3300005530 | Ga0070679_100006831 | Ga0070679_1000068319 | 267 |
| 64 | 3300005615 | Ga0070702_100157662 | Ga0070702_1001576622 | 267 |
| 65 | 3300006358 | Ga0068871_100026984 | Ga0068871_1000269843 | 267 |
| 66 | 3300025917 | Ga0207660_10026389 | Ga0207660_100263894 | 267 |
| 67 | 3300025921 | Ga0207652_10442620 | Ga0207652_104426202 | 267 |
| 68 | 3300025926 | Ga0207659_10166304 | Ga0207659_101663042 | 267 |
| 69 | 3300025941 | Ga0207711_10049449 | Ga0207711_100494492 | 267 |
| 70 | 3300026089 | Ga0207648_10121943 | Ga0207648_101219432 | 267 |
| 71 | 3300035691 | Ga0373931_0002948 | Ga0373931_0002948_4010_4954 | 267 |
| 72 | 3300048910 | Ga0496107_0192028 | Ga0496107_0192028_31_975 | 267 |
| 73 | 3300048911 | Ga0496108_0051908 | Ga0496108_0051908_1047_1991 | 267 |
| 74 | 3300048913 | Ga0496110_0197959 | Ga0496110_0197959_140_1090 | 267 |
| 75 | 3300049574 | Ga0501038_0181327 | Ga0501038_0181327_586_1524 | 267 |
| 76 | 3300049578 | Ga0501042_0095214 | Ga0501042_0095214_163_1107 | 267 |
| 77 | 3300049743 | Ga0501081_0303575 | Ga0501081_0303575_25_972 | 267 |
| 78 | 3300025922 | Ga0207646_10029644 | Ga0207646_100296445 | 268 |
| 79 | 3300005328 | Ga0070676_10031847 | Ga0070676_100318473 | 269 |
| 80 | 3300005331 | Ga0070670_100005552 | Ga0070670_1000055526 | 269 |
| 81 | 3300005334 | Ga0068869_100001553 | Ga0068869_1000015538 | 269 |
| 82 | 3300005336 | Ga0070680_100002617 | Ga0070680_1000026175 | 269 |
| 83 | 3300005337 | Ga0070682_100001981 | Ga0070682_10000198110 | 269 |
| 84 | 3300005339 | Ga0070660_100001885 | Ga0070660_10000188510 | 269 |
| 85 | 3300005341 | Ga0070691_10005786 | Ga0070691_100057865 | 269 |
| 86 | 3300005344 | Ga0070661_100002131 | Ga0070661_1000021319 | 269 |
| 87 | 3300005345 | Ga0070692_10001426 | Ga0070692_100014269 | 269 |
| 88 | 3300005364 | Ga0070673_100004910 | Ga0070673_1000049106 | 269 |
| 89 | 3300005366 | Ga0070659_100005878 | Ga0070659_1000058785 | 269 |
| 90 | 3300005406 | Ga0070703_10004356 | Ga0070703_100043562 | 269 |
| 91 | 3300005438 | Ga0070701_10016367 | Ga0070701_100163673 | 269 |
| 92 | 3300005440 | Ga0070705_100002757 | Ga0070705_1000027574 | 269 |
| 93 | 3300005444 | Ga0070694_100009548 | Ga0070694_1000095485 | 269 |
| 94 | 3300005455 | Ga0070663_100011705 | Ga0070663_1000117054 | 269 |
| 95 | 3300005457 | Ga0070662_100030082 | Ga0070662_1000300824 | 269 |
| 96 | 3300005530 | Ga0070679_100016329 | Ga0070679_1000163295 | 269 |
| 97 | 3300005535 | Ga0070684_100084993 | Ga0070684_1000849932 | 269 |
| 98 | 3300005539 | Ga0068853_100007116 | Ga0068853_1000071168 | 269 |
| 99 | 3300005546 | Ga0070696_100012586 | Ga0070696_1000125864 | 269 |
| 100 | 3300005547 | Ga0070693_100000151 | Ga0070693_10000015128 | 269 |
| 101 | 3300005549 | Ga0070704_100002130 | Ga0070704_1000021309 | 269 |
| 102 | 3300005563 | Ga0068855_100035290 | Ga0068855_1000352903 | 269 |
| 103 | 3300005578 | Ga0068854_100015767 | Ga0068854_1000157674 | 269 |
| 104 | 3300005617 | Ga0068859_100008495 | Ga0068859_10000849512 | 269 |
| 105 | 3300005618 | Ga0068864_100007539 | Ga0068864_1000075394 | 269 |
| 106 | 3300005719 | Ga0068861_100016833 | Ga0068861_1000168333 | 269 |
| 107 | 3300005840 | Ga0068870_10003943 | Ga0068870_100039435 | 269 |
| 108 | 3300005841 | Ga0068863_100009810 | Ga0068863_1000098107 | 269 |
| 109 | 3300006914 | Ga0075436_100079284 | Ga0075436_1000792843 | 269 |
| 110 | 3300006931 | Ga0097620_100008495 | Ga0097620_1000084952 | 269 |
| 111 | 3300007076 | Ga0075435_100032114 | Ga0075435_1000321143 | 269 |
| 112 | 3300009093 | Ga0105240_10578691 | Ga0105240_105786911 | 269 |
| 113 | 3300009174 | Ga0105241_10001720 | Ga0105241_1000172015 | 269 |
| 114 | 3300013100 | Ga0157373_10001536 | Ga0157373_1000153615 | 269 |
| 115 | 3300013104 | Ga0157370_10175127 | Ga0157370_101751272 | 269 |
| 116 | 3300013307 | Ga0157372_10008094 | Ga0157372_1000809410 | 269 |
| 117 | 3300014326 | Ga0157380_10330684 | Ga0157380_103306842 | 269 |
| 118 | 3300014497 | Ga0182008_10119018 | Ga0182008_101190182 | 269 |
| 119 | 3300025885 | Ga0207653_10008663 | Ga0207653_100086631 | 269 |
| 120 | 3300025901 | Ga0207688_10107031 | Ga0207688_101070312 | 269 |
| 121 | 3300025907 | Ga0207645_10000858 | Ga0207645_1000085819 | 269 |
| 122 | 3300025908 | Ga0207643_10001314 | Ga0207643_1000131411 | 269 |
| 123 | 3300025912 | Ga0207707_10000169 | Ga0207707_1000016956 | 269 |
| 124 | 3300025917 | Ga0207660_10000853 | Ga0207660_1000085315 | 269 |
| 125 | 3300025919 | Ga0207657_10000230 | Ga0207657_1000023054 | 269 |
| 126 | 3300025920 | Ga0207649_10003044 | Ga0207649_100030445 | 269 |
| 127 | 3300025921 | Ga0207652_10000263 | Ga0207652_1000026328 | 269 |
| 128 | 3300025925 | Ga0207650_10003760 | Ga0207650_100037602 | 269 |
| 129 | 3300025932 | Ga0207690_10002921 | Ga0207690_100029214 | 269 |
| 130 | 3300025933 | Ga0207706_10010067 | Ga0207706_100100674 | 269 |
| 131 | 3300025936 | Ga0207670_10154874 | Ga0207670_101548742 | 269 |
| 132 | 3300025942 | Ga0207689_10000006 | Ga0207689_1000000654 | 269 |
