F467445

General Info

Members Datasets Scaffolds Average Seq Length
595 284 592 290

Family's Representative Sequence

Representative Sequence 3300025944|Ga0207661_10456742|Ga0207661_104567421
Length 342
Sequence LENRKTNMTWVDYLRSANWNQASGIGFCAYLLGCFAAGYYLVRSRLGEDVRELGSGSVGARNVGRILGKTGFLITLLCDFGKGALAVWIANHFTKDPRIVAFAMVAVVAGPFVYRVPIDEIDFKAKLKGPSGAHPLGTDDLGQDLLARMLYGGRISLAVGVTAMLIAITLFLCLPQLPLLLLLVYLFRDTLKKVLGPEMGVFMLVVVVIGGLRWMPVARLVRAQFLSLREKEFVEAARGLGAPPLRQVLRHILPNAVGPVIVAGTIDVAAAIIAESSLSFLGLGFPPDIPTWGRILFDAKDNLDFAPHWAIFPGTAIFLAVLSINYIGDGLRDALDPRKVLS

Samples

Sample ID Description Type Environment
1 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
2 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
187 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
188 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
189 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
190 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
191 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
192 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
193 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
210 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
227 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
228 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
248 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
254 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
263 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
269 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
270 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
274 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
275 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
276 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
277 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
278 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
279 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
280 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
281 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
284 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.5
Metatranscriptomes 0
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.51
Nodule 0.34
Rhizoplane 1.01
Rhizosphere 95.97
Stem 0
Stem Tuber 0
Unclassified 1.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001308 3300003215 Bacteria 14903
2 JGI26128J50194_1002768 3300003347 Bacteria 1153
3 Ga0065707_10209494 3300005295 Bacteria 1272
4 Ga0070658_10038297 3300005327 Bacteria 3867
5 Ga0070676_10031847 3300005328 Bacteria 3017
6 Ga0070676_10245427 3300005328 Bacteria 1193
7 Ga0070683_100044869 3300005329 Bacteria 4078
8 Ga0070670_100005552 3300005331 Bacteria 10639
9 Ga0068869_100001553 3300005334 Bacteria 13640
10 Ga0070680_100002617 3300005336 Bacteria 13323
11 Ga0070680_100010196 3300005336 Bacteria 7246
12 Ga0070680_100014854 3300005336 Bacteria 6091
13 Ga0070680_100055722 3300005336 Bacteria 3231
14 Ga0070680_100388472 3300005336 Bacteria 1189
15 Ga0070682_100001981 3300005337 Bacteria 11419
16 Ga0070660_100001885 3300005339 Bacteria 14442
17 Ga0070691_10005786 3300005341 Bacteria 5643
18 Ga0070691_10023890 3300005341 Bacteria 2839
19 Ga0070661_100002131 3300005344 Bacteria 13640
20 Ga0070661_100017942 3300005344 Bacteria 5026
21 Ga0070692_10001426 3300005345 Bacteria 8665
22 Ga0070673_100004910 3300005364 Bacteria 8518
23 Ga0070659_100005878 3300005366 Bacteria 8840
24 Ga0070659_100058363 3300005366 Bacteria 3045
25 Ga0070703_10004356 3300005406 Bacteria 3988
26 Ga0070714_100394417 3300005435 Bacteria 1307
27 Ga0070701_10016367 3300005438 Bacteria 3446
28 Ga0070711_100274400 3300005439 Bacteria 1332
29 Ga0070705_100002327 3300005440 Bacteria 9587
30 Ga0070705_100002757 3300005440 Bacteria 8765
31 Ga0070705_100006694 3300005440 Bacteria 5666
32 Ga0070705_100038426 3300005440 Bacteria 2708
33 Ga0070694_100008439 3300005444 Bacteria 6302
34 Ga0070694_100009548 3300005444 Bacteria 5952
35 Ga0070694_100018940 3300005444 Bacteria 4374
36 Ga0070708_100004512 3300005445 Bacteria 10956
37 Ga0070708_100039979 3300005445 Bacteria 4106
38 Ga0070708_100041712 3300005445 Bacteria 4024
39 Ga0070708_100095959 3300005445 Bacteria 2708
40 Ga0070663_100011705 3300005455 Bacteria 5519
41 Ga0070662_100030082 3300005457 Bacteria 3796
42 Ga0070662_100031994 3300005457 Bacteria 3696
43 Ga0070681_10018023 3300005458 Bacteria 7054
44 Ga0070681_10037353 3300005458 Bacteria 4874
45 Ga0070706_100011007 3300005467 Bacteria 8400
46 Ga0070706_100027880 3300005467 Bacteria 5194
47 Ga0070706_100062940 3300005467 Bacteria 3428
48 Ga0070706_100154277 3300005467 Bacteria 2143
49 Ga0070706_100221601 3300005467 Bacteria 1766
50 Ga0070707_100010096 3300005468 Bacteria 8787
51 Ga0070707_100040474 3300005468 Bacteria 4459
52 Ga0070707_100054661 3300005468 Bacteria 3828
53 Ga0070698_100009734 3300005471 Bacteria 10274
54 Ga0070698_100020081 3300005471 Bacteria 7003
55 Ga0070698_100057994 3300005471 Bacteria 3916
56 Ga0070698_100148256 3300005471 Bacteria 2295
57 Ga0070698_100409080 3300005471 Bacteria 1290
58 Ga0070699_100000309 3300005518 Bacteria 47299
59 Ga0070699_100028086 3300005518 Bacteria 4852
60 Ga0070699_100062989 3300005518 Bacteria 3215
61 Ga0070699_100114885 3300005518 Bacteria 2365
62 Ga0070699_100330107 3300005518 Bacteria 1372
63 Ga0070679_100006831 3300005530 Bacteria 10642
64 Ga0070679_100016329 3300005530 Bacteria 7157
65 Ga0070679_100030364 3300005530 Bacteria 5336
66 Ga0070684_100030738 3300005535 Bacteria 4567
67 Ga0070684_100084993 3300005535 Bacteria 2806
68 Ga0070697_100037165 3300005536 Bacteria 3934
69 Ga0070697_100331782 3300005536 Bacteria 1311
70 Ga0068853_100007116 3300005539 Bacteria 8948
71 Ga0068853_100108345 3300005539 Bacteria 2465
72 Ga0070695_100001304 3300005545 Bacteria 13773
73 Ga0070695_100015240 3300005545 Bacteria 4639
74 Ga0070695_100017447 3300005545 Bacteria 4353
75 Ga0070695_100020539 3300005545 Bacteria 4032
76 Ga0070695_100069499 3300005545 Bacteria 2302
77 Ga0070696_100012586 3300005546 Bacteria 5680
78 Ga0070696_100013541 3300005546 Bacteria 5474
79 Ga0070696_100052871 3300005546 Bacteria 2826
80 Ga0070693_100000151 3300005547 Bacteria 31642
81 Ga0070693_100104562 3300005547 Bacteria 1731
82 Ga0070704_100001890 3300005549 Bacteria 11548
83 Ga0070704_100002130 3300005549 Bacteria 11015
84 Ga0070704_100002499 3300005549 Bacteria 10342
85 Ga0070704_100003768 3300005549 Bacteria 8731
86 Ga0068855_100035290 3300005563 Bacteria 5957
87 Ga0070664_100085235 3300005564 Bacteria 2728
88 Ga0068857_100195993 3300005577 Bacteria 1840
89 Ga0068854_100015767 3300005578 Bacteria 5018
90 Ga0068854_100022692 3300005578 Bacteria 4281
91 Ga0068856_100006441 3300005614 Bacteria 11516
92 Ga0070702_100157662 3300005615 Bacteria 1463
93 Ga0070702_100278558 3300005615 Bacteria 1147
94 Ga0068852_100073525 3300005616 Bacteria 3007
95 Ga0068852_100440251 3300005616 Bacteria 1288
96 Ga0068859_100008495 3300005617 Bacteria 10392
97 Ga0068859_100039908 3300005617 Bacteria 4711
98 Ga0068859_100093010 3300005617 Bacteria 3067
99 Ga0068864_100007539 3300005618 Bacteria 8964
100 Ga0068864_100119092 3300005618 Bacteria 2359
101 Ga0068866_10009741 3300005718 Bacteria 4091
102 Ga0068861_100001943 3300005719 Bacteria 13319
103 Ga0068861_100016833 3300005719 Bacteria 5180
104 Ga0068851_10027390 3300005834 Bacteria 2809
105 Ga0068870_10003943 3300005840 Bacteria 6335
106 Ga0068863_100003131 3300005841 Bacteria 16331
107 Ga0068863_100009810 3300005841 Bacteria 9329
108 Ga0068858_100001019 3300005842 Bacteria 28891
109 Ga0068858_100258974 3300005842 Bacteria 1653
110 Ga0068860_100000932 3300005843 Bacteria 32353
111 Ga0068860_100014294 3300005843 Bacteria 7784
112 Ga0068860_100040136 3300005843 Bacteria 4475