| 133 | 3300025945 | Ga0207679_10001904 | Ga0207679_100019049 | 269 |
| 134 | 3300025949 | Ga0207667_10010274 | Ga0207667_100102746 | 269 |
| 135 | 3300026041 | Ga0207639_10009451 | Ga0207639_100094517 | 269 |
| 136 | 3300026067 | Ga0207678_10112224 | Ga0207678_101122242 | 269 |
| 137 | 3300026078 | Ga0207702_10003271 | Ga0207702_1000327113 | 269 |
| 138 | 3300026095 | Ga0207676_10008475 | Ga0207676_100084754 | 269 |
| 139 | 3300026118 | Ga0207675_100031776 | Ga0207675_1000317763 | 269 |
| 140 | 3300027876 | Ga0209974_10027690 | Ga0209974_100276902 | 269 |
| 141 | 3300028380 | Ga0268265_10002714 | Ga0268265_100027149 | 269 |
| 142 | 3300035090 | Ga0373949_0017211 | Ga0373949_0017211_256_1203 | 269 |
| 143 | 3300035121 | Ga0373960_0089920 | Ga0373960_0089920_14_961 | 269 |
| 144 | 3300035241 | Ga0373961_0017716 | Ga0373961_0017716_119_1066 | 269 |
| 145 | 3300042005 | Ga0439448_0000296 | Ga0439448_0000296_8096_9043 | 269 |
| 146 | 3300042438 | Ga0439459_0000355 | Ga0439459_0000355_1328_2275 | 269 |
| 147 | 3300044673 | Ga0453683_0286187 | Ga0453683_0286187_48_995 | 269 |
| 148 | 3300048905 | Ga0496102_0081173 | Ga0496102_0081173_1034_1981 | 269 |
| 149 | 3300050512 | nmdc:mga0n895_215906_c1 | nmdc:mga0n895_215906_c1_539_1486 | 269 |
| 150 | 3300050513 | nmdc:mga0rr50_113522_c1 | nmdc:mga0rr50_113522_c1_291_1238 | 269 |
| 151 | 3300049585 | Ga0501069_0069463 | Ga0501069_0069463_940_1872 | 270 |
| 152 | 3300049571 | Ga0501034_0048692 | Ga0501034_0048692_797_1699 | 272 |
| 153 | 3300049584 | Ga0501068_0023945 | Ga0501068_0023945_1729_2631 | 272 |
| 154 | 3300049586 | Ga0501070_0460725 | Ga0501070_0460725_96_998 | 272 |
| 155 | 3300049741 | Ga0501079_0033373 | Ga0501079_0033373_1966_2916 | 272 |
| 156 | 3300049823 | Ga0501044_0079300 | Ga0501044_0079300_1141_2043 | 272 |
| 157 | 3300005295 | Ga0065707_10209494 | Ga0065707_102094941 | 273 |
| 158 | 3300049575 | Ga0501039_0088078 | Ga0501039_0088078_1342_2283 | 273 |
| 159 | 3300049577 | Ga0501041_0083457 | Ga0501041_0083457_400_1341 | 273 |
| 160 | 3300049580 | Ga0501046_0129135 | Ga0501046_0129135_629_1570 | 273 |
| 161 | 3300049824 | Ga0501045_0063103 | Ga0501045_0063103_237_1178 | 273 |
| 162 | 3300031241 | Ga0265325_10125297 | Ga0265325_101252972 | 274 |
| 163 | 3300031247 | Ga0265340_10014560 | Ga0265340_100145605 | 274 |
| 164 | 3300005518 | Ga0070699_100114885 | Ga0070699_1001148852 | 275 |
| 165 | 3300006871 | Ga0075434_100032026 | Ga0075434_1000320263 | 275 |
| 166 | 3300006871 | Ga0075434_100080138 | Ga0075434_1000801383 | 275 |
| 167 | 3300007076 | Ga0075435_100245671 | Ga0075435_1002456712 | 275 |
| 168 | 3300009094 | Ga0111539_10125193 | Ga0111539_101251933 | 275 |
| 169 | 3300028380 | Ga0268265_10189844 | Ga0268265_101898442 | 275 |
| 170 | 3300050507 | nmdc:mga05p37_421095_c1 | nmdc:mga05p37_421095_c1_247_1182 | 275 |
| 171 | 3300050512 | nmdc:mga0n895_139393_c1 | nmdc:mga0n895_139393_c1_1068_1976 | 275 |
| 172 | 3300050513 | nmdc:mga0rr50_84476_c1 | nmdc:mga0rr50_84476_c1_190_1128 | 275 |
| 173 | 3300050515 | nmdc:mga0a205_99331_c1 | nmdc:mga0a205_99331_c1_415_1359 | 275 |
| 174 | 3300005440 | Ga0070705_100038426 | Ga0070705_1000384263 | 276 |
| 175 | 3300046533 | Ga0495640_0008049 | Ga0495640_0008049_6812_7720 | 276 |
| 176 | 3300049568 | Ga0501031_0023681 | Ga0501031_0023681_2585_3529 | 276 |
| 177 | 3300049569 | Ga0501032_0090473 | Ga0501032_0090473_889_1833 | 276 |
| 178 | 3300049572 | Ga0501036_0002690 | Ga0501036_0002690_2571_3515 | 276 |
| 179 | 3300049574 | Ga0501038_0052165 | Ga0501038_0052165_937_1881 | 276 |
| 180 | 3300049575 | Ga0501039_0036427 | Ga0501039_0036427_312_1256 | 276 |
| 181 | 3300049576 | Ga0501040_0001684 | Ga0501040_0001684_10665_11609 | 276 |
| 182 | 3300049576 | Ga0501040_0358115 | Ga0501040_0358115_43_984 | 276 |
| 183 | 3300049577 | Ga0501041_0056990 | Ga0501041_0056990_884_1828 | 276 |
| 184 | 3300049578 | Ga0501042_0059310 | Ga0501042_0059310_57_1001 | 276 |
| 185 | 3300049580 | Ga0501046_0002560 | Ga0501046_0002560_2542_3486 | 276 |
| 186 | 3300049582 | Ga0501048_0021169 | Ga0501048_0021169_2544_3488 | 276 |
| 187 | 3300049584 | Ga0501068_0022873 | Ga0501068_0022873_1589_2533 | 276 |
| 188 | 3300049586 | Ga0501070_0034376 | Ga0501070_0034376_2581_3525 | 276 |
| 189 | 3300049587 | Ga0501071_0003914 | Ga0501071_0003914_1895_2839 | 276 |
| 190 | 3300049590 | Ga0501074_0047869 | Ga0501074_0047869_1544_2488 | 276 |
| 191 | 3300049592 | Ga0501076_0001859 | Ga0501076_0001859_10623_11567 | 276 |
| 192 | 3300049593 | Ga0501077_0027843 | Ga0501077_0027843_2567_3511 | 276 |
| 193 | 3300049593 | Ga0501077_0183364 | Ga0501077_0183364_263_1204 | 276 |
| 194 | 3300049741 | Ga0501079_0003697 | Ga0501079_0003697_9106_10050 | 276 |
| 195 | 3300049742 | Ga0501080_0003420 | Ga0501080_0003420_2533_3477 | 276 |
| 196 | 3300049743 | Ga0501081_0000778 | Ga0501081_0000778_2849_3793 | 276 |
| 197 | 3300049744 | Ga0501083_0096551 | Ga0501083_0096551_431_1375 | 276 |
| 198 | 3300049824 | Ga0501045_0002468 | Ga0501045_0002468_11265_12209 | 276 |