113 Ga0068862_100030858 3300005844 Bacteria 4519
114 Ga0081455_10000138 3300005937 Bacteria 85156
115 Ga0081540_1000543 3300005983 Bacteria 36549
116 Ga0081540_1006899 3300005983 Bacteria 8191
117 Ga0081540_1008693 3300005983 Bacteria 7069
118 Ga0081540_1022242 3300005983 Bacteria 3746
119 Ga0081540_1094164 3300005983 Bacteria 1309
120 Ga0081539_10000002 3300005985 Bacteria 601032
121 Ga0081539_10062158 3300005985 Bacteria 2042
122 Ga0070716_100001131 3300006173 Bacteria 11744
123 Ga0070716_100027582 3300006173 Bacteria 3053
124 Ga0068871_100026984 3300006358 Bacteria 4487
125 Ga0075428_100000227 3300006844 Bacteria 54930
126 Ga0075428_100058129 3300006844 Bacteria 4234
127 Ga0075428_100098276 3300006844 Bacteria 3192
128 Ga0075428_100102262 3300006844 Bacteria 3125
129 Ga0075428_100442042 3300006844 Bacteria 1393
130 Ga0075430_100000307 3300006846 Bacteria 34681
131 Ga0075430_100005095 3300006846 Bacteria 11056
132 Ga0075430_100031603 3300006846 Bacteria 4493
133 Ga0075430_100117832 3300006846 Bacteria 2213
134 Ga0075431_100000049 3300006847 Bacteria 63960
135 Ga0075431_100000414 3300006847 Bacteria 34710
136 Ga0075431_100005700 3300006847 Bacteria 12306
137 Ga0075431_100025974 3300006847 Bacteria 6003
138 Ga0075431_100026093 3300006847 Bacteria 5991
139 Ga0075431_100196809 3300006847 Bacteria 2063
140 Ga0075431_100517045 3300006847 Bacteria 1183
141 Ga0075433_10008156 3300006852 Bacteria 8341
142 Ga0075433_10020195 3300006852 Bacteria 5565
143 Ga0075433_10087235 3300006852 Bacteria 2756
144 Ga0075433_10139106 3300006852 Bacteria 2158
145 Ga0075433_10149641 3300006852 Bacteria 2076
146 Ga0075434_100007335 3300006871 Bacteria 10205
147 Ga0075434_100030642 3300006871 Bacteria 5298
148 Ga0075434_100032026 3300006871 Bacteria 5183
149 Ga0075434_100080138 3300006871 Bacteria 3261
150 Ga0075434_100084090 3300006871 Bacteria 3181
151 Ga0075429_100000032 3300006880 Bacteria 64062
152 Ga0075429_100000080 3300006880 Bacteria 49555
153 Ga0075429_100045351 3300006880 Bacteria 3825
154 Ga0075429_100130750 3300006880 Bacteria 2196
155 Ga0068865_100072769 3300006881 Bacteria 2442
156 Ga0075436_100024505 3300006914 Bacteria 4147
157 Ga0075436_100050078 3300006914 Bacteria 2882
158 Ga0075436_100079284 3300006914 Bacteria 2275
159 Ga0075436_100136418 3300006914 Bacteria 1723
160 Ga0097620_100008495 3300006931 Bacteria 10392
161 Ga0097620_100039908 3300006931 Bacteria 4711
162 Ga0097620_100093016 3300006931 Bacteria 3067
163 Ga0075435_100016916 3300007076 Bacteria 5506
164 Ga0075435_100032114 3300007076 Bacteria 4144
165 Ga0075435_100040810 3300007076 Bacteria 3707
166 Ga0075435_100056712 3300007076 Bacteria 3167
167 Ga0075435_100074962 3300007076 Bacteria 2769
168 Ga0075435_100102142 3300007076 Bacteria 2376
169 Ga0075435_100153526 3300007076 Bacteria 1937
170 Ga0075435_100245671 3300007076 Bacteria 1523
171 Ga0099794_10066651 3300007265 Bacteria 1757
172 Ga0099794_10147116 3300007265 Bacteria 1195
173 Ga0099794_10172291 3300007265 Bacteria 1103
174 Ga0099794_10187721 3300007265 Bacteria 1056
175 Ga0105240_10010045 3300009093 Bacteria 13330
176 Ga0105240_10570672 3300009093 Bacteria 1249
177 Ga0105240_10578691 3300009093 Bacteria 1239
178 Ga0111539_10037354 3300009094 Bacteria 5865
179 Ga0111539_10125193 3300009094 Bacteria 3012
180 Ga0111539_10624416 3300009094 Bacteria 1255
181 Ga0114129_10000479 3300009147 Bacteria 48277
182 Ga0114129_10002723 3300009147 Bacteria 24628
183 Ga0114129_10005731 3300009147 Bacteria 17601
184 Ga0114129_10028104 3300009147 Bacteria 7968
185 Ga0114129_10034512 3300009147 Bacteria 7146
186 Ga0114129_10038302 3300009147 Bacteria 6764
187 Ga0114129_10043947 3300009147 Bacteria 6285
188 Ga0114129_10056587 3300009147 Bacteria 5492
189 Ga0114129_10157112 3300009147 Bacteria 3109
190 Ga0114129_10306203 3300009147 Bacteria 2116
191 Ga0114129_10421519 3300009147 Bacteria 1755
192 Ga0114129_10547089 3300009147 Bacteria 1506
193 Ga0105241_10001720 3300009174 Bacteria 16652
194 Ga0105248_10143623 3300009177 Bacteria 2693
195 Ga0105248_10282859 3300009177 Bacteria 1867
196 Ga0105248_10562011 3300009177 Bacteria 1287
197 Ga0105238_10022379 3300009551 Bacteria 6441
198 Ga0157373_10001536 3300013100 Bacteria 17616
199 Ga0157370_10031729 3300013104 Bacteria 5165
200 Ga0157370_10175127 3300013104 Bacteria 1994
201 Ga0157378_10428147 3300013297 Bacteria 1309
202 Ga0157372_10008094 3300013307 Bacteria 11181
203 Ga0157372_10075034 3300013307 Bacteria 3814
204 Ga0157380_10026243 3300014326 Bacteria 4422
205 Ga0157380_10117120 3300014326 Bacteria 2250
206 Ga0157380_10330684 3300014326 Bacteria 1417
207 Ga0182008_10119018 3300014497 Bacteria 1312
208 Ga0157379_10042544 3300014968 Bacteria 4056
209 Ga0213874_10028151 3300021377 Bacteria 1604
210 Ga0209025_1047681 3300025294 Bacteria 1746
211 Ga0207656_10057804 3300025321 Bacteria 1693
212 Ga0207653_10008663 3300025885 Bacteria 3173
213 Ga0207688_10107031 3300025901 Bacteria 1620
214 Ga0207680_10002621 3300025903 Bacteria 8397
215 Ga0207685_10041883 3300025905 Bacteria 1716
216 Ga0207699_10204338 3300025906 Bacteria 1340
217 Ga0207645_10000858 3300025907 Bacteria 25253
218 Ga0207645_10001649 3300025907 Bacteria 18179
219 Ga0207643_10001314 3300025908 Bacteria 14435
220 Ga0207684_10000105 3300025910 Bacteria 160905
221 Ga0207684_10127474 3300025910 Bacteria 2184
222 Ga0207684_10129732 3300025910 Bacteria 2164
223 Ga0207684_10287016 3300025910 Bacteria 1419
224 Ga0207684_10343765 3300025910 Bacteria 1285
225 Ga0207707_10000169 3300025912 Bacteria 68558
226 Ga0207707_10038106 3300025912 Bacteria 4200
227 Ga0207707_10055003 3300025912 Bacteria 3463
228 Ga0207695_10086041 3300025913 Bacteria 3171
229 Ga0207695_10396238 3300025913 Bacteria 1265
230 Ga0207693_10059818 3300025915 Bacteria 2985
231 Ga0207693_10060239 3300025915 Bacteria 2973
232 Ga0207660_10000853 3300025917 Bacteria 20092
233 Ga0207660_10016991 3300025917 Bacteria 4827
234 Ga0207660_10026389 3300025917 Bacteria 3956
235 Ga0207660_10108347 3300025917 Bacteria 2086
236 Ga0207662_10025200 3300025918 Bacteria 3425
237 Ga0207657_10000230 3300025919 Bacteria 58597
238 Ga0207649_10003044 3300025920 Bacteria 9231
239 Ga0207649_10010768 3300025920 Bacteria 5028
240 Ga0207652_10000263 3300025921 Bacteria 54913
241 Ga0207652_10309299 3300025921 Bacteria 1426
242 Ga0207652_10442620 3300025921 Bacteria 1171
243 Ga0207646_10028308 3300025922 Bacteria 5102
244 Ga0207646_10029644 3300025922 Bacteria 4969
245 Ga0207646_10049095 3300025922 Bacteria 3780
246 Ga0207646_10230967 3300025922 Bacteria 1671
247 Ga0207681_10000549 3300025923 Bacteria 25898
248 Ga0207650_10003760 3300025925 Bacteria 10378
249 Ga0207659_10166304 3300025926 Bacteria 1736
250 Ga0207659_10271704 3300025926 Bacteria 1383
251 Ga0207687_10018259 3300025927 Bacteria 4628
252 Ga0207700_10310263 3300025928 Bacteria 1364
253 Ga0207690_10002921 3300025932 Bacteria 10300
254 Ga0207706_10010067 3300025933 Bacteria 8659
255 Ga0207709_10164113 3300025935 Bacteria 1552
256 Ga0207670_10154874 3300025936 Bacteria 1705
257 Ga0207670_10265708 3300025936 Bacteria 1332
258 Ga0207704_10003465 3300025938 Bacteria 7174
259 Ga0207704_10065568 3300025938 Bacteria 2274
260 Ga0207711_10049449 3300025941 Bacteria 3600
261 Ga0207689_10000006 3300025942 Bacteria 133746
262 Ga0207689_10001671 3300025942 Bacteria 21060
263 Ga0207689_10005014 3300025942 Bacteria 11926
264 Ga0207661_10038163 3300025944 Bacteria 3762
265 Ga0207661_10456742 3300025944 Bacteria 1164
266 Ga0207679_10001904 3300025945 Bacteria 12958
267 Ga0207679_10038287 3300025945 Bacteria 3415
268 Ga0207667_10010274 3300025949 Bacteria 10956
269 Ga0207667_10104934 3300025949 Bacteria 2915
270 Ga0207712_10001342 3300025961 Bacteria 16857
271 Ga0207658_10000522 3300025986 Bacteria 35086
272 Ga0207703_10000176 3300026035 Bacteria 74238
273 Ga0207703_10009198 3300026035 Bacteria 7769
274 Ga0207703_10361750 3300026035 Bacteria 1338
275 Ga0207639_10009451 3300026041 Bacteria 6728
276 Ga0207639_10061917 3300026041 Bacteria 2892
277 Ga0207678_10112224 3300026067 Bacteria 2325
278 Ga0207708_10043236 3300026075 Bacteria 3434
279 Ga0207708_10185384 3300026075 Bacteria 1653
280 Ga0207708_10274130 3300026075 Bacteria 1365
281 Ga0207702_10003271 3300026078 Bacteria 14957
282 Ga0207702_10039619 3300026078 Bacteria 3950
283 Ga0207641_10004166 3300026088 Bacteria 12600
284 Ga0207648_10121943 3300026089 Bacteria 2292
285 Ga0207648_10158257 3300026089 Bacteria 2000
286 Ga0207676_10008475 3300026095 Bacteria 7310
287 Ga0207676_10068770 3300026095 Bacteria 2834
288 Ga0207674_10183266 3300026116 Bacteria 2045
289 Ga0207675_100000483 3300026118 Bacteria 38723
290 Ga0207675_100031776 3300026118 Bacteria 4918
291 Ga0207698_10016249 3300026142 Bacteria 5012
292 Ga0209984_1000895 3300027424 Bacteria 3189
293 Ga0209995_1000412 3300027471 Bacteria 6646
294 Ga0209968_1001582 3300027526 Bacteria 3446
295 Ga0209970_1000985 3300027614 Bacteria 5065
296 Ga0209983_1000242 3300027665 Bacteria 11097
297 Ga0209971_1000034 3300027682 Bacteria 47898
298 Ga0209966_1000109 3300027695 Bacteria 36391
299 Ga0209998_10000010 3300027717 Bacteria 98452
300 Ga0209998_10032290 3300027717 Bacteria 1163
301 Ga0209974_10001764 3300027876 Bacteria 7885
302 Ga0209974_10027690 3300027876 Bacteria 1875
303 Ga0207428_10013876 3300027907 Bacteria 7018
304 Ga0268265_10002714 3300028380 Bacteria 13103
305 Ga0268265_10082636 3300028380 Bacteria 2540
306 Ga0268265_10189844 3300028380 Bacteria 1773
307 Ga0268264_10000951 3300028381 Bacteria 29911
308 Ga0268264_10074115 3300028381 Bacteria 2890
309 Ga0265325_10125297 3300031241 Bacteria 1235
310 Ga0265340_10014560 3300031247 Bacteria 4104
311 Ga0307509_10198022 3300031507 Bacteria 1850
312 Ga0307408_100090312 3300031548 Bacteria 2311
313 Ga0307408_100149550 3300031548 Bacteria 1842
314 Ga0265314_10000822 3300031711 Bacteria 36961
315 Ga0265342_10085635 3300031712 Bacteria 1813
316 Ga0307516_10072372 3300031730 Bacteria 3307
317 Ga0307405_10200194 3300031731 Bacteria 1450
318 Ga0307413_10119711 3300031824 Bacteria 1781
319 Ga0307406_10119893 3300031901 Bacteria 1827
320 Ga0307412_10362663 3300031911 Bacteria 1167
321 Ga0307416_100004427 3300032002 Bacteria 8466
322 Ga0307416_100274746 3300032002 Bacteria 1657
323 Ga0307510_10063262 3300033180 Bacteria 3770
324 Ga0373934_0001390 3300035086 Bacteria 8823
325 Ga0373949_0017211 3300035090 Bacteria 1627
326 Ga0373932_0059866 3300035112 Bacteria 1154
327 Ga0373936_0094211 3300035113 Bacteria 1258
328 Ga0373939_0071043 3300035114 Bacteria 1133
329 Ga0373953_0000426 3300035117 Bacteria 11483
330 Ga0373954_0000139 3300035118 Bacteria 25320
331 Ga0373956_0001236 3300035119 Bacteria 10570
332 Ga0373957_0054999 3300035120 Bacteria 1529
333 Ga0373960_0089920 3300035121 Bacteria 980
334 Ga0373943_0036609 3300035170 Bacteria 2351
335 Ga0373955_0000597 3300035172 Bacteria 15391
336 Ga0373961_0017716 3300035241 Bacteria 1852
337 Ga0373962_0055380 3300035242 Bacteria 1152
338 Ga0373924_0012050 3300035410 Bacteria 3223
339 Ga0373931_0002948 3300035691 Bacteria 7596
340 Ga0373931_0012972 3300035691 Bacteria 4047
341 Ga0373931_0038630 3300035691 Bacteria 2498
342 Ga0373935_0249287 3300035692 Bacteria 1242
343 Ga0373927_0007782 3300035695 Bacteria 7249
344 Ga0373927_0014475 3300035695 Bacteria 5219
345 Ga0373933_0000483 3300035724 Bacteria 24839
346 Ga0373925_0045346 3300037068 Bacteria 3266
347 Ga0373925_0135517 3300037068 Bacteria 1924
348 Ga0395899_0009056 3300037312 Bacteria 7651
349 Ga0395900_0008032 3300037418 Bacteria 10861
350 Ga0395900_0012079 3300037418 Bacteria 8825
351 Ga0395898_0001503 3300037466 Bacteria 32214
352 Ga0395898_0172039 3300037466 Bacteria 2070
353 Ga0395901_0020242 3300038443 Bacteria 6811
354 Ga0395901_0274140 3300038443 Bacteria 1754
355 Ga0436365_0212285 3300039437 Bacteria 5469
356 Ga0436365_0821657 3300039437 Bacteria 2351
357 Ga0436362_1210859 3300039453 Bacteria 4461
358 Ga0439431_0002062 3300041997 Bacteria 4448
359 Ga0439448_0000296 3300042005 Bacteria 10945
360 Ga0439448_0010675 3300042005 Bacteria 2727
361 Ga0439455_0044582 3300042012 Bacteria 1144
362 Ga0450919_004622 3300042121 Bacteria 1678
363 Ga0439435_0005572 3300042436 Bacteria 2776
364 Ga0439459_0000355 3300042438 Bacteria 5651
365 Ga0439464_0007748 3300042439 Bacteria 2810
366 Ga0439460_0002563 3300042461 Bacteria 4386
367 Ga0439460_0025397 3300042461 Bacteria 1649
368 Ga0451577_0053645 3300042876 Bacteria 3598
369 Ga0451577_0095818 3300042876 Bacteria 2650
370 Ga0466972_0000124 3300044658 Bacteria 65163
371 Ga0453683_0173520 3300044673 Bacteria 1366
372 Ga0453683_0286187 3300044673 Bacteria 1053
373 Ga0451576_0077245 3300045051 Bacteria 3465
374 Ga0451576_0083244 3300045051 Bacteria 3328
375 Ga0451576_0141592 3300045051 Bacteria 2507
376 Ga0451576_0235333 3300045051 Bacteria 1913
377 Ga0495592_0001466 3300046454 Bacteria 16413
378 Ga0495603_0025030 3300046455 Bacteria 3610
379 Ga0495629_0000548 3300046459 Bacteria 30813
380 Ga0495651_0003160 3300046462 Bacteria 12682
381 Ga0495653_0000621 3300046463 Bacteria 27177
382 Ga0495580_0000443 3300046472 Bacteria 34172
383 Ga0495594_0183542 3300046499 Bacteria 1191
384 Ga0495608_0002190 3300046511 Bacteria 14104
385 Ga0495618_0139786 3300046514 Bacteria 1549
386 Ga0495628_0018073 3300046516 Bacteria 5847
387 Ga0495648_0106702 3300046524 Bacteria 1533
388 Ga0495642_0044113 3300046528 Bacteria 1820
389 Ga0495652_0005425 3300046529 Bacteria 12014
390 Ga0495640_0008049 3300046533 Bacteria 8283
391 Ga0495587_0001777 3300046536 Bacteria 14419
392 Ga0495645_0055831 3300046543 Bacteria 2867
393 Ga0495667_0000853 3300046559 Bacteria 19711
394 Ga0495634_0008025 3300046642 Bacteria 7880
395 Ga0495635_0000485 3300046663 Bacteria 25077
396 Ga0495657_0004077 3300046675 Bacteria 11715
397 Ga0495599_0000942 3300046678 Bacteria 16269
398 Ga0495623_0015435 3300046679 Bacteria 4937
399 Ga0495646_0013023 3300046680 Bacteria 5288
400 Ga0495613_0117506 3300046689 Bacteria 1912
401 Ga0495600_0002111 3300046809 Bacteria 11243
402 Ga0495604_0003566 3300047317 Bacteria 12406
403 Ga0495674_0054183 3300047319 Bacteria 3523
404 Ga0495680_0001218 3300047322 Bacteria 28201
405 Ga0495675_0000987 3300047444 Bacteria 17273
406 Ga0495684_0001700 3300047471 Bacteria 17689
407 Ga0495593_0006674 3300047673 Bacteria 6754
408 Ga0495602_0035011 3300048088 Bacteria 4687
409 Ga0496102_0081173 3300048905 Bacteria 2989
410 Ga0496102_0632047 3300048905 Bacteria 994
411 Ga0496106_0341759 3300048909 Bacteria 1202
412 Ga0496107_0192028 3300048910 Bacteria 1517
413 Ga0496108_0051908 3300048911 Bacteria 3435
414 Ga0496110_0197959 3300048913 Bacteria 1825
415 Ga0501031_0023681 3300049568 Bacteria 4002
416 Ga0501031_0141746 3300049568 Bacteria 1571
417 Ga0501031_0209678 3300049568 Bacteria 1270
418 Ga0501032_0090473 3300049569 Bacteria 2031
419 Ga0501033_0151829 3300049570 Bacteria 1671
420 Ga0501034_0048692 3300049571 Bacteria 4277
421 Ga0501036_0002690 3300049572 Bacteria 14026
422 Ga0501036_0325849 3300049572 Bacteria 1283
423 Ga0501038_0052165 3300049574 Bacteria 3527
424 Ga0501038_0068158 3300049574 Bacteria 3025
425 Ga0501038_0093353 3300049574 Bacteria 2518
426 Ga0501038_0181327 3300049574 Bacteria 1699
427 Ga0501039_0036427 3300049575 Bacteria 3797
428 Ga0501039_0088078 3300049575 Bacteria 2419
429 Ga0501039_0099966 3300049575 Bacteria 2264
430 Ga0501039_0144931 3300049575 Bacteria 1866
431 Ga0501040_0001684 3300049576 Bacteria 14163
432 Ga0501040_0005541 3300049576 Bacteria 8172
433 Ga0501040_0180246 3300049576 Bacteria 1497
434 Ga0501040_0358115 3300049576 Bacteria 1045