| 199 | 3300049824 | Ga0501045_0377558 | Ga0501045_0377558_39_980 | 276 |
| 200 | 3300054114 | Ga0501084_0004829 | Ga0501084_0004829_419_1363 | 276 |
| 201 | 3300054114 | Ga0501084_0050553 | Ga0501084_0050553_1436_2377 | 276 |
| 202 | 3300060353 | Ga0501082_0002933 | Ga0501082_0002933_11390_12334 | 276 |
| 203 | 3300061734 | Ga0530510_0003893 | Ga0530510_0003893_8985_9929 | 276 |
| 204 | 3300061734 | Ga0530510_0246265 | Ga0530510_0246265_284_1225 | 276 |
| 205 | iso_pu_bacteria | 2857509624 | 2857514821 | 276 |
| 206 | iso_pu_bacteria | 2922386360 | 2922387251 | 276 |
| 207 | iso_pu_bacteria | 8006994254 | 8006999803 | 276 |
| 208 | 3300005468 | Ga0070707_100010096 | Ga0070707_1000100963 | 277 |
| 209 | 3300005983 | Ga0081540_1008693 | Ga0081540_10086932 | 277 |
| 210 | 3300025294 | Ga0209025_1047681 | Ga0209025_10476812 | 277 |
| 211 | 3300025910 | Ga0207684_10129732 | Ga0207684_101297321 | 277 |
| 212 | 3300025922 | Ga0207646_10049095 | Ga0207646_100490953 | 277 |
| 213 | 3300026075 | Ga0207708_10185384 | Ga0207708_101853842 | 277 |
| 214 | 3300031548 | Ga0307408_100149550 | Ga0307408_1001495502 | 277 |
| 215 | 3300031731 | Ga0307405_10200194 | Ga0307405_102001941 | 277 |
| 216 | 3300044673 | Ga0453683_0173520 | Ga0453683_0173520_62_991 | 277 |
| 217 | 3300045051 | Ga0451576_0083244 | Ga0451576_0083244_912_1859 | 277 |
| 218 | 3300049568 | Ga0501031_0209678 | Ga0501031_0209678_192_1139 | 277 |
| 219 | 3300049593 | Ga0501077_0049259 | Ga0501077_0049259_983_1918 | 277 |
| 220 | 3300049741 | Ga0501079_0229362 | Ga0501079_0229362_387_1322 | 277 |
| 221 | 3300050507 | nmdc:mga05p37_5718_c1 | nmdc:mga05p37_5718_c1_11381_12322 | 277 |
| 222 | 3300050514 | nmdc:mga08x19_22684_c1 | nmdc:mga08x19_22684_c1_2360_3289 | 277 |
| 223 | 3300061734 | Ga0530510_0014446 | Ga0530510_0014446_2071_3015 | 277 |
| 224 | 3300005336 | Ga0070680_100055722 | Ga0070680_1000557222 | 278 |
| 225 | 3300005444 | Ga0070694_100018940 | Ga0070694_1000189402 | 278 |
| 226 | 3300005545 | Ga0070695_100069499 | Ga0070695_1000694991 | 278 |
| 227 | 3300005549 | Ga0070704_100003768 | Ga0070704_1000037684 | 278 |
| 228 | 3300005616 | Ga0068852_100440251 | Ga0068852_1004402512 | 278 |
| 229 | 3300005617 | Ga0068859_100093010 | Ga0068859_1000930103 | 278 |
| 230 | 3300005842 | Ga0068858_100258974 | Ga0068858_1002589742 | 278 |
| 231 | 3300005843 | Ga0068860_100014294 | Ga0068860_1000142944 | 278 |
| 232 | 3300005985 | Ga0081539_10000002 | Ga0081539_10000002199 | 278 |
| 233 | 3300006846 | Ga0075430_100005095 | Ga0075430_1000050955 | 278 |
| 234 | 3300006847 | Ga0075431_100005700 | Ga0075431_1000057005 | 278 |
| 235 | 3300006847 | Ga0075431_100517045 | Ga0075431_1005170452 | 278 |
| 236 | 3300006880 | Ga0075429_100130750 | Ga0075429_1001307502 | 278 |
| 237 | 3300006931 | Ga0097620_100093016 | Ga0097620_1000930163 | 278 |
| 238 | 3300009147 | Ga0114129_10005731 | Ga0114129_1000573119 | 278 |
| 239 | 3300009147 | Ga0114129_10028104 | Ga0114129_100281048 | 278 |
| 240 | 3300009147 | Ga0114129_10038302 | Ga0114129_100383022 | 278 |
| 241 | 3300014326 | Ga0157380_10026243 | Ga0157380_100262434 | 278 |
| 242 | 3300014968 | Ga0157379_10042544 | Ga0157379_100425442 | 278 |
| 243 | 3300025917 | Ga0207660_10016991 | Ga0207660_100169914 | 278 |
| 244 | 3300025944 | Ga0207661_10456742 | Ga0207661_104567421 | 278 |
| 245 | 3300026035 | Ga0207703_10009198 | Ga0207703_100091984 | 278 |
| 246 | 3300028381 | Ga0268264_10074115 | Ga0268264_100741153 | 278 |
| 247 | 3300031730 | Ga0307516_10072372 | Ga0307516_100723722 | 278 |
| 248 | 3300032002 | Ga0307416_100274746 | Ga0307416_1002747461 | 278 |
| 249 | 3300035112 | Ga0373932_0059866 | Ga0373932_0059866_87_1031 | 278 |
| 250 | 3300035114 | Ga0373939_0071043 | Ga0373939_0071043_31_975 | 278 |
| 251 | 3300035691 | Ga0373931_0012972 | Ga0373931_0012972_515_1459 | 278 |
| 252 | 3300045051 | Ga0451576_0077245 | Ga0451576_0077245_11_958 | 278 |
| 253 | 3300049576 | Ga0501040_0180246 | Ga0501040_0180246_23_964 | 278 |
| 254 | 3300049582 | Ga0501048_0077516 | Ga0501048_0077516_105_1040 | 278 |
| 255 | 3300049587 | Ga0501071_0081863 | Ga0501071_0081863_700_1635 | 278 |
| 256 | 3300049588 | Ga0501072_0033613 | Ga0501072_0033613_287_1228 | 278 |
| 257 | 3300049592 | Ga0501076_0015860 | Ga0501076_0015860_1984_2925 | 278 |
| 258 | 3300049592 | Ga0501076_0126721 | Ga0501076_0126721_285_1226 | 278 |
| 259 | 3300049593 | Ga0501077_0034917 | Ga0501077_0034917_1918_2859 | 278 |
| 260 | 3300049593 | Ga0501077_0155376 | Ga0501077_0155376_187_1122 | 278 |
| 261 | 3300049743 | Ga0501081_0009596 | Ga0501081_0009596_2821_3762 | 278 |
| 262 | 3300049743 | Ga0501081_0051141 | Ga0501081_0051141_854_1795 | 278 |
| 263 | 3300049744 | Ga0501083_0080109 | Ga0501083_0080109_48_989 | 278 |
| 264 | 3300049824 | Ga0501045_0064879 | Ga0501045_0064879_1445_2380 | 278 |
| 265 | 3300050507 | nmdc:mga05p37_30562_c1 | nmdc:mga05p37_30562_c1_3356_4291 | 278 |