435 Ga0501041_0010986 3300049577 Bacteria 5346
436 Ga0501041_0056990 3300049577 Bacteria 2388
437 Ga0501041_0083457 3300049577 Bacteria 1969
438 Ga0501041_0224906 3300049577 Bacteria 1178
439 Ga0501042_0017554 3300049578 Bacteria 4937
440 Ga0501042_0059310 3300049578 Bacteria 2732
441 Ga0501042_0095214 3300049578 Bacteria 2139
442 Ga0501042_0260962 3300049578 Bacteria 1251
443 Ga0501046_0000455 3300049580 Bacteria 40945
444 Ga0501046_0002560 3300049580 Bacteria 17018
445 Ga0501046_0007294 3300049580 Bacteria 9725
446 Ga0501046_0129135 3300049580 Bacteria 1917
447 Ga0501048_0001071 3300049582 Bacteria 20517
448 Ga0501048_0021169 3300049582 Bacteria 4761
449 Ga0501048_0068168 3300049582 Bacteria 2514
450 Ga0501048_0077516 3300049582 Bacteria 2346
451 Ga0501048_0147363 3300049582 Bacteria 1665
452 Ga0501068_0022873 3300049584 Bacteria 3659
453 Ga0501068_0023945 3300049584 Bacteria 3581
454 Ga0501068_0043184 3300049584 Bacteria 2712
455 Ga0501068_0130594 3300049584 Bacteria 1571
456 Ga0501069_0069463 3300049585 Bacteria 1972
457 Ga0501070_0034376 3300049586 Bacteria 4239
458 Ga0501070_0460725 3300049586 Bacteria 1024
459 Ga0501071_0003914 3300049587 Bacteria 9384
460 Ga0501071_0038668 3300049587 Bacteria 3410
461 Ga0501071_0081863 3300049587 Bacteria 2363
462 Ga0501071_0097418 3300049587 Bacteria 2166
463 Ga0501072_0033613 3300049588 Bacteria 4019
464 Ga0501072_0136212 3300049588 Bacteria 1957
465 Ga0501074_0001262 3300049590 Bacteria 16710
466 Ga0501074_0047869 3300049590 Bacteria 3089
467 Ga0501074_0173014 3300049590 Bacteria 1541
468 Ga0501075_0005080 3300049591 Bacteria 8991
469 Ga0501075_0054298 3300049591 Bacteria 3014
470 Ga0501075_0173363 3300049591 Bacteria 1646
471 Ga0501076_0001859 3300049592 Bacteria 14371
472 Ga0501076_0002358 3300049592 Bacteria 12926
473 Ga0501076_0015860 3300049592 Bacteria 5701
474 Ga0501076_0052572 3300049592 Bacteria 3227
475 Ga0501076_0126721 3300049592 Bacteria 2069
476 Ga0501076_0321171 3300049592 Bacteria 1270
477 Ga0501077_0020850 3300049593 Bacteria 4149
478 Ga0501077_0027843 3300049593 Bacteria 3589
479 Ga0501077_0034917 3300049593 Bacteria 3201
480 Ga0501077_0049259 3300049593 Bacteria 2678
481 Ga0501077_0096397 3300049593 Bacteria 1875
482 Ga0501077_0155376 3300049593 Bacteria 1452
483 Ga0501077_0183364 3300049593 Bacteria 1330
484 Ga0501077_0185949 3300049593 Bacteria 1320
485 Ga0501079_0003697 3300049741 Bacteria 11280
486 Ga0501079_0005279 3300049741 Bacteria 9608
487 Ga0501079_0033373 3300049741 Bacteria 3959
488 Ga0501079_0229362 3300049741 Bacteria 1451
489 Ga0501080_0003420 3300049742 Bacteria 14000
490 Ga0501080_0248240 3300049742 Bacteria 1623
491 Ga0501081_0000283 3300049743 Bacteria 26838
492 Ga0501081_0000778 3300049743 Bacteria 18695
493 Ga0501081_0002562 3300049743 Bacteria 11477
494 Ga0501081_0009596 3300049743 Bacteria 6312
495 Ga0501081_0051141 3300049743 Bacteria 2849
496 Ga0501081_0071185 3300049743 Bacteria 2424
497 Ga0501081_0108144 3300049743 Bacteria 1972
498 Ga0501081_0303575 3300049743 Bacteria 1171
499 Ga0501083_0018129 3300049744 Bacteria 4907
500 Ga0501083_0080109 3300049744 Bacteria 2166
501 Ga0501083_0096551 3300049744 Bacteria 1950
502 Ga0501083_0104628 3300049744 Bacteria 1865
503 Ga0501035_0229657 3300049822 Bacteria 1582
504 Ga0501044_0079300 3300049823 Bacteria 3327
505 Ga0501045_0000268 3300049824 Bacteria 30295
506 Ga0501045_0002468 3300049824 Bacteria 12569
507 Ga0501045_0063021 3300049824 Bacteria 2720
508 Ga0501045_0063103 3300049824 Bacteria 2718
509 Ga0501045_0064879 3300049824 Bacteria 2681
510 Ga0501045_0315466 3300049824 Bacteria 1163
511 Ga0501045_0377558 3300049824 Bacteria 1055
512 nmdc:mga05p37_18189_c1 3300050507 Bacteria 8491
513 nmdc:mga05p37_18838_c1 3300050507 Bacteria 8342
514 nmdc:mga05p37_26343_c1 3300050507 Bacteria 7072
515 nmdc:mga05p37_30562_c1 3300050507 Bacteria 6572
516 nmdc:mga05p37_34635_c1 3300050507 Bacteria 6186
517 nmdc:mga05p37_3869_c1 3300050507 Bacteria 17511
518 nmdc:mga05p37_421095_c1 3300050507 Bacteria 1554
519 nmdc:mga05p37_45318_c1 3300050507 Bacteria 5410
520 nmdc:mga05p37_4953_c1 3300050507 Bacteria 15605
521 nmdc:mga05p37_5718_c1 3300050507 Bacteria 14629
522 nmdc:mga05p37_62965_c1 3300050507 Bacteria 4565
523 nmdc:mga05p37_803_c1 3300050507 Bacteria 35042
524 nmdc:mga05p37_9142_c1 3300050507 Bacteria 11715
525 nmdc:mga09592_121178_c1 3300050508 Bacteria 2247
526 nmdc:mga09592_19019_c1 3300050508 Bacteria 5637
527 nmdc:mga09592_44_c1 3300050508 Bacteria 69981
528 nmdc:mga09592_95622_c1 3300050508 Bacteria 2541
529 nmdc:mga0qj67_3320_c1 3300050509 Bacteria 11598
530 nmdc:mga0qj67_7226_c1 3300050509 Bacteria 8203
531 nmdc:mga0qj67_99141_c1 3300050509 Bacteria 2347
532 nmdc:mga06r32_101066_c1 3300050510 Bacteria 2830
533 nmdc:mga06r32_104585_c1 3300050510 Bacteria 2781
534 nmdc:mga06r32_3922_c1 3300050510 Bacteria 13341
535 nmdc:mga06r32_7269_c2 3300050510 Bacteria 5791
536 nmdc:mga08y16_19461_c1 3300050511 Bacteria 6151
537 nmdc:mga08y16_616723_c1 3300050511 Bacteria 1092
538 nmdc:mga0n895_139393_c1 3300050512 Bacteria 2453
539 nmdc:mga0n895_153208_c1 3300050512 Bacteria 2336
540 nmdc:mga0n895_215906_c1 3300050512 Bacteria 1948
541 nmdc:mga0n895_33637_c1 3300050512 Bacteria 4929
542 nmdc:mga0n895_36011_c1 3300050512 Bacteria 4776
543 nmdc:mga0n895_5041_c1 3300050512 Bacteria 10964
544 nmdc:mga0n895_52844_c1 3300050512 Bacteria 3990
545 nmdc:mga0rr50_113522_c1 3300050513 Bacteria 2147
546 nmdc:mga0rr50_1492_c1 3300050513 Bacteria 12851
547 nmdc:mga0rr50_16374_c1 3300050513 Bacteria 4923
548 nmdc:mga0rr50_25001_c1 3300050513 Bacteria 4147
549 nmdc:mga0rr50_47184_c1 3300050513 Bacteria 3176
550 nmdc:mga0rr50_71815_c1 3300050513 Bacteria 2642
551 nmdc:mga0rr50_84476_c1 3300050513 Bacteria 2458
552 nmdc:mga08x19_16628_c1 3300050514 Bacteria 4489
553 nmdc:mga08x19_22684_c1 3300050514 Bacteria 3887
554 nmdc:mga08x19_67844_c1 3300050514 Bacteria 2321
555 nmdc:mga0a205_118610_c2 3300050515 Bacteria 1543
556 nmdc:mga0a205_126690_c1 3300050515 Bacteria 2126
557 nmdc:mga0a205_245018_c1 3300050515 Bacteria 1673
558 nmdc:mga0a205_37940_c1 3300050515 Bacteria 4634
559 nmdc:mga0a205_40853_c1 3300050515 Bacteria 4467
560 nmdc:mga0a205_47156_c1 3300050515 Bacteria 4157
561 nmdc:mga0a205_86822_c1 3300050515 Bacteria 3022
562 nmdc:mga0a205_99331_c1 3300050515 Bacteria 2809
563 Ga0495601_0034079 3300053077 Bacteria 3174
564 Ga0500635_0006203 3300053080 Bacteria 3182
565 Ga0495595_0000228 3300053084 Bacteria 22263
566 Ga0500651_0239377 3300053093 Bacteria 1059
567 Ga0500590_150388 3300053148 Bacteria 1051
568 Ga0500603_000055 3300053150 Bacteria 28292
569 Ga0500637_0016594 3300053178 Bacteria 3927
570 Ga0500601_000106 3300053737 Bacteria 17299
571 Ga0501084_0004829 3300054114 Bacteria 11017
572 Ga0501084_0025561 3300054114 Bacteria 4926
573 Ga0501084_0049986 3300054114 Bacteria 3500
574 Ga0501084_0050553 3300054114 Bacteria 3479
575 Ga0501084_0210103 3300054114 Bacteria 1642
576 Ga0501084_0265506 3300054114 Bacteria 1449
577 Ga0501084_0337734 3300054114 Bacteria 1272
578 Ga0500661_012999 3300055283 Bacteria 1501
579 Ga0501082_0002933 3300060353 Bacteria 14885
580 Ga0501082_0003776 3300060353 Bacteria 13236
581 Ga0501082_0006448 3300060353 Bacteria 10176
582 Ga0501082_0051435 3300060353 Bacteria 3551
583 Ga0501082_0095716 3300060353 Bacteria 2566
584 Ga0530510_0003893 3300061734 Bacteria 10293
585 Ga0530510_0007383 3300061734 Bacteria 7650
586 Ga0530510_0014446 3300061734 Bacteria 5567
587 Ga0530510_0089589 3300061734 Bacteria 2243
588 Ga0530510_0123608 3300061734 Bacteria 1901
589 Ga0530510_0124207 3300061734 Bacteria 1896
590 Ga0530510_0131915 3300061734 Bacteria 1838
591 Ga0530510_0165802 3300061734 Bacteria 1635
592 Ga0530510_0246265 3300061734 Bacteria 1331

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005617 Ga0068859_100039908 Ga0068859_1000399084 248
2 3300005718 Ga0068866_10009741 Ga0068866_100097414 248
3 3300005719 Ga0068861_100001943 Ga0068861_1000019436 248
4 3300005841 Ga0068863_100003131 Ga0068863_10000313112 248
5 3300005842 Ga0068858_100001019 Ga0068858_1000010196 248
6 3300005843 Ga0068860_100000932 Ga0068860_10000093215 248
7 3300006881 Ga0068865_100072769 Ga0068865_1000727692 248
8 3300006931 Ga0097620_100039908 Ga0097620_1000399084 248
9 3300025903 Ga0207680_10002621 Ga0207680_100026213 248
10 3300025907 Ga0207645_10001649 Ga0207645_100016495 248
11 3300025918 Ga0207662_10025200 Ga0207662_100252003 248
12 3300025923 Ga0207681_10000549 Ga0207681_1000054913 248
13 3300025927 Ga0207687_10018259 Ga0207687_100182592 248
14 3300025938 Ga0207704_10003465 Ga0207704_100034652 248
15 3300025942 Ga0207689_10001671 Ga0207689_100016712 248
16 3300025961 Ga0207712_10001342 Ga0207712_100013424 248
17 3300025986 Ga0207658_10000522 Ga0207658_1000052214 248
18 3300026035 Ga0207703_10000176 Ga0207703_1000017648 248
19 3300026075 Ga0207708_10043236 Ga0207708_100432363 248
20 3300026088 Ga0207641_10004166 Ga0207641_1000416611 248
21 3300026118 Ga0207675_100000483 Ga0207675_10000048332 248
22 3300028381 Ga0268264_10000951 Ga0268264_1000095121 248
23 3300025926 Ga0207659_10271704 Ga0207659_102717042 253
24 3300042121 Ga0450919_004622 Ga0450919_004622_414_1286 261
25 3300049593 Ga0501077_0096397 Ga0501077_0096397_787_1740 262
26 3300049742 Ga0501080_0248240 Ga0501080_0248240_578_1531 262
27 3300006852 Ga0075433_10008156 Ga0075433_100081564 265
28 3300006871 Ga0075434_100007335 Ga0075434_1000073352 265
29 3300007076 Ga0075435_100074962 Ga0075435_1000749622 265
30 3300049582 Ga0501048_0147363 Ga0501048_0147363_129_1082 265
31 3300049587 Ga0501071_0038668 Ga0501071_0038668_1348_2301 265
32 3300049593 Ga0501077_0185949 Ga0501077_0185949_186_1139 265
33 3300049743 Ga0501081_0071185 Ga0501081_0071185_633_1586 265
34 3300050507 nmdc:mga05p37_62965_c1 nmdc:mga05p37_62965_c1_2278_3225 265
35 3300050513 nmdc:mga0rr50_1492_c1 nmdc:mga0rr50_1492_c1_9864_10811 265
36 3300050515 nmdc:mga0a205_37940_c1 nmdc:mga0a205_37940_c1_593_1540 265
37 3300061734 Ga0530510_0124207 Ga0530510_0124207_923_1876 265
38 3300005327 Ga0070658_10038297 Ga0070658_100382973 266
39 3300005329 Ga0070683_100044869 Ga0070683_1000448692 266
40 3300005344 Ga0070661_100017942 Ga0070661_1000179422 266
41 3300005366 Ga0070659_100058363 Ga0070659_1000583633 266
42 3300005471 Ga0070698_100148256 Ga0070698_1001482561 266
43 3300005535 Ga0070684_100030738 Ga0070684_1000307384 266
44 3300005539 Ga0068853_100108345 Ga0068853_1001083452 266
45 3300005564 Ga0070664_100085235 Ga0070664_1000852352 266
46 3300005577 Ga0068857_100195993 Ga0068857_1001959932 266
47 3300005578 Ga0068854_100022692 Ga0068854_1000226924 266
48 3300005614 Ga0068856_100006441 Ga0068856_1000064412 266
49 3300005616 Ga0068852_100073525 Ga0068852_1000735253 266
50 3300005834 Ga0068851_10027390 Ga0068851_100273902 266
51 3300009551 Ga0105238_10022379 Ga0105238_100223793 266
52 3300013307 Ga0157372_10075034 Ga0157372_100750342 266
53 3300025321 Ga0207656_10057804 Ga0207656_100578042 266
54 3300025920 Ga0207649_10010768 Ga0207649_100107683 266
55 3300025944 Ga0207661_10038163 Ga0207661_100381633 266
56 3300025945 Ga0207679_10038287 Ga0207679_100382873 266
57 3300026041 Ga0207639_10061917 Ga0207639_100619173 266
58 3300026078 Ga0207702_10039619 Ga0207702_100396192 266
59 3300026116 Ga0207674_10183266 Ga0207674_101832662 266
60 3300026142 Ga0207698_10016249 Ga0207698_100162493 266
61 3300005336 Ga0070680_100014854 Ga0070680_1000148545 267
62 3300005341 Ga0070691_10023890 Ga0070691_100238902 267
63 3300005530 Ga0070679_100006831 Ga0070679_1000068319 267
64 3300005615 Ga0070702_100157662 Ga0070702_1001576622 267
65 3300006358 Ga0068871_100026984 Ga0068871_1000269843 267
66 3300025917 Ga0207660_10026389 Ga0207660_100263894 267
67 3300025921 Ga0207652_10442620 Ga0207652_104426202 267
68 3300025926 Ga0207659_10166304 Ga0207659_101663042 267
69 3300025941 Ga0207711_10049449 Ga0207711_100494492 267
70 3300026089 Ga0207648_10121943 Ga0207648_101219432 267
71 3300035691 Ga0373931_0002948 Ga0373931_0002948_4010_4954 267
72 3300048910 Ga0496107_0192028 Ga0496107_0192028_31_975 267
73 3300048911 Ga0496108_0051908 Ga0496108_0051908_1047_1991 267
74 3300048913 Ga0496110_0197959 Ga0496110_0197959_140_1090 267
75 3300049574 Ga0501038_0181327 Ga0501038_0181327_586_1524 267
76 3300049578 Ga0501042_0095214 Ga0501042_0095214_163_1107 267
77 3300049743 Ga0501081_0303575 Ga0501081_0303575_25_972 267
78 3300025922 Ga0207646_10029644 Ga0207646_100296445 268
79 3300005328 Ga0070676_10031847 Ga0070676_100318473 269
80 3300005331 Ga0070670_100005552 Ga0070670_1000055526 269
81 3300005334 Ga0068869_100001553 Ga0068869_1000015538 269
82 3300005336 Ga0070680_100002617 Ga0070680_1000026175 269
83 3300005337 Ga0070682_100001981 Ga0070682_10000198110 269
84 3300005339 Ga0070660_100001885 Ga0070660_10000188510 269
85 3300005341 Ga0070691_10005786 Ga0070691_100057865 269
86 3300005344 Ga0070661_100002131 Ga0070661_1000021319 269
87 3300005345 Ga0070692_10001426 Ga0070692_100014269 269
88 3300005364 Ga0070673_100004910 Ga0070673_1000049106 269
89 3300005366 Ga0070659_100005878 Ga0070659_1000058785 269
90 3300005406 Ga0070703_10004356 Ga0070703_100043562 269
91 3300005438 Ga0070701_10016367 Ga0070701_100163673 269
92 3300005440 Ga0070705_100002757 Ga0070705_1000027574 269
93 3300005444 Ga0070694_100009548 Ga0070694_1000095485 269
94 3300005455 Ga0070663_100011705 Ga0070663_1000117054 269
95 3300005457 Ga0070662_100030082 Ga0070662_1000300824 269
96 3300005530 Ga0070679_100016329 Ga0070679_1000163295 269
97 3300005535 Ga0070684_100084993 Ga0070684_1000849932 269
98 3300005539 Ga0068853_100007116 Ga0068853_1000071168 269
99 3300005546 Ga0070696_100012586 Ga0070696_1000125864 269
100 3300005547 Ga0070693_100000151 Ga0070693_10000015128 269
101 3300005549 Ga0070704_100002130 Ga0070704_1000021309 269
102 3300005563 Ga0068855_100035290 Ga0068855_1000352903 269
103 3300005578 Ga0068854_100015767 Ga0068854_1000157674 269
104 3300005617 Ga0068859_100008495 Ga0068859_10000849512 269
105 3300005618 Ga0068864_100007539 Ga0068864_1000075394 269
106 3300005719 Ga0068861_100016833 Ga0068861_1000168333 269
107 3300005840 Ga0068870_10003943 Ga0068870_100039435 269
108 3300005841 Ga0068863_100009810 Ga0068863_1000098107 269
109 3300006914 Ga0075436_100079284 Ga0075436_1000792843 269
110 3300006931 Ga0097620_100008495 Ga0097620_1000084952 269
111 3300007076 Ga0075435_100032114 Ga0075435_1000321143 269
112 3300009093 Ga0105240_10578691 Ga0105240_105786911 269
113 3300009174 Ga0105241_10001720 Ga0105241_1000172015 269
114 3300013100 Ga0157373_10001536 Ga0157373_1000153615 269
115 3300013104 Ga0157370_10175127 Ga0157370_101751272 269
116 3300013307 Ga0157372_10008094 Ga0157372_1000809410 269
117 3300014326 Ga0157380_10330684 Ga0157380_103306842 269
118 3300014497 Ga0182008_10119018 Ga0182008_101190182 269
119 3300025885 Ga0207653_10008663 Ga0207653_100086631 269
120 3300025901 Ga0207688_10107031 Ga0207688_101070312 269
121 3300025907 Ga0207645_10000858 Ga0207645_1000085819 269
122 3300025908 Ga0207643_10001314 Ga0207643_1000131411 269
123 3300025912 Ga0207707_10000169 Ga0207707_1000016956 269
124 3300025917 Ga0207660_10000853 Ga0207660_1000085315 269
125 3300025919 Ga0207657_10000230 Ga0207657_1000023054 269
126 3300025920 Ga0207649_10003044 Ga0207649_100030445 269
127 3300025921 Ga0207652_10000263 Ga0207652_1000026328 269
128 3300025925 Ga0207650_10003760 Ga0207650_100037602 269
129 3300025932 Ga0207690_10002921 Ga0207690_100029214 269
130 3300025933 Ga0207706_10010067 Ga0207706_100100674 269
131 3300025936 Ga0207670_10154874 Ga0207670_101548742 269
132 3300025942 Ga0207689_10000006 Ga0207689_1000000654 269
133 3300025945 Ga0207679_10001904 Ga0207679_100019049 269
134 3300025949 Ga0207667_10010274 Ga0207667_100102746 269
135 3300026041 Ga0207639_10009451 Ga0207639_100094517 269
136 3300026067 Ga0207678_10112224 Ga0207678_101122242 269
137 3300026078 Ga0207702_10003271 Ga0207702_1000327113 269
138 3300026095 Ga0207676_10008475 Ga0207676_100084754 269
139 3300026118 Ga0207675_100031776 Ga0207675_1000317763 269
140 3300027876 Ga0209974_10027690 Ga0209974_100276902 269
141 3300028380 Ga0268265_10002714 Ga0268265_100027149 269
142 3300035090 Ga0373949_0017211 Ga0373949_0017211_256_1203 269
143 3300035121 Ga0373960_0089920 Ga0373960_0089920_14_961 269
144 3300035241 Ga0373961_0017716 Ga0373961_0017716_119_1066 269
145 3300042005 Ga0439448_0000296 Ga0439448_0000296_8096_9043 269
146 3300042438 Ga0439459_0000355 Ga0439459_0000355_1328_2275 269
147 3300044673 Ga0453683_0286187 Ga0453683_0286187_48_995 269
148 3300048905 Ga0496102_0081173 Ga0496102_0081173_1034_1981 269
149 3300050512 nmdc:mga0n895_215906_c1 nmdc:mga0n895_215906_c1_539_1486 269
150 3300050513 nmdc:mga0rr50_113522_c1 nmdc:mga0rr50_113522_c1_291_1238 269
151 3300049585 Ga0501069_0069463 Ga0501069_0069463_940_1872 270
152 3300049571 Ga0501034_0048692 Ga0501034_0048692_797_1699 272
153 3300049584 Ga0501068_0023945 Ga0501068_0023945_1729_2631 272
154 3300049586 Ga0501070_0460725 Ga0501070_0460725_96_998 272
155 3300049741 Ga0501079_0033373 Ga0501079_0033373_1966_2916 272