| 266 | 3300050507 | nmdc:mga05p37_3869_c1 | nmdc:mga05p37_3869_c1_4802_5746 | 278 |
| 267 | 3300050507 | nmdc:mga05p37_9142_c1 | nmdc:mga05p37_9142_c1_8844_9779 | 278 |
| 268 | 3300050508 | nmdc:mga09592_95622_c1 | nmdc:mga09592_95622_c1_651_1595 | 278 |
| 269 | 3300050509 | nmdc:mga0qj67_3320_c1 | nmdc:mga0qj67_3320_c1_3762_4706 | 278 |
| 270 | 3300050510 | nmdc:mga06r32_3922_c1 | nmdc:mga06r32_3922_c1_4338_5282 | 278 |
| 271 | 3300050515 | nmdc:mga0a205_118610_c2 | nmdc:mga0a205_118610_c2_582_1517 | 278 |
| 272 | 3300054114 | Ga0501084_0025561 | Ga0501084_0025561_1995_2927 | 278 |
| 273 | 3300054114 | Ga0501084_0337734 | Ga0501084_0337734_284_1225 | 278 |
| 274 | 3300060353 | Ga0501082_0051435 | Ga0501082_0051435_908_1849 | 278 |
| 275 | 3300060353 | Ga0501082_0095716 | Ga0501082_0095716_1472_2413 | 278 |
| 276 | 3300061734 | Ga0530510_0131915 | Ga0530510_0131915_621_1562 | 278 |
| 277 | 3300061734 | Ga0530510_0165802 | Ga0530510_0165802_210_1151 | 278 |
| 278 | 3300005328 | Ga0070676_10245427 | Ga0070676_102454271 | 279 |
| 279 | 3300005336 | Ga0070680_100010196 | Ga0070680_1000101963 | 279 |
| 280 | 3300005336 | Ga0070680_100388472 | Ga0070680_1003884721 | 279 |
| 281 | 3300005440 | Ga0070705_100006694 | Ga0070705_1000066945 | 279 |
| 282 | 3300005444 | Ga0070694_100008439 | Ga0070694_1000084392 | 279 |
| 283 | 3300005458 | Ga0070681_10018023 | Ga0070681_100180233 | 279 |
| 284 | 3300005458 | Ga0070681_10037353 | Ga0070681_100373533 | 279 |
| 285 | 3300005467 | Ga0070706_100154277 | Ga0070706_1001542773 | 279 |
| 286 | 3300005530 | Ga0070679_100030364 | Ga0070679_1000303643 | 279 |
| 287 | 3300005545 | Ga0070695_100015240 | Ga0070695_1000152403 | 279 |
| 288 | 3300005545 | Ga0070695_100020539 | Ga0070695_1000205394 | 279 |
| 289 | 3300005546 | Ga0070696_100052871 | Ga0070696_1000528713 | 279 |
| 290 | 3300005549 | Ga0070704_100001890 | Ga0070704_1000018908 | 279 |
| 291 | 3300005549 | Ga0070704_100002499 | Ga0070704_1000024999 | 279 |
| 292 | 3300005937 | Ga0081455_10000138 | Ga0081455_1000013810 | 279 |
| 293 | 3300005983 | Ga0081540_1000543 | Ga0081540_100054334 | 279 |
| 294 | 3300005983 | Ga0081540_1006899 | Ga0081540_10068993 | 279 |
| 295 | 3300005983 | Ga0081540_1094164 | Ga0081540_10941642 | 279 |
| 296 | 3300006173 | Ga0070716_100027582 | Ga0070716_1000275822 | 279 |
| 297 | 3300006844 | Ga0075428_100000227 | Ga0075428_10000022752 | 279 |
| 298 | 3300006844 | Ga0075428_100098276 | Ga0075428_1000982762 | 279 |
| 299 | 3300006846 | Ga0075430_100000307 | Ga0075430_10000030725 | 279 |
| 300 | 3300006847 | Ga0075431_100000414 | Ga0075431_10000041425 | 279 |
| 301 | 3300006847 | Ga0075431_100025974 | Ga0075431_1000259744 | 279 |
| 302 | 3300006852 | Ga0075433_10020195 | Ga0075433_100201954 | 279 |
| 303 | 3300006852 | Ga0075433_10149641 | Ga0075433_101496412 | 279 |
| 304 | 3300006871 | Ga0075434_100084090 | Ga0075434_1000840902 | 279 |
| 305 | 3300006880 | Ga0075429_100000032 | Ga0075429_1000000329 | 279 |
| 306 | 3300006880 | Ga0075429_100000080 | Ga0075429_10000008031 | 279 |
| 307 | 3300006914 | Ga0075436_100024505 | Ga0075436_1000245054 | 279 |
| 308 | 3300006914 | Ga0075436_100050078 | Ga0075436_1000500782 | 279 |
| 309 | 3300007076 | Ga0075435_100016916 | Ga0075435_1000169163 | 279 |
| 310 | 3300007076 | Ga0075435_100040810 | Ga0075435_1000408102 | 279 |
| 311 | 3300007265 | Ga0099794_10147116 | Ga0099794_101471161 | 279 |
| 312 | 3300009093 | Ga0105240_10010045 | Ga0105240_1001004513 | 279 |
| 313 | 3300009093 | Ga0105240_10570672 | Ga0105240_105706722 | 279 |
| 314 | 3300009094 | Ga0111539_10037354 | Ga0111539_100373542 | 279 |
| 315 | 3300009094 | Ga0111539_10624416 | Ga0111539_106244162 | 279 |
| 316 | 3300009147 | Ga0114129_10002723 | Ga0114129_100027232 | 279 |
| 317 | 3300009147 | Ga0114129_10056587 | Ga0114129_100565872 | 279 |
| 318 | 3300009147 | Ga0114129_10157112 | Ga0114129_101571123 | 279 |
| 319 | 3300009147 | Ga0114129_10421519 | Ga0114129_104215192 | 279 |
| 320 | 3300009177 | Ga0105248_10282859 | Ga0105248_102828592 | 279 |
| 321 | 3300013104 | Ga0157370_10031729 | Ga0157370_100317293 | 279 |
| 322 | 3300013297 | Ga0157378_10428147 | Ga0157378_104281471 | 279 |
| 323 | 3300021377 | Ga0213874_10028151 | Ga0213874_100281512 | 279 |
| 324 | 3300025910 | Ga0207684_10127474 | Ga0207684_101274742 | 279 |
| 325 | 3300025912 | Ga0207707_10038106 | Ga0207707_100381062 | 279 |
| 326 | 3300025912 | Ga0207707_10055003 | Ga0207707_100550032 | 279 |
| 327 | 3300025913 | Ga0207695_10086041 | Ga0207695_100860413 | 279 |
| 328 | 3300025913 | Ga0207695_10396238 | Ga0207695_103962382 | 279 |
| 329 | 3300025915 | Ga0207693_10059818 | Ga0207693_100598182 | 279 |
| 330 | 3300025915 | Ga0207693_10060239 | Ga0207693_100602392 | 279 |
| 331 | 3300025917 | Ga0207660_10108347 | Ga0207660_101083472 | 279 |
| 332 | 3300025921 | Ga0207652_10309299 | Ga0207652_103092992 | 279 |
| 333 | 3300025928 | Ga0207700_10310263 | Ga0207700_103102632 | 279 |
| 334 | 3300025949 | Ga0207667_10104934 | Ga0207667_101049342 | 279 |