156 3300049823 Ga0501044_0079300 Ga0501044_0079300_1141_2043 272
157 3300005295 Ga0065707_10209494 Ga0065707_102094941 273
158 3300049575 Ga0501039_0088078 Ga0501039_0088078_1342_2283 273
159 3300049577 Ga0501041_0083457 Ga0501041_0083457_400_1341 273
160 3300049580 Ga0501046_0129135 Ga0501046_0129135_629_1570 273
161 3300049824 Ga0501045_0063103 Ga0501045_0063103_237_1178 273
162 3300031241 Ga0265325_10125297 Ga0265325_101252972 274
163 3300031247 Ga0265340_10014560 Ga0265340_100145605 274
164 3300005518 Ga0070699_100114885 Ga0070699_1001148852 275
165 3300006871 Ga0075434_100032026 Ga0075434_1000320263 275
166 3300006871 Ga0075434_100080138 Ga0075434_1000801383 275
167 3300007076 Ga0075435_100245671 Ga0075435_1002456712 275
168 3300009094 Ga0111539_10125193 Ga0111539_101251933 275
169 3300028380 Ga0268265_10189844 Ga0268265_101898442 275
170 3300050507 nmdc:mga05p37_421095_c1 nmdc:mga05p37_421095_c1_247_1182 275
171 3300050512 nmdc:mga0n895_139393_c1 nmdc:mga0n895_139393_c1_1068_1976 275
172 3300050513 nmdc:mga0rr50_84476_c1 nmdc:mga0rr50_84476_c1_190_1128 275
173 3300050515 nmdc:mga0a205_99331_c1 nmdc:mga0a205_99331_c1_415_1359 275
174 3300005440 Ga0070705_100038426 Ga0070705_1000384263 276
175 3300046533 Ga0495640_0008049 Ga0495640_0008049_6812_7720 276
176 3300049568 Ga0501031_0023681 Ga0501031_0023681_2585_3529 276
177 3300049569 Ga0501032_0090473 Ga0501032_0090473_889_1833 276
178 3300049572 Ga0501036_0002690 Ga0501036_0002690_2571_3515 276
179 3300049574 Ga0501038_0052165 Ga0501038_0052165_937_1881 276
180 3300049575 Ga0501039_0036427 Ga0501039_0036427_312_1256 276
181 3300049576 Ga0501040_0001684 Ga0501040_0001684_10665_11609 276
182 3300049576 Ga0501040_0358115 Ga0501040_0358115_43_984 276
183 3300049577 Ga0501041_0056990 Ga0501041_0056990_884_1828 276
184 3300049578 Ga0501042_0059310 Ga0501042_0059310_57_1001 276
185 3300049580 Ga0501046_0002560 Ga0501046_0002560_2542_3486 276
186 3300049582 Ga0501048_0021169 Ga0501048_0021169_2544_3488 276
187 3300049584 Ga0501068_0022873 Ga0501068_0022873_1589_2533 276
188 3300049586 Ga0501070_0034376 Ga0501070_0034376_2581_3525 276
189 3300049587 Ga0501071_0003914 Ga0501071_0003914_1895_2839 276
190 3300049590 Ga0501074_0047869 Ga0501074_0047869_1544_2488 276
191 3300049592 Ga0501076_0001859 Ga0501076_0001859_10623_11567 276
192 3300049593 Ga0501077_0027843 Ga0501077_0027843_2567_3511 276
193 3300049593 Ga0501077_0183364 Ga0501077_0183364_263_1204 276
194 3300049741 Ga0501079_0003697 Ga0501079_0003697_9106_10050 276
195 3300049742 Ga0501080_0003420 Ga0501080_0003420_2533_3477 276
196 3300049743 Ga0501081_0000778 Ga0501081_0000778_2849_3793 276
197 3300049744 Ga0501083_0096551 Ga0501083_0096551_431_1375 276
198 3300049824 Ga0501045_0002468 Ga0501045_0002468_11265_12209 276
199 3300049824 Ga0501045_0377558 Ga0501045_0377558_39_980 276
200 3300054114 Ga0501084_0004829 Ga0501084_0004829_419_1363 276
201 3300054114 Ga0501084_0050553 Ga0501084_0050553_1436_2377 276
202 3300060353 Ga0501082_0002933 Ga0501082_0002933_11390_12334 276
203 3300061734 Ga0530510_0003893 Ga0530510_0003893_8985_9929 276
204 3300061734 Ga0530510_0246265 Ga0530510_0246265_284_1225 276
205 iso_pu_bacteria 2857509624 2857514821 276
206 iso_pu_bacteria 2922386360 2922387251 276
207 iso_pu_bacteria 8006994254 8006999803 276
208 3300005468 Ga0070707_100010096 Ga0070707_1000100963 277
209 3300005983 Ga0081540_1008693 Ga0081540_10086932 277
210 3300025294 Ga0209025_1047681 Ga0209025_10476812 277
211 3300025910 Ga0207684_10129732 Ga0207684_101297321 277
212 3300025922 Ga0207646_10049095 Ga0207646_100490953 277
213 3300026075 Ga0207708_10185384 Ga0207708_101853842 277
214 3300031548 Ga0307408_100149550 Ga0307408_1001495502 277
215 3300031731 Ga0307405_10200194 Ga0307405_102001941 277
216 3300044673 Ga0453683_0173520 Ga0453683_0173520_62_991 277
217 3300045051 Ga0451576_0083244 Ga0451576_0083244_912_1859 277
218 3300049568 Ga0501031_0209678 Ga0501031_0209678_192_1139 277
219 3300049593 Ga0501077_0049259 Ga0501077_0049259_983_1918 277
220 3300049741 Ga0501079_0229362 Ga0501079_0229362_387_1322 277
221 3300050507 nmdc:mga05p37_5718_c1 nmdc:mga05p37_5718_c1_11381_12322 277
222 3300050514 nmdc:mga08x19_22684_c1 nmdc:mga08x19_22684_c1_2360_3289 277
223 3300061734 Ga0530510_0014446 Ga0530510_0014446_2071_3015 277
224 3300005336 Ga0070680_100055722 Ga0070680_1000557222 278
225 3300005444 Ga0070694_100018940 Ga0070694_1000189402 278
226 3300005545 Ga0070695_100069499 Ga0070695_1000694991 278
227 3300005549 Ga0070704_100003768 Ga0070704_1000037684 278
228 3300005616 Ga0068852_100440251 Ga0068852_1004402512 278
229 3300005617 Ga0068859_100093010 Ga0068859_1000930103 278
230 3300005842 Ga0068858_100258974 Ga0068858_1002589742 278
231 3300005843 Ga0068860_100014294 Ga0068860_1000142944 278
232 3300005985 Ga0081539_10000002 Ga0081539_10000002199 278
233 3300006846 Ga0075430_100005095 Ga0075430_1000050955 278
234 3300006847 Ga0075431_100005700 Ga0075431_1000057005 278
235 3300006847 Ga0075431_100517045 Ga0075431_1005170452 278
236 3300006880 Ga0075429_100130750 Ga0075429_1001307502 278
237 3300006931 Ga0097620_100093016 Ga0097620_1000930163 278
238 3300009147 Ga0114129_10005731 Ga0114129_1000573119 278
239 3300009147 Ga0114129_10028104 Ga0114129_100281048 278
240 3300009147 Ga0114129_10038302 Ga0114129_100383022 278
241 3300014326 Ga0157380_10026243 Ga0157380_100262434 278
242 3300014968 Ga0157379_10042544 Ga0157379_100425442 278
243 3300025917 Ga0207660_10016991 Ga0207660_100169914 278
244 3300025944 Ga0207661_10456742 Ga0207661_104567421 278
245 3300026035 Ga0207703_10009198 Ga0207703_100091984 278
246 3300028381 Ga0268264_10074115 Ga0268264_100741153 278
247 3300031730 Ga0307516_10072372 Ga0307516_100723722 278
248 3300032002 Ga0307416_100274746 Ga0307416_1002747461 278
249 3300035112 Ga0373932_0059866 Ga0373932_0059866_87_1031 278
250 3300035114 Ga0373939_0071043 Ga0373939_0071043_31_975 278
251 3300035691 Ga0373931_0012972 Ga0373931_0012972_515_1459 278
252 3300045051 Ga0451576_0077245 Ga0451576_0077245_11_958 278
253 3300049576 Ga0501040_0180246 Ga0501040_0180246_23_964 278
254 3300049582 Ga0501048_0077516 Ga0501048_0077516_105_1040 278
255 3300049587 Ga0501071_0081863 Ga0501071_0081863_700_1635 278
256 3300049588 Ga0501072_0033613 Ga0501072_0033613_287_1228 278
257 3300049592 Ga0501076_0015860 Ga0501076_0015860_1984_2925 278
258 3300049592 Ga0501076_0126721 Ga0501076_0126721_285_1226 278
259 3300049593 Ga0501077_0034917 Ga0501077_0034917_1918_2859 278
260 3300049593 Ga0501077_0155376 Ga0501077_0155376_187_1122 278
261 3300049743 Ga0501081_0009596 Ga0501081_0009596_2821_3762 278
262 3300049743 Ga0501081_0051141 Ga0501081_0051141_854_1795 278
263 3300049744 Ga0501083_0080109 Ga0501083_0080109_48_989 278
264 3300049824 Ga0501045_0064879 Ga0501045_0064879_1445_2380 278
265 3300050507 nmdc:mga05p37_30562_c1 nmdc:mga05p37_30562_c1_3356_4291 278
266 3300050507 nmdc:mga05p37_3869_c1 nmdc:mga05p37_3869_c1_4802_5746 278
267 3300050507 nmdc:mga05p37_9142_c1 nmdc:mga05p37_9142_c1_8844_9779 278
268 3300050508 nmdc:mga09592_95622_c1 nmdc:mga09592_95622_c1_651_1595 278
269 3300050509 nmdc:mga0qj67_3320_c1 nmdc:mga0qj67_3320_c1_3762_4706 278
270 3300050510 nmdc:mga06r32_3922_c1 nmdc:mga06r32_3922_c1_4338_5282 278
271 3300050515 nmdc:mga0a205_118610_c2 nmdc:mga0a205_118610_c2_582_1517 278
272 3300054114 Ga0501084_0025561 Ga0501084_0025561_1995_2927 278
273 3300054114 Ga0501084_0337734 Ga0501084_0337734_284_1225 278
274 3300060353 Ga0501082_0051435 Ga0501082_0051435_908_1849 278
275 3300060353 Ga0501082_0095716 Ga0501082_0095716_1472_2413 278
276 3300061734 Ga0530510_0131915 Ga0530510_0131915_621_1562 278
277 3300061734 Ga0530510_0165802 Ga0530510_0165802_210_1151 278
278 3300005328 Ga0070676_10245427 Ga0070676_102454271 279
279 3300005336 Ga0070680_100010196 Ga0070680_1000101963 279
280 3300005336 Ga0070680_100388472 Ga0070680_1003884721 279
281 3300005440 Ga0070705_100006694 Ga0070705_1000066945 279
282 3300005444 Ga0070694_100008439 Ga0070694_1000084392 279
283 3300005458 Ga0070681_10018023 Ga0070681_100180233 279
284 3300005458 Ga0070681_10037353 Ga0070681_100373533 279
285 3300005467 Ga0070706_100154277 Ga0070706_1001542773 279
286 3300005530 Ga0070679_100030364 Ga0070679_1000303643 279
287 3300005545 Ga0070695_100015240 Ga0070695_1000152403 279
288 3300005545 Ga0070695_100020539 Ga0070695_1000205394 279
289 3300005546 Ga0070696_100052871 Ga0070696_1000528713 279
290 3300005549 Ga0070704_100001890 Ga0070704_1000018908 279
291 3300005549 Ga0070704_100002499 Ga0070704_1000024999 279
292 3300005937 Ga0081455_10000138 Ga0081455_1000013810 279
293 3300005983 Ga0081540_1000543 Ga0081540_100054334 279
294 3300005983 Ga0081540_1006899 Ga0081540_10068993 279
295 3300005983 Ga0081540_1094164 Ga0081540_10941642 279
296 3300006173 Ga0070716_100027582 Ga0070716_1000275822 279
297 3300006844 Ga0075428_100000227 Ga0075428_10000022752 279
298 3300006844 Ga0075428_100098276 Ga0075428_1000982762 279
299 3300006846 Ga0075430_100000307 Ga0075430_10000030725 279
300 3300006847 Ga0075431_100000414 Ga0075431_10000041425 279
301 3300006847 Ga0075431_100025974 Ga0075431_1000259744 279
302 3300006852 Ga0075433_10020195 Ga0075433_100201954 279
303 3300006852 Ga0075433_10149641 Ga0075433_101496412 279
304 3300006871 Ga0075434_100084090 Ga0075434_1000840902 279
305 3300006880 Ga0075429_100000032 Ga0075429_1000000329 279
306 3300006880 Ga0075429_100000080 Ga0075429_10000008031 279
307 3300006914 Ga0075436_100024505 Ga0075436_1000245054 279
308 3300006914 Ga0075436_100050078 Ga0075436_1000500782 279
309 3300007076 Ga0075435_100016916 Ga0075435_1000169163 279
310 3300007076 Ga0075435_100040810 Ga0075435_1000408102 279
311 3300007265 Ga0099794_10147116 Ga0099794_101471161 279
312 3300009093 Ga0105240_10010045 Ga0105240_1001004513 279
313 3300009093 Ga0105240_10570672 Ga0105240_105706722 279
314 3300009094 Ga0111539_10037354 Ga0111539_100373542 279
315 3300009094 Ga0111539_10624416 Ga0111539_106244162 279
316 3300009147 Ga0114129_10002723 Ga0114129_100027232 279
317 3300009147 Ga0114129_10056587 Ga0114129_100565872 279
318 3300009147 Ga0114129_10157112 Ga0114129_101571123 279
319 3300009147 Ga0114129_10421519 Ga0114129_104215192 279
320 3300009177 Ga0105248_10282859 Ga0105248_102828592 279
321 3300013104 Ga0157370_10031729 Ga0157370_100317293 279
322 3300013297 Ga0157378_10428147 Ga0157378_104281471 279
323 3300021377 Ga0213874_10028151 Ga0213874_100281512 279
324 3300025910 Ga0207684_10127474 Ga0207684_101274742 279
325 3300025912 Ga0207707_10038106 Ga0207707_100381062 279
326 3300025912 Ga0207707_10055003 Ga0207707_100550032 279
327 3300025913 Ga0207695_10086041 Ga0207695_100860413 279
328 3300025913 Ga0207695_10396238 Ga0207695_103962382 279
329 3300025915 Ga0207693_10059818 Ga0207693_100598182 279
330 3300025915 Ga0207693_10060239 Ga0207693_100602392 279
331 3300025917 Ga0207660_10108347 Ga0207660_101083472 279
332 3300025921 Ga0207652_10309299 Ga0207652_103092992 279
333 3300025928 Ga0207700_10310263 Ga0207700_103102632 279
334 3300025949 Ga0207667_10104934 Ga0207667_101049342 279
335 3300027907 Ga0207428_10013876 Ga0207428_100138766 279
336 3300031507 Ga0307509_10198022 Ga0307509_101980222 279
337 3300031711 Ga0265314_10000822 Ga0265314_100008222 279
338 3300031712 Ga0265342_10085635 Ga0265342_100856352 279
339 3300031824 Ga0307413_10119711 Ga0307413_101197112 279
340 3300031911 Ga0307412_10362663 Ga0307412_103626631 279
341 3300032002 Ga0307416_100004427 Ga0307416_1000044271 279
342 3300033180 Ga0307510_10063262 Ga0307510_100632624 279
343 3300035086 Ga0373934_0001390 Ga0373934_0001390_1470_2387 279
344 3300035113 Ga0373936_0094211 Ga0373936_0094211_85_1002 279
345 3300035117 Ga0373953_0000426 Ga0373953_0000426_4897_5814 279
346 3300035118 Ga0373954_0000139 Ga0373954_0000139_8314_9231 279
347 3300035119 Ga0373956_0001236 Ga0373956_0001236_6610_7527 279
348 3300035120 Ga0373957_0054999 Ga0373957_0054999_289_1206 279
349 3300035170 Ga0373943_0036609 Ga0373943_0036609_314_1255 279
350 3300035172 Ga0373955_0000597 Ga0373955_0000597_8804_9721 279
351 3300035242 Ga0373962_0055380 Ga0373962_0055380_164_1114 279
352 3300035410 Ga0373924_0012050 Ga0373924_0012050_828_1745 279
353 3300035692 Ga0373935_0249287 Ga0373935_0249287_38_955 279
354 3300035695 Ga0373927_0007782 Ga0373927_0007782_1859_2779 279
355 3300035695 Ga0373927_0014475 Ga0373927_0014475_3266_4207 279
356 3300035724 Ga0373933_0000483 Ga0373933_0000483_4123_5040 279
357 3300037068 Ga0373925_0045346 Ga0373925_0045346_191_1111 279
358 3300037068 Ga0373925_0135517 Ga0373925_0135517_668_1609 279
359 3300039437 Ga0436365_0212285 Ga0436365_0212285_2425_3366 279
360 3300039437 Ga0436365_0821657 Ga0436365_0821657_382_1323 279
361 3300039453 Ga0436362_1210859 Ga0436362_1210859_1616_2557 279
362 3300041997 Ga0439431_0002062 Ga0439431_0002062_435_1406 279
363 3300042012 Ga0439455_0044582 Ga0439455_0044582_169_1086 279
364 3300042436 Ga0439435_0005572 Ga0439435_0005572_1207_2145 279
365 3300042461 Ga0439460_0002563 Ga0439460_0002563_3024_3962 279
366 3300046454 Ga0495592_0001466 Ga0495592_0001466_7328_8245 279
367 3300046455 Ga0495603_0025030 Ga0495603_0025030_1236_2153 279
368 3300046459 Ga0495629_0000548 Ga0495629_0000548_13878_14795 279
369 3300046462 Ga0495651_0003160 Ga0495651_0003160_4979_5896 279
370 3300046463 Ga0495653_0000621 Ga0495653_0000621_18451_19368 279
371 3300046499 Ga0495594_0183542 Ga0495594_0183542_13_930 279
372 3300046511 Ga0495608_0002190 Ga0495608_0002190_6076_6993 279
373 3300046514 Ga0495618_0139786 Ga0495618_0139786_32_949 279
374 3300046516 Ga0495628_0018073 Ga0495628_0018073_4454_5371 279
375 3300046524 Ga0495648_0106702 Ga0495648_0106702_305_1222 279
376 3300046529 Ga0495652_0005425 Ga0495652_0005425_3602_4519 279
377 3300046536 Ga0495587_0001777 Ga0495587_0001777_5404_6321 279
378 3300046543 Ga0495645_0055831 Ga0495645_0055831_1070_1987 279
379 3300046559 Ga0495667_0000853 Ga0495667_0000853_9631_10548 279
380 3300046642 Ga0495634_0008025 Ga0495634_0008025_4945_5862 279
381 3300046663 Ga0495635_0000485 Ga0495635_0000485_8374_9291 279
382 3300046675 Ga0495657_0004077 Ga0495657_0004077_4851_5768 279
383 3300046678 Ga0495599_0000942 Ga0495599_0000942_7857_8774 279
384 3300046679 Ga0495623_0015435 Ga0495623_0015435_2125_3042 279
385 3300046680 Ga0495646_0013023 Ga0495646_0013023_903_1820 279
386 3300046689 Ga0495613_0117506 Ga0495613_0117506_359_1276 279
387 3300046809 Ga0495600_0002111 Ga0495600_0002111_4251_5168 279
388 3300047317 Ga0495604_0003566 Ga0495604_0003566_5414_6331 279
389 3300047319 Ga0495674_0054183 Ga0495674_0054183_2566_3483 279
390 3300047322 Ga0495680_0001218 Ga0495680_0001218_16422_17339 279
391 3300047444 Ga0495675_0000987 Ga0495675_0000987_8258_9175 279
392 3300047471 Ga0495684_0001700 Ga0495684_0001700_8130_9047 279
393 3300047673 Ga0495593_0006674 Ga0495593_0006674_5670_6587 279
394 3300048088 Ga0495602_0035011 Ga0495602_0035011_1896_2813 279
395 3300048905 Ga0496102_0632047 Ga0496102_0632047_23_961 279
396 3300048909 Ga0496106_0341759 Ga0496106_0341759_18_938 279
397 3300049568 Ga0501031_0141746 Ga0501031_0141746_253_1254 279
398 3300049572 Ga0501036_0325849 Ga0501036_0325849_36_977 279
399 3300049574 Ga0501038_0068158 Ga0501038_0068158_1849_2850 279
400 3300049575 Ga0501039_0144931 Ga0501039_0144931_845_1846 279
401 3300049576 Ga0501040_0005541 Ga0501040_0005541_5104_6105 279
402 3300049577 Ga0501041_0224906 Ga0501041_0224906_155_1099 279
403 3300049580 Ga0501046_0000455 Ga0501046_0000455_31673_32674 279
404 3300049582 Ga0501048_0001071 Ga0501048_0001071_18613_19614 279
405 3300049584 Ga0501068_0043184 Ga0501068_0043184_1015_2016 279
406 3300049584 Ga0501068_0130594 Ga0501068_0130594_481_1422 279
407 3300049587 Ga0501071_0097418 Ga0501071_0097418_1019_1963 279
408 3300049590 Ga0501074_0001262 Ga0501074_0001262_6357_7358 279
409 3300049591 Ga0501075_0054298 Ga0501075_0054298_968_1969 279
410 3300049592 Ga0501076_0052572 Ga0501076_0052572_560_1573 279
411 3300049592 Ga0501076_0321171 Ga0501076_0321171_237_1187 279
412 3300049741 Ga0501079_0005279 Ga0501079_0005279_8479_9480 279
413 3300049743 Ga0501081_0002562 Ga0501081_0002562_4812_5813 279
414 3300049744 Ga0501083_0018129 Ga0501083_0018129_401_1402 279
415 3300049824 Ga0501045_0000268 Ga0501045_0000268_5351_6352 279
416 3300050507 nmdc:mga05p37_26343_c1 nmdc:mga05p37_26343_c1_839_1783 279
417 3300050507 nmdc:mga05p37_45318_c1 nmdc:mga05p37_45318_c1_4280_5215 279
418 3300050507 nmdc:mga05p37_803_c1 nmdc:mga05p37_803_c1_28356_29297 279
419 3300050508 nmdc:mga09592_19019_c1 nmdc:mga09592_19019_c1_2923_3867 279
420 3300050508 nmdc:mga09592_44_c1 nmdc:mga09592_44_c1_44522_45463 279
421 3300050509 nmdc:mga0qj67_7226_c1 nmdc:mga0qj67_7226_c1_1683_2627 279
422 3300050510 nmdc:mga06r32_104585_c1 nmdc:mga06r32_104585_c1_512_1456 279
423 3300050510 nmdc:mga06r32_7269_c2 nmdc:mga06r32_7269_c2_3969_4910 279
424 3300050511 nmdc:mga08y16_19461_c1 nmdc:mga08y16_19461_c1_3021_3959 279
425 3300050511 nmdc:mga08y16_616723_c1 nmdc:mga08y16_616723_c1_110_1054 279
426 3300050512 nmdc:mga0n895_33637_c1 nmdc:mga0n895_33637_c1_2172_3116 279
427 3300050512 nmdc:mga0n895_36011_c1 nmdc:mga0n895_36011_c1_1999_2937 279
428 3300050512 nmdc:mga0n895_5041_c1 nmdc:mga0n895_5041_c1_3142_4083 279
429 3300050513 nmdc:mga0rr50_16374_c1 nmdc:mga0rr50_16374_c1_624_1565 279
430 3300050513 nmdc:mga0rr50_25001_c1 nmdc:mga0rr50_25001_c1_2794_3738 279
431 3300050514 nmdc:mga08x19_16628_c1 nmdc:mga08x19_16628_c1_2823_3761 279
432 3300050514 nmdc:mga08x19_67844_c1 nmdc:mga08x19_67844_c1_576_1511 279
433 3300050515 nmdc:mga0a205_40853_c1 nmdc:mga0a205_40853_c1_912_1856 279
434 3300050515 nmdc:mga0a205_47156_c1 nmdc:mga0a205_47156_c1_970_1905 279
435 3300053077 Ga0495601_0034079 Ga0495601_0034079_658_1575 279
436 3300053080 Ga0500635_0006203 Ga0500635_0006203_1034_1951 279
437 3300053084 Ga0495595_0000228 Ga0495595_0000228_12892_13809 279
438 3300053148 Ga0500590_150388 Ga0500590_150388_67_984 279
439 3300053150 Ga0500603_000055 Ga0500603_000055_26608_27525 279
440 3300053178 Ga0500637_0016594 Ga0500637_0016594_1062_1979 279
441 3300054114 Ga0501084_0265506 Ga0501084_0265506_492_1436 279
442 3300060353 Ga0501082_0003776 Ga0501082_0003776_5561_6562 279
443 3300003215 JGI25153J46596_10001308 JGI25153J46596_100013085 280
444 3300003347 JGI26128J50194_1002768 JGI26128J50194_10027681 280
445 3300005435 Ga0070714_100394417 Ga0070714_1003944171 280
446 3300005439 Ga0070711_100274400 Ga0070711_1002744001 280
447 3300005440 Ga0070705_100002327 Ga0070705_1000023279 280
448 3300005445 Ga0070708_100004512 Ga0070708_1000045129 280
449 3300005445 Ga0070708_100039979 Ga0070708_1000399793 280