| 335 | 3300027907 | Ga0207428_10013876 | Ga0207428_100138766 | 279 |
| 336 | 3300031507 | Ga0307509_10198022 | Ga0307509_101980222 | 279 |
| 337 | 3300031711 | Ga0265314_10000822 | Ga0265314_100008222 | 279 |
| 338 | 3300031712 | Ga0265342_10085635 | Ga0265342_100856352 | 279 |
| 339 | 3300031824 | Ga0307413_10119711 | Ga0307413_101197112 | 279 |
| 340 | 3300031911 | Ga0307412_10362663 | Ga0307412_103626631 | 279 |
| 341 | 3300032002 | Ga0307416_100004427 | Ga0307416_1000044271 | 279 |
| 342 | 3300033180 | Ga0307510_10063262 | Ga0307510_100632624 | 279 |
| 343 | 3300035086 | Ga0373934_0001390 | Ga0373934_0001390_1470_2387 | 279 |
| 344 | 3300035113 | Ga0373936_0094211 | Ga0373936_0094211_85_1002 | 279 |
| 345 | 3300035117 | Ga0373953_0000426 | Ga0373953_0000426_4897_5814 | 279 |
| 346 | 3300035118 | Ga0373954_0000139 | Ga0373954_0000139_8314_9231 | 279 |
| 347 | 3300035119 | Ga0373956_0001236 | Ga0373956_0001236_6610_7527 | 279 |
| 348 | 3300035120 | Ga0373957_0054999 | Ga0373957_0054999_289_1206 | 279 |
| 349 | 3300035170 | Ga0373943_0036609 | Ga0373943_0036609_314_1255 | 279 |
| 350 | 3300035172 | Ga0373955_0000597 | Ga0373955_0000597_8804_9721 | 279 |
| 351 | 3300035242 | Ga0373962_0055380 | Ga0373962_0055380_164_1114 | 279 |
| 352 | 3300035410 | Ga0373924_0012050 | Ga0373924_0012050_828_1745 | 279 |
| 353 | 3300035692 | Ga0373935_0249287 | Ga0373935_0249287_38_955 | 279 |
| 354 | 3300035695 | Ga0373927_0007782 | Ga0373927_0007782_1859_2779 | 279 |
| 355 | 3300035695 | Ga0373927_0014475 | Ga0373927_0014475_3266_4207 | 279 |
| 356 | 3300035724 | Ga0373933_0000483 | Ga0373933_0000483_4123_5040 | 279 |
| 357 | 3300037068 | Ga0373925_0045346 | Ga0373925_0045346_191_1111 | 279 |
| 358 | 3300037068 | Ga0373925_0135517 | Ga0373925_0135517_668_1609 | 279 |
| 359 | 3300039437 | Ga0436365_0212285 | Ga0436365_0212285_2425_3366 | 279 |
| 360 | 3300039437 | Ga0436365_0821657 | Ga0436365_0821657_382_1323 | 279 |
| 361 | 3300039453 | Ga0436362_1210859 | Ga0436362_1210859_1616_2557 | 279 |
| 362 | 3300041997 | Ga0439431_0002062 | Ga0439431_0002062_435_1406 | 279 |
| 363 | 3300042012 | Ga0439455_0044582 | Ga0439455_0044582_169_1086 | 279 |
| 364 | 3300042436 | Ga0439435_0005572 | Ga0439435_0005572_1207_2145 | 279 |
| 365 | 3300042461 | Ga0439460_0002563 | Ga0439460_0002563_3024_3962 | 279 |
| 366 | 3300046454 | Ga0495592_0001466 | Ga0495592_0001466_7328_8245 | 279 |
| 367 | 3300046455 | Ga0495603_0025030 | Ga0495603_0025030_1236_2153 | 279 |
| 368 | 3300046459 | Ga0495629_0000548 | Ga0495629_0000548_13878_14795 | 279 |
| 369 | 3300046462 | Ga0495651_0003160 | Ga0495651_0003160_4979_5896 | 279 |
| 370 | 3300046463 | Ga0495653_0000621 | Ga0495653_0000621_18451_19368 | 279 |
| 371 | 3300046499 | Ga0495594_0183542 | Ga0495594_0183542_13_930 | 279 |
| 372 | 3300046511 | Ga0495608_0002190 | Ga0495608_0002190_6076_6993 | 279 |
| 373 | 3300046514 | Ga0495618_0139786 | Ga0495618_0139786_32_949 | 279 |
| 374 | 3300046516 | Ga0495628_0018073 | Ga0495628_0018073_4454_5371 | 279 |
| 375 | 3300046524 | Ga0495648_0106702 | Ga0495648_0106702_305_1222 | 279 |
| 376 | 3300046529 | Ga0495652_0005425 | Ga0495652_0005425_3602_4519 | 279 |
| 377 | 3300046536 | Ga0495587_0001777 | Ga0495587_0001777_5404_6321 | 279 |
| 378 | 3300046543 | Ga0495645_0055831 | Ga0495645_0055831_1070_1987 | 279 |
| 379 | 3300046559 | Ga0495667_0000853 | Ga0495667_0000853_9631_10548 | 279 |
| 380 | 3300046642 | Ga0495634_0008025 | Ga0495634_0008025_4945_5862 | 279 |
| 381 | 3300046663 | Ga0495635_0000485 | Ga0495635_0000485_8374_9291 | 279 |
| 382 | 3300046675 | Ga0495657_0004077 | Ga0495657_0004077_4851_5768 | 279 |
| 383 | 3300046678 | Ga0495599_0000942 | Ga0495599_0000942_7857_8774 | 279 |
| 384 | 3300046679 | Ga0495623_0015435 | Ga0495623_0015435_2125_3042 | 279 |
| 385 | 3300046680 | Ga0495646_0013023 | Ga0495646_0013023_903_1820 | 279 |
| 386 | 3300046689 | Ga0495613_0117506 | Ga0495613_0117506_359_1276 | 279 |
| 387 | 3300046809 | Ga0495600_0002111 | Ga0495600_0002111_4251_5168 | 279 |
| 388 | 3300047317 | Ga0495604_0003566 | Ga0495604_0003566_5414_6331 | 279 |
| 389 | 3300047319 | Ga0495674_0054183 | Ga0495674_0054183_2566_3483 | 279 |
| 390 | 3300047322 | Ga0495680_0001218 | Ga0495680_0001218_16422_17339 | 279 |
| 391 | 3300047444 | Ga0495675_0000987 | Ga0495675_0000987_8258_9175 | 279 |
| 392 | 3300047471 | Ga0495684_0001700 | Ga0495684_0001700_8130_9047 | 279 |
| 393 | 3300047673 | Ga0495593_0006674 | Ga0495593_0006674_5670_6587 | 279 |
| 394 | 3300048088 | Ga0495602_0035011 | Ga0495602_0035011_1896_2813 | 279 |
| 395 | 3300048905 | Ga0496102_0632047 | Ga0496102_0632047_23_961 | 279 |
| 396 | 3300048909 | Ga0496106_0341759 | Ga0496106_0341759_18_938 | 279 |
| 397 | 3300049568 | Ga0501031_0141746 | Ga0501031_0141746_253_1254 | 279 |
| 398 | 3300049572 | Ga0501036_0325849 | Ga0501036_0325849_36_977 | 279 |
| 399 | 3300049574 | Ga0501038_0068158 | Ga0501038_0068158_1849_2850 | 279 |