450 3300005445 Ga0070708_100041712 Ga0070708_1000417122 280
451 3300005445 Ga0070708_100095959 Ga0070708_1000959592 280
452 3300005457 Ga0070662_100031994 Ga0070662_1000319942 280
453 3300005467 Ga0070706_100011007 Ga0070706_1000110073 280
454 3300005467 Ga0070706_100027880 Ga0070706_1000278802 280
455 3300005467 Ga0070706_100062940 Ga0070706_1000629403 280
456 3300005467 Ga0070706_100221601 Ga0070706_1002216012 280
457 3300005468 Ga0070707_100040474 Ga0070707_1000404742 280
458 3300005468 Ga0070707_100054661 Ga0070707_1000546614 280
459 3300005471 Ga0070698_100009734 Ga0070698_1000097348 280
460 3300005471 Ga0070698_100020081 Ga0070698_1000200813 280
461 3300005471 Ga0070698_100057994 Ga0070698_1000579941 280
462 3300005471 Ga0070698_100409080 Ga0070698_1004090802 280
463 3300005518 Ga0070699_100000309 Ga0070699_10000030951 280
464 3300005518 Ga0070699_100028086 Ga0070699_1000280863 280
465 3300005518 Ga0070699_100062989 Ga0070699_1000629893 280
466 3300005518 Ga0070699_100330107 Ga0070699_1003301071 280
467 3300005536 Ga0070697_100037165 Ga0070697_1000371653 280
468 3300005536 Ga0070697_100331782 Ga0070697_1003317822 280
469 3300005545 Ga0070695_100001304 Ga0070695_1000013046 280
470 3300005545 Ga0070695_100017447 Ga0070695_1000174475 280
471 3300005546 Ga0070696_100013541 Ga0070696_1000135416 280
472 3300005547 Ga0070693_100104562 Ga0070693_1001045622 280
473 3300005615 Ga0070702_100278558 Ga0070702_1002785582 280
474 3300005618 Ga0068864_100119092 Ga0068864_1001190922 280
475 3300005843 Ga0068860_100040136 Ga0068860_1000401362 280
476 3300005844 Ga0068862_100030858 Ga0068862_1000308583 280
477 3300005983 Ga0081540_1022242 Ga0081540_10222423 280
478 3300005985 Ga0081539_10062158 Ga0081539_100621582 280
479 3300006173 Ga0070716_100001131 Ga0070716_1000011313 280
480 3300006844 Ga0075428_100058129 Ga0075428_1000581293 280
481 3300006844 Ga0075428_100102262 Ga0075428_1001022622 280
482 3300006844 Ga0075428_100442042 Ga0075428_1004420422 280
483 3300006846 Ga0075430_100031603 Ga0075430_1000316033 280
484 3300006846 Ga0075430_100117832 Ga0075430_1001178322 280
485 3300006847 Ga0075431_100000049 Ga0075431_1000000492 280
486 3300006847 Ga0075431_100026093 Ga0075431_1000260933 280
487 3300006847 Ga0075431_100196809 Ga0075431_1001968092 280
488 3300006852 Ga0075433_10087235 Ga0075433_100872352 280
489 3300006852 Ga0075433_10139106 Ga0075433_101391062 280
490 3300006871 Ga0075434_100030642 Ga0075434_1000306422 280
491 3300006880 Ga0075429_100045351 Ga0075429_1000453512 280
492 3300006914 Ga0075436_100136418 Ga0075436_1001364182 280
493 3300007076 Ga0075435_100056712 Ga0075435_1000567123 280
494 3300007076 Ga0075435_100102142 Ga0075435_1001021423 280
495 3300007076 Ga0075435_100153526 Ga0075435_1001535262 280
496 3300007265 Ga0099794_10066651 Ga0099794_100666512 280
497 3300007265 Ga0099794_10172291 Ga0099794_101722912 280
498 3300007265 Ga0099794_10187721 Ga0099794_101877211 280
499 3300009147 Ga0114129_10000479 Ga0114129_1000047927 280
500 3300009147 Ga0114129_10034512 Ga0114129_100345126 280
501 3300009147 Ga0114129_10043947 Ga0114129_100439474 280
502 3300009147 Ga0114129_10306203 Ga0114129_103062032 280
503 3300009147 Ga0114129_10547089 Ga0114129_105470892 280
504 3300009177 Ga0105248_10143623 Ga0105248_101436232 280
505 3300009177 Ga0105248_10562011 Ga0105248_105620112 280
506 3300014326 Ga0157380_10117120 Ga0157380_101171202 280
507 3300025905 Ga0207685_10041883 Ga0207685_100418832 280
508 3300025906 Ga0207699_10204338 Ga0207699_102043381 280
509 3300025910 Ga0207684_10000105 Ga0207684_10000105120 280
510 3300025910 Ga0207684_10287016 Ga0207684_102870162 280
511 3300025910 Ga0207684_10343765 Ga0207684_103437652 280
512 3300025922 Ga0207646_10028308 Ga0207646_100283083 280
513 3300025922 Ga0207646_10230967 Ga0207646_102309672 280
514 3300025935 Ga0207709_10164113 Ga0207709_101641132 280
515 3300025936 Ga0207670_10265708 Ga0207670_102657081 280
516 3300025938 Ga0207704_10065568 Ga0207704_100655682 280
517 3300025942 Ga0207689_10005014 Ga0207689_100050144 280
518 3300026035 Ga0207703_10361750 Ga0207703_103617502 280
519 3300026075 Ga0207708_10274130 Ga0207708_102741302 280
520 3300026089 Ga0207648_10158257 Ga0207648_101582572 280
521 3300026095 Ga0207676_10068770 Ga0207676_100687702 280
522 3300027424 Ga0209984_1000895 Ga0209984_10008952 280
523 3300027471 Ga0209995_1000412 Ga0209995_10004124 280
524 3300027526 Ga0209968_1001582 Ga0209968_10015823 280
525 3300027614 Ga0209970_1000985 Ga0209970_10009854 280
526 3300027665 Ga0209983_1000242 Ga0209983_10002426 280
527 3300027682 Ga0209971_1000034 Ga0209971_100003430 280
528 3300027695 Ga0209966_1000109 Ga0209966_100010915 280
529 3300027717 Ga0209998_10000010 Ga0209998_1000001066 280
530 3300027717 Ga0209998_10032290 Ga0209998_100322901 280
531 3300027876 Ga0209974_10001764 Ga0209974_100017646 280
532 3300028380 Ga0268265_10082636 Ga0268265_100826362 280
533 3300031548 Ga0307408_100090312 Ga0307408_1000903122 280
534 3300031901 Ga0307406_10119893 Ga0307406_101198932 280
535 3300035691 Ga0373931_0038630 Ga0373931_0038630_786_1730 280
536 3300037312 Ga0395899_0009056 Ga0395899_0009056_111_1055 280
537 3300037418 Ga0395900_0008032 Ga0395900_0008032_7618_8562 280
538 3300037418 Ga0395900_0012079 Ga0395900_0012079_1109_2026 280
539 3300037466 Ga0395898_0001503 Ga0395898_0001503_9921_10838 280
540 3300037466 Ga0395898_0172039 Ga0395898_0172039_160_1104 280
541 3300038443 Ga0395901_0020242 Ga0395901_0020242_5715_6659 280
542 3300038443 Ga0395901_0274140 Ga0395901_0274140_101_1018 280
543 3300042005 Ga0439448_0010675 Ga0439448_0010675_943_1944 280
544 3300042439 Ga0439464_0007748 Ga0439464_0007748_63_1013 280
545 3300042461 Ga0439460_0025397 Ga0439460_0025397_212_1213 280
546 3300042876 Ga0451577_0053645 Ga0451577_0053645_116_1117 280
547 3300042876 Ga0451577_0095818 Ga0451577_0095818_236_1180 280
548 3300044658 Ga0466972_0000124 Ga0466972_0000124_24956_25873 280
549 3300045051 Ga0451576_0141592 Ga0451576_0141592_1262_2263 280
550 3300045051 Ga0451576_0235333 Ga0451576_0235333_287_1231 280
551 3300046472 Ga0495580_0000443 Ga0495580_0000443_14605_15549 280
552 3300046528 Ga0495642_0044113 Ga0495642_0044113_62_1006 280
553 3300049570 Ga0501033_0151829 Ga0501033_0151829_98_1051 280
554 3300049574 Ga0501038_0093353 Ga0501038_0093353_833_1777 280
555 3300049575 Ga0501039_0099966 Ga0501039_0099966_947_1894 280
556 3300049577 Ga0501041_0010986 Ga0501041_0010986_746_1690 280
557 3300049578 Ga0501042_0017554 Ga0501042_0017554_817_1764 280
558 3300049578 Ga0501042_0260962 Ga0501042_0260962_11_949 280
559 3300049580 Ga0501046_0007294 Ga0501046_0007294_455_1399 280
560 3300049582 Ga0501048_0068168 Ga0501048_0068168_911_1858 280
561 3300049588 Ga0501072_0136212 Ga0501072_0136212_288_1286 280
562 3300049590 Ga0501074_0173014 Ga0501074_0173014_376_1320 280
563 3300049591 Ga0501075_0005080 Ga0501075_0005080_197_1141 280
564 3300049591 Ga0501075_0173363 Ga0501075_0173363_63_1010 280
565 3300049592 Ga0501076_0002358 Ga0501076_0002358_9845_10789 280
566 3300049593 Ga0501077_0020850 Ga0501077_0020850_1333_2277 280
567 3300049743 Ga0501081_0000283 Ga0501081_0000283_23913_24857 280
568 3300049743 Ga0501081_0108144 Ga0501081_0108144_222_1223 280
569 3300049744 Ga0501083_0104628 Ga0501083_0104628_83_1030 280
570 3300049822 Ga0501035_0229657 Ga0501035_0229657_584_1528 280
571 3300049824 Ga0501045_0063021 Ga0501045_0063021_802_1746 280
572 3300049824 Ga0501045_0315466 Ga0501045_0315466_153_1100 280
573 3300050507 nmdc:mga05p37_18189_c1 nmdc:mga05p37_18189_c1_110_1045 280
574 3300050507 nmdc:mga05p37_18838_c1 nmdc:mga05p37_18838_c1_3168_4103 280
575 3300050507 nmdc:mga05p37_34635_c1 nmdc:mga05p37_34635_c1_3535_4551 280
576 3300050507 nmdc:mga05p37_4953_c1 nmdc:mga05p37_4953_c1_10665_11600 280
577 3300050508 nmdc:mga09592_121178_c1 nmdc:mga09592_121178_c1_1176_2108 280
578 3300050509 nmdc:mga0qj67_99141_c1 nmdc:mga0qj67_99141_c1_240_1175 280
579 3300050510 nmdc:mga06r32_101066_c1 nmdc:mga06r32_101066_c1_1406_2341 280
580 3300050512 nmdc:mga0n895_153208_c1 nmdc:mga0n895_153208_c1_851_1795 280
581 3300050512 nmdc:mga0n895_52844_c1 nmdc:mga0n895_52844_c1_1242_2186 280
582 3300050513 nmdc:mga0rr50_47184_c1 nmdc:mga0rr50_47184_c1_149_1087 280
583 3300050513 nmdc:mga0rr50_71815_c1 nmdc:mga0rr50_71815_c1_926_1870 280
584 3300050515 nmdc:mga0a205_126690_c1 nmdc:mga0a205_126690_c1_621_1565 280
585 3300050515 nmdc:mga0a205_245018_c1 nmdc:mga0a205_245018_c1_38_976 280
586 3300050515 nmdc:mga0a205_86822_c1 nmdc:mga0a205_86822_c1_55_999 280
587 3300053093 Ga0500651_0239377 Ga0500651_0239377_97_1014 280
588 3300053737 Ga0500601_000106 Ga0500601_000106_7127_8044 280
589 3300054114 Ga0501084_0049986 Ga0501084_0049986_668_1612 280
590 3300054114 Ga0501084_0210103 Ga0501084_0210103_476_1429 280
591 3300055283 Ga0500661_012999 Ga0500661_012999_525_1442 280
592 3300060353 Ga0501082_0006448 Ga0501082_0006448_7774_8718 280
593 3300061734 Ga0530510_0007383 Ga0530510_0007383_2178_3122 280
594 3300061734 Ga0530510_0089589 Ga0530510_0089589_222_1169 280
595 3300061734 Ga0530510_0123608 Ga0530510_0123608_473_1402 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

154

340

0.95

PF02660

G3P_acyltransf

Glycerol-3-phosphate acyltransferase

28

118

0.91

Feature Viewer

pLDDT pTM Quality
59.79 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map