| 400 | 3300049575 | Ga0501039_0144931 | Ga0501039_0144931_845_1846 | 279 |
| 401 | 3300049576 | Ga0501040_0005541 | Ga0501040_0005541_5104_6105 | 279 |
| 402 | 3300049577 | Ga0501041_0224906 | Ga0501041_0224906_155_1099 | 279 |
| 403 | 3300049580 | Ga0501046_0000455 | Ga0501046_0000455_31673_32674 | 279 |
| 404 | 3300049582 | Ga0501048_0001071 | Ga0501048_0001071_18613_19614 | 279 |
| 405 | 3300049584 | Ga0501068_0043184 | Ga0501068_0043184_1015_2016 | 279 |
| 406 | 3300049584 | Ga0501068_0130594 | Ga0501068_0130594_481_1422 | 279 |
| 407 | 3300049587 | Ga0501071_0097418 | Ga0501071_0097418_1019_1963 | 279 |
| 408 | 3300049590 | Ga0501074_0001262 | Ga0501074_0001262_6357_7358 | 279 |
| 409 | 3300049591 | Ga0501075_0054298 | Ga0501075_0054298_968_1969 | 279 |
| 410 | 3300049592 | Ga0501076_0052572 | Ga0501076_0052572_560_1573 | 279 |
| 411 | 3300049592 | Ga0501076_0321171 | Ga0501076_0321171_237_1187 | 279 |
| 412 | 3300049741 | Ga0501079_0005279 | Ga0501079_0005279_8479_9480 | 279 |
| 413 | 3300049743 | Ga0501081_0002562 | Ga0501081_0002562_4812_5813 | 279 |
| 414 | 3300049744 | Ga0501083_0018129 | Ga0501083_0018129_401_1402 | 279 |
| 415 | 3300049824 | Ga0501045_0000268 | Ga0501045_0000268_5351_6352 | 279 |
| 416 | 3300050507 | nmdc:mga05p37_26343_c1 | nmdc:mga05p37_26343_c1_839_1783 | 279 |
| 417 | 3300050507 | nmdc:mga05p37_45318_c1 | nmdc:mga05p37_45318_c1_4280_5215 | 279 |
| 418 | 3300050507 | nmdc:mga05p37_803_c1 | nmdc:mga05p37_803_c1_28356_29297 | 279 |
| 419 | 3300050508 | nmdc:mga09592_19019_c1 | nmdc:mga09592_19019_c1_2923_3867 | 279 |
| 420 | 3300050508 | nmdc:mga09592_44_c1 | nmdc:mga09592_44_c1_44522_45463 | 279 |
| 421 | 3300050509 | nmdc:mga0qj67_7226_c1 | nmdc:mga0qj67_7226_c1_1683_2627 | 279 |
| 422 | 3300050510 | nmdc:mga06r32_104585_c1 | nmdc:mga06r32_104585_c1_512_1456 | 279 |
| 423 | 3300050510 | nmdc:mga06r32_7269_c2 | nmdc:mga06r32_7269_c2_3969_4910 | 279 |
| 424 | 3300050511 | nmdc:mga08y16_19461_c1 | nmdc:mga08y16_19461_c1_3021_3959 | 279 |
| 425 | 3300050511 | nmdc:mga08y16_616723_c1 | nmdc:mga08y16_616723_c1_110_1054 | 279 |
| 426 | 3300050512 | nmdc:mga0n895_33637_c1 | nmdc:mga0n895_33637_c1_2172_3116 | 279 |
| 427 | 3300050512 | nmdc:mga0n895_36011_c1 | nmdc:mga0n895_36011_c1_1999_2937 | 279 |
| 428 | 3300050512 | nmdc:mga0n895_5041_c1 | nmdc:mga0n895_5041_c1_3142_4083 | 279 |
| 429 | 3300050513 | nmdc:mga0rr50_16374_c1 | nmdc:mga0rr50_16374_c1_624_1565 | 279 |
| 430 | 3300050513 | nmdc:mga0rr50_25001_c1 | nmdc:mga0rr50_25001_c1_2794_3738 | 279 |
| 431 | 3300050514 | nmdc:mga08x19_16628_c1 | nmdc:mga08x19_16628_c1_2823_3761 | 279 |
| 432 | 3300050514 | nmdc:mga08x19_67844_c1 | nmdc:mga08x19_67844_c1_576_1511 | 279 |
| 433 | 3300050515 | nmdc:mga0a205_40853_c1 | nmdc:mga0a205_40853_c1_912_1856 | 279 |
| 434 | 3300050515 | nmdc:mga0a205_47156_c1 | nmdc:mga0a205_47156_c1_970_1905 | 279 |
| 435 | 3300053077 | Ga0495601_0034079 | Ga0495601_0034079_658_1575 | 279 |
| 436 | 3300053080 | Ga0500635_0006203 | Ga0500635_0006203_1034_1951 | 279 |
| 437 | 3300053084 | Ga0495595_0000228 | Ga0495595_0000228_12892_13809 | 279 |
| 438 | 3300053148 | Ga0500590_150388 | Ga0500590_150388_67_984 | 279 |
| 439 | 3300053150 | Ga0500603_000055 | Ga0500603_000055_26608_27525 | 279 |
| 440 | 3300053178 | Ga0500637_0016594 | Ga0500637_0016594_1062_1979 | 279 |
| 441 | 3300054114 | Ga0501084_0265506 | Ga0501084_0265506_492_1436 | 279 |
| 442 | 3300060353 | Ga0501082_0003776 | Ga0501082_0003776_5561_6562 | 279 |
| 443 | 3300003215 | JGI25153J46596_10001308 | JGI25153J46596_100013085 | 280 |
| 444 | 3300003347 | JGI26128J50194_1002768 | JGI26128J50194_10027681 | 280 |
| 445 | 3300005435 | Ga0070714_100394417 | Ga0070714_1003944171 | 280 |
| 446 | 3300005439 | Ga0070711_100274400 | Ga0070711_1002744001 | 280 |
| 447 | 3300005440 | Ga0070705_100002327 | Ga0070705_1000023279 | 280 |
| 448 | 3300005445 | Ga0070708_100004512 | Ga0070708_1000045129 | 280 |
| 449 | 3300005445 | Ga0070708_100039979 | Ga0070708_1000399793 | 280 |
| 450 | 3300005445 | Ga0070708_100041712 | Ga0070708_1000417122 | 280 |
| 451 | 3300005445 | Ga0070708_100095959 | Ga0070708_1000959592 | 280 |
| 452 | 3300005457 | Ga0070662_100031994 | Ga0070662_1000319942 | 280 |
| 453 | 3300005467 | Ga0070706_100011007 | Ga0070706_1000110073 | 280 |
| 454 | 3300005467 | Ga0070706_100027880 | Ga0070706_1000278802 | 280 |
| 455 | 3300005467 | Ga0070706_100062940 | Ga0070706_1000629403 | 280 |
| 456 | 3300005467 | Ga0070706_100221601 | Ga0070706_1002216012 | 280 |
| 457 | 3300005468 | Ga0070707_100040474 | Ga0070707_1000404742 | 280 |
| 458 | 3300005468 | Ga0070707_100054661 | Ga0070707_1000546614 | 280 |
| 459 | 3300005471 | Ga0070698_100009734 | Ga0070698_1000097348 | 280 |
| 460 | 3300005471 | Ga0070698_100020081 | Ga0070698_1000200813 | 280 |
| 461 | 3300005471 | Ga0070698_100057994 | Ga0070698_1000579941 | 280 |
| 462 | 3300005471 | Ga0070698_100409080 | Ga0070698_1004090802 | 280 |
| 463 | 3300005518 | Ga0070699_100000309 | Ga0070699_10000030951 | 280 |
| 464 | 3300005518 | Ga0070699_100028086 | Ga0070699_1000280863 | 280 |
| 465 | 3300005518 | Ga0070699_100062989 | Ga0070699_1000629893 | 280 |
| 466 | 3300005518 | Ga0070699_100330107 | Ga0070699_1003301071 | 280 |
| 467 | 3300005536 | Ga0070697_100037165 | Ga0070697_1000371653 | 280 |
| 468 | 3300005536 | Ga0070697_100331782 | Ga0070697_1003317822 | 280 |
| 469 | 3300005545 | Ga0070695_100001304 | Ga0070695_1000013046 | 280 |
| 470 | 3300005545 | Ga0070695_100017447 | Ga0070695_1000174475 | 280 |
| 471 | 3300005546 | Ga0070696_100013541 | Ga0070696_1000135416 | 280 |
| 472 | 3300005547 | Ga0070693_100104562 | Ga0070693_1001045622 | 280 |
| 473 | 3300005615 | Ga0070702_100278558 | Ga0070702_1002785582 | 280 |
| 474 | 3300005618 | Ga0068864_100119092 | Ga0068864_1001190922 | 280 |
| 475 | 3300005843 | Ga0068860_100040136 | Ga0068860_1000401362 | 280 |
| 476 | 3300005844 | Ga0068862_100030858 | Ga0068862_1000308583 | 280 |
| 477 | 3300005983 | Ga0081540_1022242 | Ga0081540_10222423 | 280 |
| 478 | 3300005985 | Ga0081539_10062158 | Ga0081539_100621582 | 280 |
| 479 | 3300006173 | Ga0070716_100001131 | Ga0070716_1000011313 | 280 |
| 480 | 3300006844 | Ga0075428_100058129 | Ga0075428_1000581293 | 280 |
| 481 | 3300006844 | Ga0075428_100102262 | Ga0075428_1001022622 | 280 |
| 482 | 3300006844 | Ga0075428_100442042 | Ga0075428_1004420422 | 280 |
| 483 | 3300006846 | Ga0075430_100031603 | Ga0075430_1000316033 | 280 |
| 484 | 3300006846 | Ga0075430_100117832 | Ga0075430_1001178322 | 280 |
| 485 | 3300006847 | Ga0075431_100000049 | Ga0075431_1000000492 | 280 |
| 486 | 3300006847 | Ga0075431_100026093 | Ga0075431_1000260933 | 280 |
| 487 | 3300006847 | Ga0075431_100196809 | Ga0075431_1001968092 | 280 |
| 488 | 3300006852 | Ga0075433_10087235 | Ga0075433_100872352 | 280 |
| 489 | 3300006852 | Ga0075433_10139106 | Ga0075433_101391062 | 280 |
| 490 | 3300006871 | Ga0075434_100030642 | Ga0075434_1000306422 | 280 |
| 491 | 3300006880 | Ga0075429_100045351 | Ga0075429_1000453512 | 280 |
| 492 | 3300006914 | Ga0075436_100136418 | Ga0075436_1001364182 | 280 |
| 493 | 3300007076 | Ga0075435_100056712 | Ga0075435_1000567123 | 280 |
| 494 | 3300007076 | Ga0075435_100102142 | Ga0075435_1001021423 | 280 |
| 495 | 3300007076 | Ga0075435_100153526 | Ga0075435_1001535262 | 280 |
| 496 | 3300007265 | Ga0099794_10066651 | Ga0099794_100666512 | 280 |
| 497 | 3300007265 | Ga0099794_10172291 | Ga0099794_101722912 | 280 |
| 498 | 3300007265 | Ga0099794_10187721 | Ga0099794_101877211 | 280 |
| 499 | 3300009147 | Ga0114129_10000479 | Ga0114129_1000047927 | 280 |
| 500 | 3300009147 | Ga0114129_10034512 | Ga0114129_100345126 | 280 |
| 501 | 3300009147 | Ga0114129_10043947 | Ga0114129_100439474 | 280 |
| 502 | 3300009147 | Ga0114129_10306203 | Ga0114129_103062032 | 280 |
| 503 | 3300009147 | Ga0114129_10547089 | Ga0114129_105470892 | 280 |
| 504 | 3300009177 | Ga0105248_10143623 | Ga0105248_101436232 | 280 |
| 505 | 3300009177 | Ga0105248_10562011 | Ga0105248_105620112 | 280 |
| 506 | 3300014326 | Ga0157380_10117120 | Ga0157380_101171202 | 280 |
| 507 | 3300025905 | Ga0207685_10041883 | Ga0207685_100418832 | 280 |
| 508 | 3300025906 | Ga0207699_10204338 | Ga0207699_102043381 | 280 |
| 509 | 3300025910 | Ga0207684_10000105 | Ga0207684_10000105120 | 280 |
| 510 | 3300025910 | Ga0207684_10287016 | Ga0207684_102870162 | 280 |
| 511 | 3300025910 | Ga0207684_10343765 | Ga0207684_103437652 | 280 |
| 512 | 3300025922 | Ga0207646_10028308 | Ga0207646_100283083 | 280 |
| 513 | 3300025922 | Ga0207646_10230967 | Ga0207646_102309672 | 280 |
| 514 | 3300025935 | Ga0207709_10164113 | Ga0207709_101641132 | 280 |
| 515 | 3300025936 | Ga0207670_10265708 | Ga0207670_102657081 | 280 |
| 516 | 3300025938 | Ga0207704_10065568 | Ga0207704_100655682 | 280 |
| 517 | 3300025942 | Ga0207689_10005014 | Ga0207689_100050144 | 280 |
| 518 | 3300026035 | Ga0207703_10361750 | Ga0207703_103617502 | 280 |
| 519 | 3300026075 | Ga0207708_10274130 | Ga0207708_102741302 | 280 |
| 520 | 3300026089 | Ga0207648_10158257 | Ga0207648_101582572 | 280 |
| 521 | 3300026095 | Ga0207676_10068770 | Ga0207676_100687702 | 280 |
| 522 | 3300027424 | Ga0209984_1000895 | Ga0209984_10008952 | 280 |
| 523 | 3300027471 | Ga0209995_1000412 | Ga0209995_10004124 | 280 |
| 524 | 3300027526 | Ga0209968_1001582 | Ga0209968_10015823 | 280 |
| 525 | 3300027614 | Ga0209970_1000985 | Ga0209970_10009854 | 280 |
| 526 | 3300027665 | Ga0209983_1000242 | Ga0209983_10002426 | 280 |
| 527 | 3300027682 | Ga0209971_1000034 | Ga0209971_100003430 | 280 |
| 528 | 3300027695 | Ga0209966_1000109 | Ga0209966_100010915 | 280 |
| 529 | 3300027717 | Ga0209998_10000010 | Ga0209998_1000001066 | 280 |
| 530 | 3300027717 | Ga0209998_10032290 | Ga0209998_100322901 | 280 |
| 531 | 3300027876 | Ga0209974_10001764 | Ga0209974_100017646 | 280 |
| 532 | 3300028380 | Ga0268265_10082636 | Ga0268265_100826362 | 280 |
| 533 | 3300031548 | Ga0307408_100090312 | Ga0307408_1000903122 | 280 |
| 534 | 3300031901 | Ga0307406_10119893 | Ga0307406_101198932 | 280 |
| 535 | 3300035691 | Ga0373931_0038630 | Ga0373931_0038630_786_1730 | 280 |
| 536 | 3300037312 | Ga0395899_0009056 | Ga0395899_0009056_111_1055 | 280 |
| 537 | 3300037418 | Ga0395900_0008032 | Ga0395900_0008032_7618_8562 | 280 |
| 538 | 3300037418 | Ga0395900_0012079 | Ga0395900_0012079_1109_2026 | 280 |
| 539 | 3300037466 | Ga0395898_0001503 | Ga0395898_0001503_9921_10838 | 280 |
| 540 | 3300037466 | Ga0395898_0172039 | Ga0395898_0172039_160_1104 | 280 |
| 541 | 3300038443 | Ga0395901_0020242 | Ga0395901_0020242_5715_6659 | 280 |
| 542 | 3300038443 | Ga0395901_0274140 | Ga0395901_0274140_101_1018 | 280 |
| 543 | 3300042005 | Ga0439448_0010675 | Ga0439448_0010675_943_1944 | 280 |
| 544 | 3300042439 | Ga0439464_0007748 | Ga0439464_0007748_63_1013 | 280 |
| 545 | 3300042461 | Ga0439460_0025397 | Ga0439460_0025397_212_1213 | 280 |
| 546 | 3300042876 | Ga0451577_0053645 | Ga0451577_0053645_116_1117 | 280 |
| 547 | 3300042876 | Ga0451577_0095818 | Ga0451577_0095818_236_1180 | 280 |
| 548 | 3300044658 | Ga0466972_0000124 | Ga0466972_0000124_24956_25873 | 280 |
| 549 | 3300045051 | Ga0451576_0141592 | Ga0451576_0141592_1262_2263 | 280 |
| 550 | 3300045051 | Ga0451576_0235333 | Ga0451576_0235333_287_1231 | 280 |
| 551 | 3300046472 | Ga0495580_0000443 | Ga0495580_0000443_14605_15549 | 280 |
| 552 | 3300046528 | Ga0495642_0044113 | Ga0495642_0044113_62_1006 | 280 |
| 553 | 3300049570 | Ga0501033_0151829 | Ga0501033_0151829_98_1051 | 280 |
| 554 | 3300049574 | Ga0501038_0093353 | Ga0501038_0093353_833_1777 | 280 |
| 555 | 3300049575 | Ga0501039_0099966 | Ga0501039_0099966_947_1894 | 280 |
| 556 | 3300049577 | Ga0501041_0010986 | Ga0501041_0010986_746_1690 | 280 |
| 557 | 3300049578 | Ga0501042_0017554 | Ga0501042_0017554_817_1764 | 280 |
| 558 | 3300049578 | Ga0501042_0260962 | Ga0501042_0260962_11_949 | 280 |
| 559 | 3300049580 | Ga0501046_0007294 | Ga0501046_0007294_455_1399 | 280 |
| 560 | 3300049582 | Ga0501048_0068168 | Ga0501048_0068168_911_1858 | 280 |
| 561 | 3300049588 | Ga0501072_0136212 | Ga0501072_0136212_288_1286 | 280 |
| 562 | 3300049590 | Ga0501074_0173014 | Ga0501074_0173014_376_1320 | 280 |
| 563 | 3300049591 | Ga0501075_0005080 | Ga0501075_0005080_197_1141 | 280 |
| 564 | 3300049591 | Ga0501075_0173363 | Ga0501075_0173363_63_1010 | 280 |
| 565 | 3300049592 | Ga0501076_0002358 | Ga0501076_0002358_9845_10789 | 280 |
| 566 | 3300049593 | Ga0501077_0020850 | Ga0501077_0020850_1333_2277 | 280 |
| 567 | 3300049743 | Ga0501081_0000283 | Ga0501081_0000283_23913_24857 | 280 |
| 568 | 3300049743 | Ga0501081_0108144 | Ga0501081_0108144_222_1223 | 280 |
| 569 | 3300049744 | Ga0501083_0104628 | Ga0501083_0104628_83_1030 | 280 |
| 570 | 3300049822 | Ga0501035_0229657 | Ga0501035_0229657_584_1528 | 280 |
| 571 | 3300049824 | Ga0501045_0063021 | Ga0501045_0063021_802_1746 | 280 |
| 572 | 3300049824 | Ga0501045_0315466 | Ga0501045_0315466_153_1100 | 280 |
| 573 | 3300050507 | nmdc:mga05p37_18189_c1 | nmdc:mga05p37_18189_c1_110_1045 | 280 |
| 574 | 3300050507 | nmdc:mga05p37_18838_c1 | nmdc:mga05p37_18838_c1_3168_4103 | 280 |
| 575 | 3300050507 | nmdc:mga05p37_34635_c1 | nmdc:mga05p37_34635_c1_3535_4551 | 280 |
| 576 | 3300050507 | nmdc:mga05p37_4953_c1 | nmdc:mga05p37_4953_c1_10665_11600 | 280 |
| 577 | 3300050508 | nmdc:mga09592_121178_c1 | nmdc:mga09592_121178_c1_1176_2108 | 280 |
| 578 | 3300050509 | nmdc:mga0qj67_99141_c1 | nmdc:mga0qj67_99141_c1_240_1175 | 280 |
| 579 | 3300050510 | nmdc:mga06r32_101066_c1 | nmdc:mga06r32_101066_c1_1406_2341 | 280 |
| 580 | 3300050512 | nmdc:mga0n895_153208_c1 | nmdc:mga0n895_153208_c1_851_1795 | 280 |
| 581 | 3300050512 | nmdc:mga0n895_52844_c1 | nmdc:mga0n895_52844_c1_1242_2186 | 280 |
| 582 | 3300050513 | nmdc:mga0rr50_47184_c1 | nmdc:mga0rr50_47184_c1_149_1087 | 280 |
| 583 | 3300050513 | nmdc:mga0rr50_71815_c1 | nmdc:mga0rr50_71815_c1_926_1870 | 280 |
| 584 | 3300050515 | nmdc:mga0a205_126690_c1 | nmdc:mga0a205_126690_c1_621_1565 | 280 |
| 585 | 3300050515 | nmdc:mga0a205_245018_c1 | nmdc:mga0a205_245018_c1_38_976 | 280 |
| 586 | 3300050515 | nmdc:mga0a205_86822_c1 | nmdc:mga0a205_86822_c1_55_999 | 280 |
| 587 | 3300053093 | Ga0500651_0239377 | Ga0500651_0239377_97_1014 | 280 |
| 588 | 3300053737 | Ga0500601_000106 | Ga0500601_000106_7127_8044 | 280 |
| 589 | 3300054114 | Ga0501084_0049986 | Ga0501084_0049986_668_1612 | 280 |
| 590 | 3300054114 | Ga0501084_0210103 | Ga0501084_0210103_476_1429 | 280 |
| 591 | 3300055283 | Ga0500661_012999 | Ga0500661_012999_525_1442 | 280 |
| 592 | 3300060353 | Ga0501082_0006448 | Ga0501082_0006448_7774_8718 | 280 |
| 593 | 3300061734 | Ga0530510_0007383 | Ga0530510_0007383_2178_3122 | 280 |
| 594 | 3300061734 | Ga0530510_0089589 | Ga0530510_0089589_222_1169 | 280 |
| 595 | 3300061734 | Ga0530510_0123608 | Ga0530510_0123608_473_1402 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
154
340
0.95
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar