metagRoot

F467394

General Info

Members	Datasets	Scaffolds	Average Seq Length
594	363	506	287

Family's Representative Sequence

Representative Sequence	3300049576\|Ga0501040_0023542\|Ga0501040_0023542_2924_3913
Length	329
Sequence	MRHILRARRARVTGSHENFAVERAVCGRCARAPYPWSYAGTVPELPEVEALAVDLQTRLTGRAVARVDIAAFSALKTFDPPVSALHGGFVDGVTRHGKFLDLDVSGLHLVVHLSRAGWVRWRDEVPATPPRPSNKSPIAARVVLDNGAGFDLTEAGTQKRLAMYVVRDPAEVPGIARLGPDPLAEGFTRDALRRILEEAGRAQLKGVLRDQSVVAGIGNAYSDEVLHAARMSPFKPASSVEGPELEVLYDAIRTVLGAAVDRSRGLAAADLKGEKKSHLAVHGRAGQPCPVCGDTVREVSFADSSLQYCPTCQTGGKLLADRRMSRLLK

Samples

	Sample ID	Description	Type	Environment
1	2508501039	Frankia saprophytica CN3	Isolate	Nodule
2	2517572101	Frankia sp. DC12	Isolate	Nodule
3	2585428157	Microbacterium sp. CF335	Isolate	Rhizosphere
4	2616644814	Streptomyces mirabilis OK461	Isolate	Rhizosphere
5	2626541554	Frankia sp. AvcI.1	Isolate	Nodule
6	2643221542	Microbacterium sp. Root1433D1	Isolate	Unclassified
7	2643221546	Microbacterium sp. Root53	Isolate	Unclassified
8	2643221553	Microbacterium sp. Root553	Isolate	Unclassified
9	2643221566	Microbacterium sp. Root166	Isolate	Unclassified
10	2643221575	Microbacterium sp. Root61	Isolate	Unclassified
11	2643221597	Microbacterium sp. Root180	Isolate	Unclassified
12	2643221601	Kitasatospora sp. Root187	Isolate	Unclassified
13	2643221604	Nocardioides sp. Root190	Isolate	Unclassified
14	2643221630	Microbacterium sp. Root322	Isolate	Unclassified
15	2643221631	Kitasatospora sp. Root107	Isolate	Unclassified
16	2643221632	Leifsonia sp. Root112D2	Isolate	Unclassified
17	2643221679	Angustibacter sp. Root456	Isolate	Unclassified
18	2675902999	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
19	2687453737	Frankia sp. BMG5.36	Isolate	Nodule
20	2731639228	Motilibacter peucedani DSM 45328	Isolate	Rhizosphere
21	2739367898	Nocardioides sp. CF479	Isolate	Unclassified
22	2747842429	Microbacterium sp. WCS2014-259	Isolate	Unclassified
23	2757320536	Microbacterium sp. NFIX05	Isolate	Unclassified
24	2773857758	Microbacterium chocolatum 1320	Isolate	Unclassified
25	2773857759	Microbacterium sp. 1294	Isolate	Unclassified
26	2773857762	Nocardioides sp. SAI-095	Isolate	Unclassified
27	2773857921	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
28	2784132148	Streptomyces sp. E5N91 SAI-083	Isolate	Unclassified
29	2799112218	Motilibacter rhizosphaerae DSM 45622	Isolate	Rhizosphere
30	2808606368	Microbacterium sp. SLBN-1	Isolate	Unclassified
31	2808606370	Arthrobacter sp. SLBN-100	Isolate	Unclassified
32	2808606439	Nocardioides sp. SLBN-172	Isolate	Unclassified
33	2808606447	Microbacterium sp. HAR-UPW-R2A-48	Isolate	Unclassified
34	2811994872	Microbacterium sp. MU4Y-5-1	Isolate	Unclassified
35	2811994878	Nocardioides sp. SLBN-169	Isolate	Unclassified
36	2816332119	Kribbella amoyensis DSM 24683	Isolate	Rhizosphere
37	2821268502	Microbacterium sp. YT0620BN	Isolate	Unclassified
38	2837268691	Jiangella endophytica KE2-3	Isolate	Rhizosphere
39	2852632344	Microbacterium sp. AK009	Isolate	Rhizosphere
40	2852646457	Microbacterium sp. AK031	Isolate	Rhizosphere
41	2852663356	Microbacterium sp. JAI119	Isolate	Rhizosphere
42	2857720070	Microbacterium sp. R-72113	Isolate	Unclassified
43	2857723135	Microbacterium sp. R-72356	Isolate	Unclassified
44	2862178590	Streptomyces sp. SDr-06	Isolate	Rhizosphere
45	2862382967	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
46	2862705112	Streptomyces triticirhizae NEAU-YY642	Isolate	Rhizosphere
47	2863404153	Streptomyces scabiei SAI-025 (Annotation) (version 2)	Isolate	Unclassified
48	2868088558	Phytoactinopolyspora endophytica EGI 60009	Isolate	Unclassified
49	2870628048	Microbacterium thalassium DSM 12511	Isolate	Rhizosphere
50	2887443736	Ruania rhizosphaerae LNNU 22110	Isolate	Rhizosphere
51	2887478801	Catellatospora paridis NEAU-CL2	Isolate	Rhizosphere
52	2891968417	Nocardioides luteus SAI-037	Isolate	Unclassified
53	2904509784	Microbacterium sp. 1676	Isolate	Rhizosphere
54	2908678064	Microbacterium sp. 1518	Isolate	Rhizosphere
55	2912723979	Streptomyces sp. NEAU-sy36	Isolate	Rhizosphere
56	2919069694	Microbacterium sp. 1154	Isolate	Unclassified
57	2919391150	Arthrobacter ipis 2973	Isolate	Unclassified
58	2919395869	Microbacterium resistens 2980	Isolate	Unclassified
59	2928090899	Microbacterium sp. 1262	Isolate	Rhizosphere
60	2939598168	Arthrobacter sp. 754	Isolate	Rhizosphere
61	2945956166	Arthrobacter globiformus W2I3	Isolate	Rhizosphere
62	2945968032	Microbacterium murale W2I7	Isolate	Rhizosphere
63	2946041624	Microbacterium natoriense W4I9-1	Isolate	Rhizosphere
64	2946080515	Microbacterium sp. W4I20	Isolate	Rhizosphere
65	2966921586	Rathayibacter agropyri 617	Isolate	Rhizosphere
66	2974294766	Microbacterium proteolyticum SORGH_AS 209	Isolate	Unclassified
67	2974324384	Microbacterium sp. SORGH_AS 344	Isolate	Unclassified
68	2977228692	Microbacterium sp. SORGH_AS 421	Isolate	Unclassified
69	2977236895	Microbacterium testaceum SORGH_AS 426	Isolate	Unclassified
70	2977251589	Microbacterium sp. SORGH_AS 505	Isolate	Unclassified
71	2977264416	Microbacterium testaceum SORGH_AS 594	Isolate	Unclassified
72	2984542743	Microbacterium sp. SORGH_AS454	Isolate	Aerial Root
73	2984580707	Microbacterium paludicola SORGH_AS919	Isolate	Aerial Root
74	2990044586	Streptomyces sedi JCM 16909	Isolate	Unclassified
75	2990059506	Streptomyces sp. CAP261	Isolate	Unclassified
76	2990088156	Streptomyces albidus CAP 215	Isolate	Unclassified
77	3006425503	Streptomyces zingiberis PLAI1-29	Isolate	Unclassified
78	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
79	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
80	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
81	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
82	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
83	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
84	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
85	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
86	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
87	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
88	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
89	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
90	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
91	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
92	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
93	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
94	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
95	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
96	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
97	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
98	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
99	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
100	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
101	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
102	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
103	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
104	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
105	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
106	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
107	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
108	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
109	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
110	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
111	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
112	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
113	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
114	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
115	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
116	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
117	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
118	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
119	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
120	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
121	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
122	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
123	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
124	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
125	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
126	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
127	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
128	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
129	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
130	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
131	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
132	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
133	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
134	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
135	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
136	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
137	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
138	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
139	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
140	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
141	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
142	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
143	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
144	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
145	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
146	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
147	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
148	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
172	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
176	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
177	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
178	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
179	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
180	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
181	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
182	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
183	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
184	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
185	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
186	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
187	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
188	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
189	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
190	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
191	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
192	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
193	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
194	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
195	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
196	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
197	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
198	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
199	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
200	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
201	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
202	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
203	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
204	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
205	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
206	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
207	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
208	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
209	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
210	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
211	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
212	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
213	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
214	3300041492	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG	Metagenome	Unclassified
215	3300041511	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG	Metagenome	Unclassified
216	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
217	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
218	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
219	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
220	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
221	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
222	3300042131	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130	Metagenome	Rhizosphere
223	3300042134	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126	Metagenome	Rhizosphere
224	3300042135	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127	Metagenome	Rhizosphere
225	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
226	3300042147	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618	Metagenome	Rhizosphere
227	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
228	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
229	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
230	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
231	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
232	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
233	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
234	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
235	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
236	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
237	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
238	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
239	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
240	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
241	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
242	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
243	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
244	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
245	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
246	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
247	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
248	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
249	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
250	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
251	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
252	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
253	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
254	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
255	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
256	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
257	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
258	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
259	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
260	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
261	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
262	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
263	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
264	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
265	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
266	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
267	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
268	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
269	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
270	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
271	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
272	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
273	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
274	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
275	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
276	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
277	3300048090	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere	Metagenome	Rhizosphere
278	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
279	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
280	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
281	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
282	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
283	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
284	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
285	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
286	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
287	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
288	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
289	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
290	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
291	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
292	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
293	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
294	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
295	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
296	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
297	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
298	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
299	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
300	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
301	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
302	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
303	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
304	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
305	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
306	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
307	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
308	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
309	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
310	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
311	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
312	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
313	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
314	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
315	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
316	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
317	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
318	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
319	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
320	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
321	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
322	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
323	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
324	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
325	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
326	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
327	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
328	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
329	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
330	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
331	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
332	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
333	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
334	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
335	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
336	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
337	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
338	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
339	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
340	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
341	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
342	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
343	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
344	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
345	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
346	3300053139	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere	Metagenome	Endosphere
347	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
348	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
349	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
350	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
351	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
352	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
353	8002775197	Frankia nepalensis CN7	Isolate	Nodule
354	8002784119	Frankia sp. AgB1.9	Isolate	Nodule
355	8004025490	Arthrobacter wenxiniae AETb3-4	Isolate	Rhizosphere
356	8004182704	Microbacterium paraoxydans ku-mp	Isolate	Unclassified
357	8008485437	Streptomyces mimosae 3MP-10	Isolate	Unclassified
358	8008558824	Streptomyces scabiei NRRL B-2795	Isolate	Nodule
359	8016254467	Microbacterium sp. SLBN-111 (version 3)	Isolate	Rhizosphere
360	8025524527	Streptomyces sp. 3MP-14	Isolate	Unclassified
361	8046352972	Agromyces mangrovi NBRC 112812	Isolate	Rhizosphere
362	8054609563	Nocardioides astragali CGMCC 4.7327	Isolate	Nodule
363	8056667051	Streptomyces sichuanensis SCA3-4	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	84.68
Metatranscriptomes	0.51
Isolates	14.81

Biome Distribution

Category	Percentage (%)
Aerial Root	0.34
Bulb	0
Endosphere	5.05
Nodule	1.85
Rhizoplane	7.24
Rhizosphere	67.17
Stem	0
Stem Tuber	0
Unclassified	18.35

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24737J22298_10004010	3300001990	Bacteria	5152
2	JGI25154J39366_1001301	3300002738	Bacteria	9272
3	Ga0006562J51391_1060070	3300003578	Bacteria	13700
4	Ga0006562J51391_1060071	3300003578	Bacteria	9073
5	Ga0070658_10003566	3300005327	Bacteria	12785
6	Ga0070658_10101253	3300005327	Bacteria	2382
7	Ga0070658_10262823	3300005327	Bacteria	1466
8	Ga0070676_10048796	3300005328	Bacteria	2476
9	Ga0070683_100003421	3300005329	Bacteria	12878
10	Ga0068869_100002169	3300005334	Bacteria	11808
11	Ga0070666_10005372	3300005335	Bacteria	7855
12	Ga0070680_100000189	3300005336	Bacteria	39692
13	Ga0070680_100184959	3300005336	Bacteria	1755
14	Ga0068868_100002444	3300005338	Bacteria	12881
15	Ga0070660_100069053	3300005339	Bacteria	2755
16	Ga0070661_100029278	3300005344	Bacteria	3974
17	Ga0070692_10057061	3300005345	Bacteria	2046
18	Ga0070692_10113621	3300005345	Bacteria	1501
19	Ga0070668_100018016	3300005347	Bacteria	5298
20	Ga0070668_100051893	3300005347	Bacteria	3161
21	Ga0070669_100261470	3300005353	Bacteria	1381
22	Ga0070671_100059598	3300005355	Bacteria	3177
23	Ga0070659_100026879	3300005366	Bacteria	4430
24	Ga0070659_100103994	3300005366	Bacteria	2287
25	Ga0070667_100001479	3300005367	Bacteria	21070
26	Ga0070714_100058537	3300005435	Bacteria	3301
27	Ga0070662_100005809	3300005457	Bacteria	7913
28	Ga0070707_100125061	3300005468	Bacteria	2498
29	Ga0070698_100077942	3300005471	Bacteria	3313
30	Ga0070684_100034013	3300005535	Bacteria	4355
31	Ga0070665_100003571	3300005548	Bacteria	16486
32	Ga0070704_100117578	3300005549	Bacteria	2035
33	Ga0068855_100217732	3300005563	Bacteria	2143
34	Ga0070664_100000792	3300005564	Bacteria	24329
35	Ga0070664_100455541	3300005564	Bacteria	1175
36	Ga0068857_100030124	3300005577	Bacteria	4789
37	Ga0070702_100007179	3300005615	Bacteria	5321
38	Ga0068859_100001317	3300005617	Bacteria	25325
39	Ga0068859_100018393	3300005617	Bacteria	7025
40	Ga0068863_100001588	3300005841	Bacteria	22502
41	Ga0068858_100000034	3300005842	Bacteria	140680
42	Ga0068858_100057544	3300005842	Bacteria	3593
43	Ga0068860_100000253	3300005843	Bacteria	79802
44	Ga0068860_100000465	3300005843	Bacteria	50703
45	Ga0068860_100133605	3300005843	Bacteria	2382
46	Ga0068862_100000252	3300005844	Bacteria	59906
47	Ga0068862_100217466	3300005844	Bacteria	1729
48	Ga0081455_10000525	3300005937	Bacteria	49722
49	Ga0081455_10046483	3300005937	Bacteria	3765
50	Ga0081538_10000255	3300005981	Bacteria	60411
51	Ga0081539_10000182	3300005985	Bacteria	148133
52	Ga0075365_10064352	3300006038	Bacteria	2456
53	Ga0075365_10154578	3300006038	Bacteria	1596
54	Ga0075363_100111919	3300006048	Bacteria	1518
55	Ga0075364_10002439	3300006051	Bacteria	10414
56	Ga0075364_10035568	3300006051	Bacteria	3219
57	Ga0075364_10058232	3300006051	Bacteria	2532
58	Ga0075364_10075988	3300006051	Bacteria	2216
59	Ga0075364_10081209	3300006051	Bacteria	2144
60	Ga0075367_10036579	3300006178	Bacteria	2848
61	Ga0075367_10072046	3300006178	Bacteria	2079
62	Ga0075428_100000233	3300006844	Bacteria	54028
63	Ga0075428_100022635	3300006844	Bacteria	6957
64	Ga0075428_100033288	3300006844	Bacteria	5691
65	Ga0075430_100094599	3300006846	Bacteria	2498
66	Ga0075431_100000146	3300006847	Bacteria	47784
67	Ga0075431_100010318	3300006847	Bacteria	9386
68	Ga0075431_100054635	3300006847	Bacteria	4118
69	Ga0075431_100099371	3300006847	Bacteria	3003
70	Ga0075429_100081822	3300006880	Bacteria	2815
71	Ga0097620_100001317	3300006931	Bacteria	25325
72	Ga0097620_100018394	3300006931	Bacteria	7025
73	Ga0105244_10025499	3300009036	Bacteria	3213
74	Ga0105244_10080163	3300009036	Bacteria	1617
75	Ga0105244_10090200	3300009036	Bacteria	1508
76	Ga0111539_10006615	3300009094	Bacteria	14932
77	Ga0111539_10936212	3300009094	Bacteria	1007
78	Ga0105245_10011832	3300009098	Bacteria	7590
79	Ga0105247_10000589	3300009101	Bacteria	29511
80	Ga0114129_10007962	3300009147	Bacteria	15086
81	Ga0114129_10087134	3300009147	Bacteria	4330
82	Ga0105243_10063173	3300009148	Bacteria	2967
83	Ga0105248_10000475	3300009177	Bacteria	45720
84	Ga0105248_10151398	3300009177	Bacteria	2617
85	Ga0105237_10166234	3300009545	Bacteria	2205
86	Ga0105238_10316429	3300009551	Bacteria	1546
87	Ga0105249_10019654	3300009553	Bacteria	6029
88	Ga0105239_10455502	3300010375	Bacteria	1452
89	Ga0157371_10032657	3300013102	Bacteria	3744
90	Ga0157370_10247942	3300013104	Bacteria	1647
91	Ga0157369_10113825	3300013105	Bacteria	2874
92	Ga0157369_10132448	3300013105	Bacteria	2641
93	Ga0157372_10085202	3300013307	Bacteria	3584
94	Ga0157372_10111616	3300013307	Bacteria	3132
95	Ga0157372_10162153	3300013307	Bacteria	2584
96	Ga0157372_10637407	3300013307	Bacteria	1241
97	Ga0157372_10669169	3300013307	Bacteria	1209
98	Ga0163163_10041475	3300014325	Bacteria	4500
99	Ga0163163_10379904	3300014325	Bacteria	1470
100	Ga0157380_10040629	3300014326	Bacteria	3624
101	Ga0157380_10174246	3300014326	Bacteria	1883
102	Ga0157377_10006983	3300014745	Bacteria	5424
103	Ga0157379_10000407	3300014968	Bacteria	34932
104	Ga0206353_11564438	3300020082	Bacteria	10580
105	Ga0209646_1000092	3300025246	Bacteria	185930
106	Ga0209455_1002817	3300025272	Bacteria	6468
107	Ga0209758_1004650	3300025297	Bacteria	11242
108	Ga0207426_1000824	3300025302	Bacteria	33183
109	Ga0207655_1001398	3300025728	Bacteria	22553
110	Ga0207655_1088985	3300025728	Bacteria	1091
111	Ga0207710_10000121	3300025900	Bacteria	94774
112	Ga0207680_10002643	3300025903	Bacteria	8373
113	Ga0207647_10014184	3300025904	Bacteria	5501
114	Ga0207705_10093982	3300025909	Bacteria	2198
115	Ga0207684_10270441	3300025910	Bacteria	1466
116	Ga0207707_10006175	3300025912	Bacteria	10466
117	Ga0207707_10281034	3300025912	Bacteria	1442
118	Ga0207671_10124203	3300025914	Bacteria	1975
119	Ga0207657_10207594	3300025919	Bacteria	1573
120	Ga0207649_10021024	3300025920	Bacteria	3749
121	Ga0207652_10057512	3300025921	Bacteria	3349
122	Ga0207659_10002744	3300025926	Bacteria	10498
123	Ga0207687_10022068	3300025927	Bacteria	4235
124	Ga0207664_10048914	3300025929	Bacteria	3327
125	Ga0207690_10285637	3300025932	Bacteria	1286
126	Ga0207706_10005411	3300025933	Bacteria	11900
127	Ga0207686_10428842	3300025934	Bacteria	1013
128	Ga0207709_10017876	3300025935	Bacteria	3964
129	Ga0207709_10144372	3300025935	Bacteria	1640
130	Ga0207709_10182782	3300025935	Bacteria	1482
131	Ga0207704_10118280	3300025938	Bacteria	1807
132	Ga0207711_10000403	3300025941	Bacteria	45691
133	Ga0207689_10011495	3300025942	Bacteria	7588
134	Ga0207661_10010731	3300025944	Bacteria	6603
135	Ga0207679_10023441	3300025945	Bacteria	4221
136	Ga0207667_10145209	3300025949	Bacteria	2442
137	Ga0207712_10016812	3300025961	Bacteria	4743
138	Ga0207668_10017721	3300025972	Bacteria	4468
139	Ga0207668_10169163	3300025972	Bacteria	1712
140	Ga0207640_10421345	3300025981	Bacteria	1093
141	Ga0207677_10011957	3300026023	Bacteria	4971
142	Ga0207703_10000057	3300026035	Bacteria	140694
143	Ga0207708_10043857	3300026075	Bacteria	3409
144	Ga0207702_10242922	3300026078	Bacteria	1688
145	Ga0207641_10000611	3300026088	Bacteria	39140
146	Ga0207641_10002900	3300026088	Bacteria	15517
147	Ga0207674_10040935	3300026116	Bacteria	4795
148	Ga0207674_10245336	3300026116	Bacteria	1738
149	Ga0207674_10255165	3300026116	Bacteria	1701
150	Ga0207675_100009489	3300026118	Bacteria	9107
151	Ga0207683_10664532	3300026121	Bacteria	966
152	Ga0207428_10012041	3300027907	Bacteria	7612
153	Ga0207428_10056161	3300027907	Bacteria	3128
154	Ga0268266_10001486	3300028379	Bacteria	27812
155	Ga0268266_10669242	3300028379	Bacteria	1000
156	Ga0268265_10000244	3300028380	Bacteria	62050
157	Ga0268265_10023549	3300028380	Bacteria	4342
158	Ga0268265_10055174	3300028380	Bacteria	3018
159	Ga0268264_10000138	3300028381	Bacteria	172597
160	Ga0268264_10000220	3300028381	Bacteria	111692
161	Ga0268264_10035506	3300028381	Bacteria	4105
162	Ga0265334_10001663	3300028573	Bacteria	10643
163	Ga0307511_10038346	3300030521	Bacteria	4116
164	Ga0307408_100458899	3300031548	Bacteria	1107
165	Ga0307508_10104543	3300031616	Bacteria	2429
166	Ga0316575_10001123	3300031665	Bacteria	8367
167	Ga0316575_10002650	3300031665	Bacteria	6032
168	Ga0316579_10002868	3300031691	Bacteria	6600
169	Ga0316576_10001208	3300031727	Bacteria	13637
170	Ga0316576_10008301	3300031727	Bacteria	6612
171	Ga0316576_10066760	3300031727	Bacteria	2646
172	Ga0316578_10010573	3300031728	Bacteria	4794
173	Ga0316578_10019878	3300031728	Bacteria	3704
174	Ga0316578_10079215	3300031728	Bacteria	1953
175	Ga0316578_10104232	3300031728	Bacteria	1701
176	Ga0316577_10041384	3300031733	Bacteria	2578
177	Ga0307413_10085731	3300031824	Bacteria	2034
178	Ga0307413_10255211	3300031824	Bacteria	1303
179	Ga0307413_10292372	3300031824	Bacteria	1231
180	Ga0307410_10031818	3300031852	Bacteria	3389
181	Ga0307410_10042483	3300031852	Bacteria	3005
182	Ga0307410_10102367	3300031852	Bacteria	2055
183	Ga0307406_10000126	3300031901	Bacteria	44932
184	Ga0307406_10000710	3300031901	Bacteria	18737
185	Ga0307406_10296134	3300031901	Bacteria	1241
186	Ga0307407_10013968	3300031903	Bacteria	3916
187	Ga0307407_10142493	3300031903	Bacteria	1548
188	Ga0307412_10043593	3300031911	Bacteria	2922
189	Ga0307409_100007030	3300031995	Bacteria	6692
190	Ga0307409_100133994	3300031995	Bacteria	2122
191	Ga0307409_100187819	3300031995	Bacteria	1836
192	Ga0307416_100277364	3300032002	Bacteria	1650
193	Ga0307416_100526510	3300032002	Bacteria	1251
194	Ga0307411_10165311	3300032005	Bacteria	1663
195	Ga0307415_100005929	3300032126	Bacteria	6544
196	Ga0307415_100022047	3300032126	Bacteria	3925
197	Ga0307415_100113676	3300032126	Bacteria	2014
198	Ga0316574_0008436	3300035398	Bacteria	5721
199	Ga0316574_0008894	3300035398	Bacteria	5603
200	Ga0316582_0019313	3300036647	Bacteria	3986
201	Ga0316582_0247795	3300036647	Bacteria	1221
202	Ga0316584_0028493	3300036712	Bacteria	4119
203	Ga0316584_0221497	3300036712	Bacteria	1390
204	Ga0395900_0015691	3300037418	Bacteria	7722
205	Ga0395900_0031379	3300037418	Bacteria	5459
206	Ga0395900_0042114	3300037418	Bacteria	4704
207	Ga0395898_0010055	3300037466	Bacteria	9902
208	Ga0395898_0059923	3300037466	Bacteria	3701
209	Ga0395898_0124220	3300037466	Bacteria	2473
210	Ga0395905_0072591	3300037471	Bacteria	3227
211	Ga0395901_0005579	3300038443	Bacteria	12737
212	Ga0395901_0058342	3300038443	Bacteria	4015
213	Ga0395901_0101306	3300038443	Bacteria	3022
214	Ga0395901_0304119	3300038443	Bacteria	1653
215	Ga0395901_0385999	3300038443	Bacteria	1441
216	Ga0436365_1502407	3300039437	Bacteria	1109
217	Ga0439436_0018413	3300041404	Bacteria	2088
218	Ga0451835_0580913	3300041492	Bacteria	1434
219	Ga0451855_1620110	3300041511	Bacteria	1629
220	Ga0451853_2629277	3300041512	Bacteria	9086
221	Ga0439433_0029419	3300041999	Bacteria	1253
222	Ga0439442_000620	3300042002	Bacteria	7632
223	Ga0439449_0000847	3300042007	Bacteria	11874
224	Ga0439449_0066273	3300042007	Bacteria	1332
225	Ga0439462_0012375	3300042015	Bacteria	2179
226	Ga0450920_001110	3300042122	Bacteria	4401
227	Ga0450894_001242	3300042131	Bacteria	3738
228	Ga0450898_000509	3300042134	Bacteria	4535
229	Ga0450899_002829	3300042135	Bacteria	1876
230	Ga0450907_000456	3300042146	Bacteria	11579
231	Ga0450910_024543	3300042147	Bacteria	925
232	Ga0439446_0074382	3300042156	Bacteria	1044
233	Ga0439434_0010447	3300042435	Bacteria	2735
234	Ga0466972_0075290	3300044658	Bacteria	1609
235	Ga0466965_0000007	3300044683	Bacteria	131940
236	Ga0466966_0236709	3300044684	Bacteria	1101
237	Ga0466963_0016752	3300044694	Bacteria	4561
238	Ga0466963_0147314	3300044694	Bacteria	1634
239	Ga0466968_0026868	3300044735	Bacteria	2366
240	Ga0466968_0101816	3300044735	Bacteria	1283
241	Ga0466970_0024165	3300044765	Bacteria	3177
242	Ga0466970_0047994	3300044765	Bacteria	2276
243	Ga0466970_0090731	3300044765	Bacteria	1658
244	Ga0466970_0104158	3300044765	Bacteria	1547
245	Ga0466960_0196152	3300044901	Bacteria	1101
246	Ga0466958_0076178	3300045836	Bacteria	2059
247	Ga0466967_0193409	3300045976	Bacteria	1924
248	Ga0495617_041617	3300046452	Bacteria	1535
249	Ga0495627_000262	3300046453	Bacteria	53953
250	Ga0495592_0045918	3300046454	Bacteria	3257
251	Ga0495603_0109756	3300046455	Bacteria	1609
252	Ga0495603_0196890	3300046455	Bacteria	1165
253	Ga0495629_0048100	3300046459	Bacteria	2990
254	Ga0495629_0269139	3300046459	Bacteria	1171
255	Ga0495638_0046748	3300046460	Bacteria	2718
256	Ga0495641_0047649	3300046461	Bacteria	1966
257	Ga0495662_0005005	3300046476	Bacteria	6639
258	Ga0495585_0147829	3300046492	Bacteria	1227
259	Ga0495594_0013319	3300046499	Bacteria	4291
260	Ga0495606_0002434	3300046507	Bacteria	21635
261	Ga0495606_0029651	3300046507	Bacteria	3836
262	Ga0495616_0019472	3300046513	Bacteria	3703
263	Ga0495620_0002832	3300046515	Bacteria	9965
264	Ga0495643_0002926	3300046522	Bacteria	12951
265	Ga0495648_0032941	3300046524	Bacteria	3392
266	Ga0495648_0073097	3300046524	Bacteria	1981
267	Ga0495666_0037075	3300046526	Bacteria	2372
268	Ga0495652_0053565	3300046529	Bacteria	3438
269	Ga0495609_0087041	3300046538	Bacteria	1361
270	Ga0495597_0037118	3300046542	Bacteria	2189
271	Ga0495622_0022529	3300046557	Bacteria	2935
272	Ga0495633_0028245	3300046558	Bacteria	2736
273	Ga0495667_0066766	3300046559	Bacteria	2351
274	Ga0495668_0000256	3300046616	Bacteria	75532
275	Ga0495668_0026125	3300046616	Bacteria	3315
276	Ga0495611_0090797	3300046648	Bacteria	1411
277	Ga0495625_0002602	3300046660	Bacteria	19309
278	Ga0495635_0055714	3300046663	Bacteria	2723
279	Ga0495588_0018096	3300046674	Bacteria	3432
280	Ga0495657_0212125	3300046675	Bacteria	1177
281	Ga0495613_0123300	3300046689	Bacteria	1859
282	Ga0495613_0133151	3300046689	Bacteria	1779
283	Ga0495613_0194210	3300046689	Bacteria	1433
284	Ga0495624_0033908	3300046690	Bacteria	3306
285	Ga0495649_0045243	3300046694	Bacteria	2400
286	Ga0495649_0083488	3300046694	Bacteria	1707
287	Ga0495600_0050824	3300046809	Bacteria	2705
288	Ga0495636_0006213	3300047318	Bacteria	4691
289	Ga0495636_0017926	3300047318	Bacteria	2838
290	Ga0495672_0197450	3300047320	Bacteria	1008
291	Ga0495676_0010308	3300047321	Bacteria	8478
292	Ga0495676_0114269	3300047321	Bacteria	1975
293	Ga0495676_0348648	3300047321	Bacteria	990
294	Ga0495685_002612	3300047447	Bacteria	5668
295	Ga0495685_024178	3300047447	Bacteria	2090
296	Ga0495681_0054561	3300047470	Bacteria	1867
297	Ga0495686_0091843	3300047472	Bacteria	1842
298	Ga0495614_0104834	3300048089	Bacteria	1238
299	Ga0495615_0020638	3300048090	Bacteria	1479
300	Ga0495626_0000088	3300048091	Bacteria	121421
301	Ga0496100_0031461	3300048903	Bacteria	3299
302	Ga0496101_0035091	3300048904	Bacteria	3546
303	Ga0496102_0059350	3300048905	Bacteria	3498
304	Ga0496102_0064780	3300048905	Bacteria	3348
305	Ga0496102_0248856	3300048905	Bacteria	1676
306	Ga0496102_0303265	3300048905	Bacteria	1505
307	Ga0496102_0323540	3300048905	Bacteria	1453
308	Ga0496103_0020246	3300048906	Bacteria	3996
309	Ga0496104_0012418	3300048907	Bacteria	7658
310	Ga0496104_0033342	3300048907	Bacteria	4796
311	Ga0496104_0056977	3300048907	Bacteria	3698
312	Ga0496105_0023498	3300048908	Bacteria	5000
313	Ga0496105_0045461	3300048908	Bacteria	3623
314	Ga0496105_0353488	3300048908	Bacteria	1173
315	Ga0496107_0011280	3300048910	Bacteria	6220
316	Ga0496107_0102898	3300048910	Bacteria	2095
317	Ga0496108_0049468	3300048911	Bacteria	3516
318	Ga0496108_0059433	3300048911	Bacteria	3214
319	Ga0496108_0497842	3300048911	Bacteria	1064
320	Ga0496109_0016340	3300048912	Bacteria	6486
321	Ga0496109_0059506	3300048912	Bacteria	3490
322	Ga0496109_0071766	3300048912	Bacteria	3180
323	Ga0496110_0005324	3300048913	Bacteria	10075
324	Ga0496110_0032303	3300048913	Bacteria	4519
325	Ga0496110_0197758	3300048913	Bacteria	1826
326	Ga0496111_0020173	3300048914	Bacteria	4638
327	Ga0496111_0070636	3300048914	Bacteria	2540
328	Ga0496111_0110296	3300048914	Bacteria	2026
329	Ga0496111_0480362	3300048914	Bacteria	916
330	Ga0496112_0077240	3300048915	Bacteria	3293
331	Ga0496113_0018461	3300048916	Bacteria	4858
332	Ga0496113_0117225	3300048916	Bacteria	2079
333	Ga0496113_0363790	3300048916	Bacteria	1161
334	Ga0496114_0010686	3300048917	Bacteria	7306
335	Ga0496114_0019218	3300048917	Bacteria	5536
336	Ga0496114_0026047	3300048917	Bacteria	4785
337	Ga0496114_0042424	3300048917	Bacteria	3771
338	Ga0496114_0087327	3300048917	Bacteria	2644
339	Ga0496114_0129478	3300048917	Bacteria	2178
340	Ga0496114_0229703	3300048917	Bacteria	1630
341	Ga0496114_0276078	3300048917	Bacteria	1481
342	Ga0496114_0520390	3300048917	Bacteria	1052
343	Ga0496115_0078414	3300048918	Bacteria	2687
344	Ga0496116_0001656	3300048919	Bacteria	24505
345	Ga0496116_0012555	3300048919	Bacteria	6911
346	Ga0496116_0161985	3300048919	Bacteria	1226
347	Ga0496117_0000028	3300048920	Bacteria	407392
348	Ga0496117_0001853	3300048920	Bacteria	28519
349	Ga0496117_0003899	3300048920	Bacteria	16913
350	Ga0496117_0004606	3300048920	Bacteria	15055
351	Ga0496117_0037269	3300048920	Bacteria	3624
352	Ga0496117_0052566	3300048920	Bacteria	2868
353	Ga0496117_0060650	3300048920	Bacteria	2605
354	Ga0496118_0003621	3300048921	Bacteria	19177
355	Ga0496118_0003698	3300048921	Bacteria	18959
356	Ga0496118_0008688	3300048921	Bacteria	10440
357	Ga0496118_0035307	3300048921	Bacteria	4062
358	Ga0496118_0068041	3300048921	Bacteria	2589
359	Ga0496119_0001581	3300048922	Bacteria	27095
360	Ga0496119_0004797	3300048922	Bacteria	13271
361	Ga0496119_0009291	3300048922	Bacteria	8465
362	Ga0496119_0015845	3300048922	Bacteria	5772
363	Ga0496119_0016789	3300048922	Bacteria	5545
364	Ga0496119_0034705	3300048922	Bacteria	3315
365	Ga0496119_0216006	3300048922	Bacteria	984
366	Ga0496120_0000697	3300048923	Bacteria	49216
367	Ga0496120_0002616	3300048923	Bacteria	17850
368	Ga0496120_0010600	3300048923	Bacteria	6410
369	Ga0496120_0015416	3300048923	Bacteria	5043
370	Ga0496120_0049950	3300048923	Bacteria	2397
371	Ga0496120_0138245	3300048923	Bacteria	1239
372	Ga0496121_0000076	3300048924	Bacteria	239775
373	Ga0496121_0006593	3300048924	Bacteria	14321
374	Ga0496121_0019918	3300048924	Bacteria	6677
375	Ga0496121_0099331	3300048924	Bacteria	2249
376	Ga0496122_0000020	3300048925	Bacteria	401675
377	Ga0496122_0001685	3300048925	Bacteria	34241
378	Ga0496122_0004690	3300048925	Bacteria	16786
379	Ga0496122_0019660	3300048925	Bacteria	6156
380	Ga0496123_0000003	3300048926	Bacteria	866556
381	Ga0496123_0000718	3300048926	Bacteria	54060
382	Ga0496123_0000802	3300048926	Bacteria	50829
383	Ga0496124_0042333	3300048927	Bacteria	3922
384	Ga0496124_0048191	3300048927	Bacteria	3642
385	Ga0496124_0090111	3300048927	Bacteria	2503
386	Ga0496125_0000242	3300048928	Bacteria	112000
387	Ga0496125_0003079	3300048928	Bacteria	20827
388	Ga0496125_0020369	3300048928	Bacteria	6223
389	Ga0496125_0138287	3300048928	Bacteria	1699
390	Ga0496126_0000496	3300048929	Bacteria	77654
391	Ga0496126_0006742	3300048929	Bacteria	12749
392	Ga0496126_0007017	3300048929	Bacteria	12432
393	Ga0496126_0014147	3300048929	Bacteria	8076
394	Ga0496126_0032117	3300048929	Bacteria	4950
395	Ga0496126_0182945	3300048929	Bacteria	1779
396	Ga0501031_0316827	3300049568	Bacteria	1011
397	Ga0501032_0008393	3300049569	Bacteria	7533
398	Ga0501032_0011509	3300049569	Bacteria	6355
399	Ga0501032_0014307	3300049569	Bacteria	5619
400	Ga0501032_0037969	3300049569	Bacteria	3282
401	Ga0501032_0218654	3300049569	Bacteria	1240
402	Ga0501033_0025451	3300049570	Bacteria	4459
403	Ga0501033_0027959	3300049570	Bacteria	4239
404	Ga0501033_0056407	3300049570	Bacteria	2903
405	Ga0501034_0011059	3300049571	Bacteria	9372
406	Ga0501034_0020557	3300049571	Bacteria	6742
407	Ga0501034_0064449	3300049571	Bacteria	3678
408	Ga0501034_0101111	3300049571	Bacteria	2877
409	Ga0501034_0119377	3300049571	Bacteria	2623
410	Ga0501034_0165602	3300049571	Bacteria	2179
411	Ga0501034_0265035	3300049571	Bacteria	1660
412	Ga0501034_0312599	3300049571	Bacteria	1505
413	Ga0501034_0452051	3300049571	Bacteria	1202
414	Ga0501034_0516290	3300049571	Bacteria	1107
415	Ga0501034_0614626	3300049571	Bacteria	991
416	Ga0501036_0035345	3300049572	Bacteria	4228
417	Ga0501036_0061336	3300049572	Bacteria	3185
418	Ga0501036_0431466	3300049572	Bacteria	1098
419	Ga0501037_0087095	3300049573	Bacteria	2260
420	Ga0501037_0114673	3300049573	Bacteria	1939
421	Ga0501037_0183163	3300049573	Bacteria	1485
422	Ga0501037_0211176	3300049573	Bacteria	1369
423	Ga0501037_0223019	3300049573	Bacteria	1326
424	Ga0501038_0013217	3300049574	Bacteria	7529
425	Ga0501038_0070421	3300049574	Bacteria	2969
426	Ga0501038_0285785	3300049574	Bacteria	1297
427	Ga0501039_0081881	3300049575	Bacteria	2513
428	Ga0501040_0023542	3300049576	Bacteria	4130
429	Ga0501040_0106833	3300049576	Bacteria	1956
430	Ga0501041_0264490	3300049577	Bacteria	1082
431	Ga0501042_0268859	3300049578	Bacteria	1231
432	Ga0501042_0484564	3300049578	Bacteria	898
433	Ga0501043_0007291	3300049579	Bacteria	8779
434	Ga0501043_0014714	3300049579	Bacteria	6125
435	Ga0501047_0000016	3300049581	Bacteria	284621
436	Ga0501047_0026689	3300049581	Bacteria	5559
437	Ga0501047_0077776	3300049581	Bacteria	3190
438	Ga0501047_0084565	3300049581	Bacteria	3049
439	Ga0501048_0113451	3300049582	Bacteria	1914
440	Ga0501067_0082762	3300049583	Bacteria	1780
441	Ga0501068_0011087	3300049584	Bacteria	5074
442	Ga0501068_0325198	3300049584	Bacteria	986
443	Ga0501069_0028628	3300049585	Bacteria	3056
444	Ga0501070_0000980	3300049586	Bacteria	25623
445	Ga0501070_0006689	3300049586	Bacteria	9819
446	Ga0501070_0238443	3300049586	Bacteria	1489
447	Ga0501071_0001615	3300049587	Bacteria	13232
448	Ga0501072_0016192	3300049588	Bacteria	5719
449	Ga0501072_0022834	3300049588	Bacteria	4855
450	Ga0501073_0021904	3300049589	Bacteria	4604
451	Ga0501073_0209292	3300049589	Bacteria	1348
452	Ga0501074_0003698	3300049590	Bacteria	10844
453	Ga0501074_0132134	3300049590	Bacteria	1785
454	Ga0501077_0012606	3300049593	Bacteria	5294
455	Ga0501077_0301191	3300049593	Bacteria	1021
456	Ga0501079_0007138	3300049741	Bacteria	8432
457	Ga0501080_0006757	3300049742	Bacteria	10335
458	Ga0501080_0016560	3300049742	Bacteria	6809
459	Ga0501080_0025913	3300049742	Bacteria	5447
460	Ga0501083_0014915	3300049744	Bacteria	5435
461	Ga0501035_0012865	3300049822	Bacteria	7726
462	Ga0501035_0019015	3300049822	Bacteria	6323
463	Ga0501044_0006940	3300049823	Bacteria	12465
464	Ga0501044_0007902	3300049823	Bacteria	11696
465	Ga0501044_0041114	3300049823	Bacteria	4814
466	Ga0501044_0046159	3300049823	Bacteria	4511
467	Ga0501044_0283969	3300049823	Bacteria	1588
468	Ga0501044_0665643	3300049823	Bacteria	929
469	Ga0501045_0045755	3300049824	Bacteria	3186
470	Ga0501045_0140530	3300049824	Bacteria	1796
471	nmdc:mga03683_18939_c1	3300050489	Bacteria	1299
472	nmdc:mga00v17_27763_c1	3300050491	Bacteria	3307
473	nmdc:mga00v17_49395_c1	3300050491	Bacteria	2552
474	nmdc:mga00v17_70131_c1	3300050491	Bacteria	2170
475	nmdc:mga0yw44_15049_c1	3300050492	Bacteria	4130
476	nmdc:mga0yw44_290215_c1	3300050492	Bacteria	1094
477	nmdc:mga0yw44_90032_c1	3300050492	Bacteria	1937
478	nmdc:mga06z11_127936_c1	3300050494	Bacteria	1423
479	nmdc:mga06z11_6817_c1	3300050494	Bacteria	4669
480	nmdc:mga07m45_51088_c1	3300050496	Bacteria	2331
481	nmdc:mga05p37_301660_c1	3300050507	Bacteria	1903
482	nmdc:mga05p37_512_c1	3300050507	Bacteria	42901
483	nmdc:mga05p37_81293_c1	3300050507	Bacteria	3991
484	nmdc:mga09592_225_c1	3300050508	Bacteria	40713
485	nmdc:mga09592_47276_c1	3300050508	Bacteria	3627
486	nmdc:mga0qj67_20502_c1	3300050509	Bacteria	5062
487	nmdc:mga06r32_15919_c1	3300050510	Bacteria	6843
488	nmdc:mga06r32_25182_c1	3300050510	Bacteria	5532
489	nmdc:mga06r32_27569_c1	3300050510	Bacteria	5309
490	nmdc:mga06r32_439_c1	3300050510	Bacteria	35271
491	nmdc:mga06r32_89267_c1	3300050510	Bacteria	3009
492	nmdc:mga08y16_28492_c1	3300050511	Bacteria	5888
493	nmdc:mga08y16_504643_c1	3300050511	Bacteria	1229
494	nmdc:mga08y16_9459_c1	3300050511	Bacteria	10225
495	Ga0500635_0000066	3300053080	Bacteria	69274
496	Ga0500556_0096567	3300053104	Bacteria	1134
497	Ga0500568_0002836	3300053139	Bacteria	9990
498	Ga0500573_0078661	3300053140	Bacteria	1876
499	Ga0500573_0083242	3300053140	Bacteria	1816
500	Ga0500588_0015599	3300053146	Bacteria	1949
501	Ga0500616_0000302	3300053153	Bacteria	71543
502	Ga0501084_0009890	3300054114	Bacteria	7882
503	Ga0501084_0361821	3300054114	Bacteria	1226
504	Ga0501082_0014619	3300060353	Bacteria	6760
505	Ga0501082_0170237	3300060353	Bacteria	1894
506	Ga0466962_0105196	3300061719	Bacteria	1357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300031903	Ga0307407_10142493	Ga0307407_101424932	241
2	3300031995	Ga0307409_100007030	Ga0307409_1000070304	241
3	3300036712	Ga0316584_0221497	Ga0316584_0221497_379_1263	244
4	3300005327	Ga0070658_10003566	Ga0070658_100035664	249
5	3300049572	Ga0501036_0431466	Ga0501036_0431466_194_1075	254
6	3300046492	Ga0495585_0147829	Ga0495585_0147829_189_1046	256
7	3300031824	Ga0307413_10085731	Ga0307413_100857313	257
8	3300032126	Ga0307415_100005929	Ga0307415_1000059293	257
9	3300050494	nmdc:mga06z11_127936_c1	nmdc:mga06z11_127936_c1_116_997	257
10	3300006178	Ga0075367_10036579	Ga0075367_100365794	258
11	3300025934	Ga0207686_10428842	Ga0207686_104288421	259
12	3300031852	Ga0307410_10102367	Ga0307410_101023671	260
13	3300041492	Ga0451835_0580913	Ga0451835_0580913_510_1397	260
14	3300041511	Ga0451855_1620110	Ga0451855_1620110_312_1199	262
15	3300049571	Ga0501034_0312599	Ga0501034_0312599_614_1495	262
16	3300049573	Ga0501037_0114673	Ga0501037_0114673_10_804	262
17	3300049574	Ga0501038_0070421	Ga0501038_0070421_10_804	262
18	3300049582	Ga0501048_0113451	Ga0501048_0113451_10_804	262
19	3300031665	Ga0316575_10001123	Ga0316575_100011235	263
20	3300031995	Ga0307409_100187819	Ga0307409_1001878192	263
21	3300005981	Ga0081538_10000255	Ga0081538_1000025529	264
22	3300049824	Ga0501045_0140530	Ga0501045_0140530_437_1306	265
23	3300036647	Ga0316582_0247795	Ga0316582_0247795_118_1002	266
24	3300031903	Ga0307407_10013968	Ga0307407_100139684	267
25	3300005335	Ga0070666_10005372	Ga0070666_100053724	268
26	3300005347	Ga0070668_100018016	Ga0070668_1000180162	268
27	3300005355	Ga0070671_100059598	Ga0070671_1000595982	268
28	3300005367	Ga0070667_100001479	Ga0070667_1000014792	268
29	3300025903	Ga0207680_10002643	Ga0207680_100026436	268
30	3300025972	Ga0207668_10169163	Ga0207668_101691631	268
31	3300044765	Ga0466970_0090731	Ga0466970_0090731_661_1530	268
32	3300005347	Ga0070668_100051893	Ga0070668_1000518932	269
33	3300005468	Ga0070707_100125061	Ga0070707_1001250612	269
34	3300005471	Ga0070698_100077942	Ga0070698_1000779424	269
35	3300005549	Ga0070704_100117578	Ga0070704_1001175783	269
36	3300005563	Ga0068855_100217732	Ga0068855_1002177322	269
37	3300005843	Ga0068860_100133605	Ga0068860_1001336052	269
38	3300005844	Ga0068862_100217466	Ga0068862_1002174662	269
39	3300006846	Ga0075430_100094599	Ga0075430_1000945992	269
40	3300009094	Ga0111539_10006615	Ga0111539_1000661510	269
41	3300013105	Ga0157369_10132448	Ga0157369_101324483	269
42	3300013307	Ga0157372_10111616	Ga0157372_101116162	269
43	3300025910	Ga0207684_10270441	Ga0207684_102704411	269
44	3300025949	Ga0207667_10145209	Ga0207667_101452092	269
45	3300025972	Ga0207668_10017721	Ga0207668_100177214	269
46	3300028380	Ga0268265_10055174	Ga0268265_100551742	269
47	3300028381	Ga0268264_10035506	Ga0268264_100355062	269
48	3300031727	Ga0316576_10001208	Ga0316576_100012083	269
49	3300031728	Ga0316578_10019878	Ga0316578_100198782	269
50	3300050511	nmdc:mga08y16_9459_c1	nmdc:mga08y16_9459_c1_8678_9562	269
51	iso_pu_bacteria	2643221632	2644182627	269
52	3300048905	Ga0496102_0064780	Ga0496102_0064780_1642_2520	270
53	3300048919	Ga0496116_0001656	Ga0496116_0001656_3912_4790	270
54	3300048920	Ga0496117_0004606	Ga0496117_0004606_3781_4659	270
55	3300048921	Ga0496118_0003698	Ga0496118_0003698_14148_15026	270
56	3300048922	Ga0496119_0034705	Ga0496119_0034705_62_940	270
57	3300005843	Ga0068860_100000253	Ga0068860_10000025345	271
58	3300006038	Ga0075365_10064352	Ga0075365_100643523	271
59	3300006051	Ga0075364_10075988	Ga0075364_100759882	271
60	3300010375	Ga0105239_10455502	Ga0105239_104555023	271
61	3300028381	Ga0268264_10000220	Ga0268264_1000022056	271
62	3300050492	nmdc:mga0yw44_15049_c1	nmdc:mga0yw44_15049_c1_734_1612	271
63	3300049569	Ga0501032_0037969	Ga0501032_0037969_573_1439	272
64	3300049571	Ga0501034_0020557	Ga0501034_0020557_2562_3443	272
65	3300049571	Ga0501034_0064449	Ga0501034_0064449_2204_3064	272
66	3300049571	Ga0501034_0516290	Ga0501034_0516290_174_1040	272
67	3300049575	Ga0501039_0081881	Ga0501039_0081881_1277_2143	272
68	3300049579	Ga0501043_0007291	Ga0501043_0007291_497_1357	272
69	3300049581	Ga0501047_0026689	Ga0501047_0026689_58_918	272
70	3300049586	Ga0501070_0000980	Ga0501070_0000980_668_1528	272
71	3300049589	Ga0501073_0021904	Ga0501073_0021904_562_1422	272
72	3300049742	Ga0501080_0006757	Ga0501080_0006757_8812_9672	272
73	3300028573	Ga0265334_10001663	Ga0265334_100016636	273
74	3300046459	Ga0495629_0269139	Ga0495629_0269139_232_1089	273
75	3300046524	Ga0495648_0032941	Ga0495648_0032941_22_900	273
76	3300005842	Ga0068858_100000034	Ga0068858_10000003414	274
77	3300006048	Ga0075363_100111919	Ga0075363_1001119193	274
78	3300006051	Ga0075364_10058232	Ga0075364_100582324	274
79	3300009101	Ga0105247_10000589	Ga0105247_1000058915	274
80	3300014968	Ga0157379_10000407	Ga0157379_100004078	274
81	3300025900	Ga0207710_10000121	Ga0207710_1000012169	274
82	3300026035	Ga0207703_10000057	Ga0207703_10000057108	274
83	3300044765	Ga0466970_0024165	Ga0466970_0024165_82_957	274
84	3300048910	Ga0496107_0102898	Ga0496107_0102898_612_1496	274
85	3300048924	Ga0496121_0006593	Ga0496121_0006593_8555_9439	274
86	3300048924	Ga0496121_0099331	Ga0496121_0099331_1265_2200	274
87	3300049571	Ga0501034_0165602	Ga0501034_0165602_1087_1947	274
88	3300050489	nmdc:mga03683_18939_c1	nmdc:mga03683_18939_c1_36_902	274
89	3300050491	nmdc:mga00v17_49395_c1	nmdc:mga00v17_49395_c1_221_1087	274
90	3300050492	nmdc:mga0yw44_90032_c1	nmdc:mga0yw44_90032_c1_386_1264	274
91	3300050496	nmdc:mga07m45_51088_c1	nmdc:mga07m45_51088_c1_450_1328	274
92	3300061719	Ga0466962_0105196	Ga0466962_0105196_434_1309	274
93	3300005937	Ga0081455_10000525	Ga0081455_100005253	276
94	iso_pu_bacteria	2857723135	2857727014	276
95	3300039437	Ga0436365_1502407	Ga0436365_1502407_77_946	277
96	3300006038	Ga0075365_10154578	Ga0075365_101545782	278
97	3300006051	Ga0075364_10002439	Ga0075364_100024391	278
98	3300050491	nmdc:mga00v17_27763_c1	nmdc:mga00v17_27763_c1_94_954	278
99	3300050510	nmdc:mga06r32_15919_c1	nmdc:mga06r32_15919_c1_1830_2669	278
100	iso_pu_bacteria	2643221679	2644447187	278
101	3300005336	Ga0070680_100000189	Ga0070680_10000018933	279
102	3300005336	Ga0070680_100184959	Ga0070680_1001849591	279
103	3300005345	Ga0070692_10113621	Ga0070692_101136212	279
104	3300005366	Ga0070659_100103994	Ga0070659_1001039943	279
105	3300005435	Ga0070714_100058537	Ga0070714_1000585373	279
106	3300005564	Ga0070664_100455541	Ga0070664_1004555412	279
107	3300005937	Ga0081455_10046483	Ga0081455_100464834	279
108	3300005985	Ga0081539_10000182	Ga0081539_1000018211	279
109	3300006051	Ga0075364_10035568	Ga0075364_100355682	279
110	3300009551	Ga0105238_10316429	Ga0105238_103164292	279
111	3300013307	Ga0157372_10669169	Ga0157372_106691692	279
112	3300014326	Ga0157380_10040629	Ga0157380_100406295	279
113	3300020082	Ga0206353_11564438	Ga0206353_115644388	279
114	3300025912	Ga0207707_10006175	Ga0207707_100061759	279
115	3300025912	Ga0207707_10281034	Ga0207707_102810343	279
116	3300025919	Ga0207657_10207594	Ga0207657_102075943	279
117	3300025921	Ga0207652_10057512	Ga0207652_100575124	279
118	3300025929	Ga0207664_10048914	Ga0207664_100489145	279
119	3300025981	Ga0207640_10421345	Ga0207640_104213452	279
120	3300026121	Ga0207683_10664532	Ga0207683_106645321	279
121	3300031665	Ga0316575_10002650	Ga0316575_100026505	279
122	3300031691	Ga0316579_10002868	Ga0316579_100028683	279
123	3300031727	Ga0316576_10008301	Ga0316576_100083015	279
124	3300031727	Ga0316576_10066760	Ga0316576_100667601	279
125	3300031728	Ga0316578_10010573	Ga0316578_100105734	279
126	3300031733	Ga0316577_10041384	Ga0316577_100413842	279
127	3300035398	Ga0316574_0008436	Ga0316574_0008436_1464_2324	279
128	3300036647	Ga0316582_0019313	Ga0316582_0019313_2810_3670	279
129	3300036712	Ga0316584_0028493	Ga0316584_0028493_2642_3502	279
130	3300048907	Ga0496104_0033342	Ga0496104_0033342_2177_3037	279
131	3300048908	Ga0496105_0023498	Ga0496105_0023498_2086_2946	279
132	3300048911	Ga0496108_0049468	Ga0496108_0049468_18_878	279
133	3300048912	Ga0496109_0016340	Ga0496109_0016340_3547_4407	279
134	3300048913	Ga0496110_0032303	Ga0496110_0032303_3385_4245	279
135	3300048914	Ga0496111_0020173	Ga0496111_0020173_1343_2203	279
136	3300048916	Ga0496113_0363790	Ga0496113_0363790_48_908	279
137	3300048917	Ga0496114_0010686	Ga0496114_0010686_5577_6437	279
138	3300048917	Ga0496114_0019218	Ga0496114_0019218_3883_4803	279
139	3300048917	Ga0496114_0087327	Ga0496114_0087327_1591_2451	279
140	iso_pu_bacteria	2585428157	2588106850	279
141	iso_pu_bacteria	2643221542	2643732169	279
142	iso_pu_bacteria	2643221546	2643753153	279
143	iso_pu_bacteria	2643221553	2643785066	279
144	iso_pu_bacteria	2643221630	2644170976	279
145	iso_pu_bacteria	2747842429	2747953764	279
146	iso_pu_bacteria	2773857758	2774378663	279
147	iso_pu_bacteria	2773857759	2774383565	279
148	iso_pu_bacteria	2852646457	2852646647	279
149	iso_pu_bacteria	2852663356	2852664486	279
150	iso_pu_bacteria	2857720070	2857722241	279
151	iso_pu_bacteria	2870628048	2870629615	279
152	iso_pu_bacteria	2904509784	2904510155	279
153	iso_pu_bacteria	2908678064	2908678625	279
154	iso_pu_bacteria	2919069694	2919070976	279
155	iso_pu_bacteria	2928090899	2928091085	279
156	iso_pu_bacteria	2945968032	2945971059	279
157	iso_pu_bacteria	2946041624	2946043407	279
158	iso_pu_bacteria	2946080515	2946081654	279
159	iso_pu_bacteria	2966921586	2966923278	279
160	iso_pu_bacteria	2974294766	2974298168	279
161	iso_pu_bacteria	2974324384	2974325597	279
162	iso_pu_bacteria	2977228692	2977230522	279
163	iso_pu_bacteria	2977236895	2977239323	279
164	iso_pu_bacteria	2977251589	2977251932	279
165	iso_pu_bacteria	2977264416	2977265786	279
166	iso_pu_bacteria	2984542743	2984542892	279
167	iso_pu_bacteria	2984580707	2984582156	279
168	iso_pu_bacteria	8004025490	8004027933	279
169	iso_pu_bacteria	8004182704	8004183749	279
170	iso_pu_bacteria	8046352972	8046353373	279
171	3300002738	JGI25154J39366_1001301	JGI25154J39366_10013014	280
172	3300003578	Ga0006562J51391_1060070	Ga0006562J51391_10600706	280
173	3300003578	Ga0006562J51391_1060071	Ga0006562J51391_10600716	280
174	3300005327	Ga0070658_10262823	Ga0070658_102628232	280
175	3300009036	Ga0105244_10080163	Ga0105244_100801632	280
176	3300009036	Ga0105244_10090200	Ga0105244_100902001	280
177	3300009148	Ga0105243_10063173	Ga0105243_100631734	280
178	3300009545	Ga0105237_10166234	Ga0105237_101662343	280
179	3300013102	Ga0157371_10032657	Ga0157371_100326573	280
180	3300013104	Ga0157370_10247942	Ga0157370_102479423	280
181	3300025246	Ga0209646_1000092	Ga0209646_1000092157	280
182	3300025728	Ga0207655_1001398	Ga0207655_10013981	280
183	3300025728	Ga0207655_1088985	Ga0207655_10889851	280
184	3300025914	Ga0207671_10124203	Ga0207671_101242033	280
185	3300025935	Ga0207709_10017876	Ga0207709_100178762	280
186	3300025935	Ga0207709_10182782	Ga0207709_101827822	280
187	3300026116	Ga0207674_10255165	Ga0207674_102551652	280
188	3300031901	Ga0307406_10000710	Ga0307406_100007103	280
189	3300038443	Ga0395901_0101306	Ga0395901_0101306_557_1420	280
190	3300044683	Ga0466965_0000007	Ga0466965_0000007_2060_2941	280
191	3300044694	Ga0466963_0147314	Ga0466963_0147314_482_1342	280
192	3300044765	Ga0466970_0104158	Ga0466970_0104158_133_996	280
193	3300046453	Ga0495627_000262	Ga0495627_000262_31194_32057	280
194	3300048903	Ga0496100_0031461	Ga0496100_0031461_266_1141	280
195	3300048904	Ga0496101_0035091	Ga0496101_0035091_1904_2779	280
196	3300048905	Ga0496102_0303265	Ga0496102_0303265_404_1279	280
197	3300048906	Ga0496103_0020246	Ga0496103_0020246_1701_2576	280
198	3300048907	Ga0496104_0056977	Ga0496104_0056977_1113_1988	280
199	3300048908	Ga0496105_0045461	Ga0496105_0045461_2712_3575	280
200	3300048908	Ga0496105_0353488	Ga0496105_0353488_57_920	280
201	3300048910	Ga0496107_0011280	Ga0496107_0011280_3225_4100	280
202	3300048911	Ga0496108_0497842	Ga0496108_0497842_107_961	280
203	3300048912	Ga0496109_0059506	Ga0496109_0059506_1078_1953	280
204	3300048914	Ga0496111_0070636	Ga0496111_0070636_68_943	280
205	3300048914	Ga0496111_0110296	Ga0496111_0110296_379_1254	280
206	3300048915	Ga0496112_0077240	Ga0496112_0077240_1453_2328	280
207	3300048916	Ga0496113_0018461	Ga0496113_0018461_1613_2488	280
208	3300048917	Ga0496114_0026047	Ga0496114_0026047_3800_4663	280
209	3300048917	Ga0496114_0042424	Ga0496114_0042424_1656_2531	280
210	3300048917	Ga0496114_0129478	Ga0496114_0129478_784_1647	280
211	3300048918	Ga0496115_0078414	Ga0496115_0078414_1547_2422	280
212	3300048919	Ga0496116_0012555	Ga0496116_0012555_3318_4181	280
213	3300048919	Ga0496116_0161985	Ga0496116_0161985_88_951	280
214	3300048920	Ga0496117_0000028	Ga0496117_0000028_56806_57669	280
215	3300048920	Ga0496117_0001853	Ga0496117_0001853_16664_17527	280
216	3300048920	Ga0496117_0003899	Ga0496117_0003899_14379_15263	280
217	3300048920	Ga0496117_0037269	Ga0496117_0037269_2530_3393	280
218	3300048920	Ga0496117_0052566	Ga0496117_0052566_375_1238	280
219	3300048920	Ga0496117_0060650	Ga0496117_0060650_805_1677	280
220	3300048921	Ga0496118_0008688	Ga0496118_0008688_2348_3211	280
221	3300048921	Ga0496118_0035307	Ga0496118_0035307_1898_2782	280
222	3300048921	Ga0496118_0068041	Ga0496118_0068041_62_925	280
223	3300048922	Ga0496119_0001581	Ga0496119_0001581_18382_19257	280
224	3300048922	Ga0496119_0004797	Ga0496119_0004797_9133_10008	280
225	3300048922	Ga0496119_0009291	Ga0496119_0009291_3347_4210	280
226	3300048922	Ga0496119_0015845	Ga0496119_0015845_2786_3760	280
227	3300048922	Ga0496119_0016789	Ga0496119_0016789_3300_4163	280
228	3300048923	Ga0496120_0000697	Ga0496120_0000697_21658_22533	280
229	3300048923	Ga0496120_0002616	Ga0496120_0002616_16868_17731	280
230	3300048923	Ga0496120_0010600	Ga0496120_0010600_2228_3091	280
231	3300048923	Ga0496120_0015416	Ga0496120_0015416_1470_2345	280
232	3300048923	Ga0496120_0049950	Ga0496120_0049950_245_1120	280
233	3300048923	Ga0496120_0138245	Ga0496120_0138245_288_1148	280
234	3300048924	Ga0496121_0000076	Ga0496121_0000076_238389_239252	280
235	3300048924	Ga0496121_0019918	Ga0496121_0019918_1839_2711	280
236	3300048925	Ga0496122_0000020	Ga0496122_0000020_259894_260757	280
237	3300048925	Ga0496122_0001685	Ga0496122_0001685_5055_5930	280
238	3300048925	Ga0496122_0004690	Ga0496122_0004690_9074_9937	280
239	3300048925	Ga0496122_0019660	Ga0496122_0019660_465_1328	280
240	3300048926	Ga0496123_0000003	Ga0496123_0000003_475018_475881	280
241	3300048926	Ga0496123_0000718	Ga0496123_0000718_12352_13215	280
242	3300048926	Ga0496123_0000802	Ga0496123_0000802_28483_29358	280
243	3300048927	Ga0496124_0042333	Ga0496124_0042333_2685_3548	280
244	3300048927	Ga0496124_0048191	Ga0496124_0048191_2584_3459	280
245	3300048927	Ga0496124_0090111	Ga0496124_0090111_27_890	280
246	3300048928	Ga0496125_0003079	Ga0496125_0003079_5846_6709	280
247	3300048928	Ga0496125_0020369	Ga0496125_0020369_3611_4474	280
248	3300048928	Ga0496125_0138287	Ga0496125_0138287_642_1505	280
249	3300048929	Ga0496126_0006742	Ga0496126_0006742_8082_8945	280
250	3300048929	Ga0496126_0007017	Ga0496126_0007017_5198_6061	280
251	3300048929	Ga0496126_0014147	Ga0496126_0014147_583_1446	280
252	3300048929	Ga0496126_0032117	Ga0496126_0032117_1903_2778	280
253	3300048929	Ga0496126_0182945	Ga0496126_0182945_579_1442	280
254	3300049569	Ga0501032_0008393	Ga0501032_0008393_1468_2334	280
255	3300049569	Ga0501032_0014307	Ga0501032_0014307_2937_3803	280
256	3300049570	Ga0501033_0025451	Ga0501033_0025451_1706_2569	280
257	3300049570	Ga0501033_0056407	Ga0501033_0056407_1838_2704	280
258	3300049571	Ga0501034_0011059	Ga0501034_0011059_2495_3403	280
259	3300049571	Ga0501034_0101111	Ga0501034_0101111_1936_2808	280
260	3300049571	Ga0501034_0119377	Ga0501034_0119377_1699_2565	280
261	3300049571	Ga0501034_0265035	Ga0501034_0265035_345_1208	280
262	3300049571	Ga0501034_0452051	Ga0501034_0452051_135_1001	280
263	3300049571	Ga0501034_0614626	Ga0501034_0614626_24_887	280
264	3300049572	Ga0501036_0061336	Ga0501036_0061336_29_895	280
265	3300049573	Ga0501037_0087095	Ga0501037_0087095_1302_2168	280
266	3300049573	Ga0501037_0211176	Ga0501037_0211176_436_1302	280
267	3300049574	Ga0501038_0013217	Ga0501038_0013217_4036_4899	280
268	3300049574	Ga0501038_0285785	Ga0501038_0285785_219_1085	280
269	3300049581	Ga0501047_0084565	Ga0501047_0084565_1028_1894	280
270	3300049585	Ga0501069_0028628	Ga0501069_0028628_891_1799	280
271	3300049586	Ga0501070_0006689	Ga0501070_0006689_2951_3859	280
272	3300049587	Ga0501071_0001615	Ga0501071_0001615_5890_6798	280
273	3300049589	Ga0501073_0209292	Ga0501073_0209292_416_1324	280
274	3300049822	Ga0501035_0012865	Ga0501035_0012865_615_1487	280
275	3300049823	Ga0501044_0006940	Ga0501044_0006940_5285_6157	280
276	3300049823	Ga0501044_0665643	Ga0501044_0665643_21_884	280
277	3300053139	Ga0500568_0002836	Ga0500568_0002836_4601_5464	280
278	3300053140	Ga0500573_0078661	Ga0500573_0078661_318_1217	280
279	3300053140	Ga0500573_0083242	Ga0500573_0083242_764_1618	280
280	3300060353	Ga0501082_0170237	Ga0501082_0170237_106_1014	280
281	iso_pu_bacteria	2616644814	2616698786	280
282	iso_pu_bacteria	2643221566	2643846453	280
283	iso_pu_bacteria	2643221575	2643888395	280
284	iso_pu_bacteria	2643221597	2643996582	280
285	iso_pu_bacteria	2643221601	2644019798	280
286	iso_pu_bacteria	2643221631	2644180312	280
287	iso_pu_bacteria	2757320536	2758224545	280
288	iso_pu_bacteria	2773857762	2774395279	280
289	iso_pu_bacteria	2784132148	2784592088	280
290	iso_pu_bacteria	2808606368	2808884945	280
291	iso_pu_bacteria	2808606370	2808890724	280
292	iso_pu_bacteria	2808606439	2809193881	280
293	iso_pu_bacteria	2808606447	2809226728	280
294	iso_pu_bacteria	2811994872	2812322328	280
295	iso_pu_bacteria	2811994878	2812348627	280
296	iso_pu_bacteria	2821268502	2821269251	280
297	iso_pu_bacteria	2852632344	2852632945	280
298	iso_pu_bacteria	2862178590	2862179738	280
299	iso_pu_bacteria	2862382967	2862392619	280
300	iso_pu_bacteria	2862705112	2862710707	280
301	iso_pu_bacteria	2863404153	2863410448	280
302	iso_pu_bacteria	2887443736	2887447480	280
303	iso_pu_bacteria	2887478801	2887485557	280
304	iso_pu_bacteria	2891968417	2891973644	280
305	iso_pu_bacteria	2912723979	2912728694	280
306	iso_pu_bacteria	2919391150	2919393385	280
307	iso_pu_bacteria	2919395869	2919396716	280
308	iso_pu_bacteria	2939598168	2939600103	280
309	iso_pu_bacteria	2945956166	2945958120	280
310	iso_pu_bacteria	2990044586	2990048121	280
311	iso_pu_bacteria	2990059506	2990065062	280
312	iso_pu_bacteria	2990088156	2990089105	280
313	iso_pu_bacteria	3006425503	3006426897	280
314	iso_pu_bacteria	8008558824	8008564362	280
315	iso_pu_bacteria	8016254467	8016254819	280
316	iso_pu_bacteria	8056667051	8056668835	280
317	3300005327	Ga0070658_10101253	Ga0070658_101012532	281
318	3300005328	Ga0070676_10048796	Ga0070676_100487962	281
319	3300005329	Ga0070683_100003421	Ga0070683_1000034214	281
320	3300005334	Ga0068869_100002169	Ga0068869_1000021694	281
321	3300005338	Ga0068868_100002444	Ga0068868_1000024443	281
322	3300005339	Ga0070660_100069053	Ga0070660_1000690532	281
323	3300005344	Ga0070661_100029278	Ga0070661_1000292783	281
324	3300005345	Ga0070692_10057061	Ga0070692_100570612	281
325	3300005353	Ga0070669_100261470	Ga0070669_1002614701	281
326	3300005366	Ga0070659_100026879	Ga0070659_1000268793	281
327	3300005457	Ga0070662_100005809	Ga0070662_1000058094	281
328	3300005535	Ga0070684_100034013	Ga0070684_1000340133	281
329	3300005548	Ga0070665_100003571	Ga0070665_10000357115	281
330	3300005564	Ga0070664_100000792	Ga0070664_10000079213	281
331	3300005615	Ga0070702_100007179	Ga0070702_1000071793	281
332	3300005841	Ga0068863_100001588	Ga0068863_10000158817	281
333	3300005842	Ga0068858_100057544	Ga0068858_1000575444	281
334	3300005843	Ga0068860_100000465	Ga0068860_10000046538	281
335	3300006051	Ga0075364_10081209	Ga0075364_100812092	281
336	3300006178	Ga0075367_10072046	Ga0075367_100720462	281
337	3300006844	Ga0075428_100000233	Ga0075428_10000023322	281
338	3300006847	Ga0075431_100010318	Ga0075431_1000103185	281
339	3300006847	Ga0075431_100099371	Ga0075431_1000993713	281
340	3300006880	Ga0075429_100081822	Ga0075429_1000818222	281
341	3300009036	Ga0105244_10025499	Ga0105244_100254997	281
342	3300009098	Ga0105245_10011832	Ga0105245_100118323	281
343	3300009177	Ga0105248_10151398	Ga0105248_101513982	281
344	3300013105	Ga0157369_10113825	Ga0157369_101138255	281
345	3300014326	Ga0157380_10174246	Ga0157380_101742462	281
346	3300014745	Ga0157377_10006983	Ga0157377_100069833	281
347	3300025272	Ga0209455_1002817	Ga0209455_10028174	281
348	3300025297	Ga0209758_1004650	Ga0209758_10046508	281
349	3300025302	Ga0207426_1000824	Ga0207426_10008249	281
350	3300025909	Ga0207705_10093982	Ga0207705_100939823	281
351	3300025920	Ga0207649_10021024	Ga0207649_100210243	281
352	3300025926	Ga0207659_10002744	Ga0207659_100027445	281
353	3300025927	Ga0207687_10022068	Ga0207687_100220683	281
354	3300025932	Ga0207690_10285637	Ga0207690_102856371	281
355	3300025933	Ga0207706_10005411	Ga0207706_100054114	281
356	3300025935	Ga0207709_10144372	Ga0207709_101443722	281
357	3300025938	Ga0207704_10118280	Ga0207704_101182802	281
358	3300025942	Ga0207689_10011495	Ga0207689_100114953	281
359	3300025944	Ga0207661_10010731	Ga0207661_100107316	281
360	3300025945	Ga0207679_10023441	Ga0207679_100234412	281
361	3300026023	Ga0207677_10011957	Ga0207677_100119573	281
362	3300026075	Ga0207708_10043857	Ga0207708_100438572	281
363	3300026088	Ga0207641_10000611	Ga0207641_100006116	281
364	3300026116	Ga0207674_10245336	Ga0207674_102453362	281
365	3300026118	Ga0207675_100009489	Ga0207675_1000094897	281
366	3300027907	Ga0207428_10012041	Ga0207428_100120417	281
367	3300027907	Ga0207428_10056161	Ga0207428_100561612	281
368	3300028379	Ga0268266_10001486	Ga0268266_1000148628	281
369	3300028380	Ga0268265_10023549	Ga0268265_100235492	281
370	3300028381	Ga0268264_10000138	Ga0268264_10000138154	281
371	3300030521	Ga0307511_10038346	Ga0307511_100383464	281
372	3300031616	Ga0307508_10104543	Ga0307508_101045432	281
373	3300031824	Ga0307413_10255211	Ga0307413_102552112	281
374	3300031824	Ga0307413_10292372	Ga0307413_102923721	281
375	3300031852	Ga0307410_10031818	Ga0307410_100318183	281
376	3300031852	Ga0307410_10042483	Ga0307410_100424832	281
377	3300031901	Ga0307406_10000126	Ga0307406_1000012639	281
378	3300031901	Ga0307406_10296134	Ga0307406_102961341	281
379	3300031911	Ga0307412_10043593	Ga0307412_100435932	281
380	3300031995	Ga0307409_100133994	Ga0307409_1001339943	281
381	3300032002	Ga0307416_100277364	Ga0307416_1002773641	281
382	3300032002	Ga0307416_100526510	Ga0307416_1005265101	281
383	3300032005	Ga0307411_10165311	Ga0307411_101653112	281
384	3300032126	Ga0307415_100022047	Ga0307415_1000220473	281
385	3300032126	Ga0307415_100113676	Ga0307415_1001136763	281
386	3300037418	Ga0395900_0015691	Ga0395900_0015691_6200_7072	281
387	3300037418	Ga0395900_0042114	Ga0395900_0042114_3389_4555	281
388	3300037466	Ga0395898_0010055	Ga0395898_0010055_3250_4122	281
389	3300037466	Ga0395898_0124220	Ga0395898_0124220_598_1473	281
390	3300038443	Ga0395901_0058342	Ga0395901_0058342_2698_3570	281
391	3300038443	Ga0395901_0304119	Ga0395901_0304119_423_1589	281
392	3300041404	Ga0439436_0018413	Ga0439436_0018413_286_1155	281
393	3300041512	Ga0451853_2629277	Ga0451853_2629277_3908_4777	281
394	3300041999	Ga0439433_0029419	Ga0439433_0029419_111_980	281
395	3300042002	Ga0439442_000620	Ga0439442_000620_5355_6227	281
396	3300042007	Ga0439449_0000847	Ga0439449_0000847_9654_10526	281
397	3300042007	Ga0439449_0066273	Ga0439449_0066273_142_1011	281
398	3300042015	Ga0439462_0012375	Ga0439462_0012375_980_1849	281
399	3300042122	Ga0450920_001110	Ga0450920_001110_1942_2811	281
400	3300042131	Ga0450894_001242	Ga0450894_001242_115_984	281
401	3300042134	Ga0450898_000509	Ga0450898_000509_90_959	281
402	3300042135	Ga0450899_002829	Ga0450899_002829_847_1716	281
403	3300042146	Ga0450907_000456	Ga0450907_000456_142_1011	281
404	3300042147	Ga0450910_024543	Ga0450910_024543_17_886	281
405	3300042156	Ga0439446_0074382	Ga0439446_0074382_120_989	281
406	3300042435	Ga0439434_0010447	Ga0439434_0010447_1729_2598	281
407	3300044684	Ga0466966_0236709	Ga0466966_0236709_93_953	281
408	3300045836	Ga0466958_0076178	Ga0466958_0076178_469_1338	281
409	3300046452	Ga0495617_041617	Ga0495617_041617_229_1089	281
410	3300046454	Ga0495592_0045918	Ga0495592_0045918_1032_1892	281
411	3300046455	Ga0495603_0109756	Ga0495603_0109756_355_1215	281
412	3300046455	Ga0495603_0196890	Ga0495603_0196890_267_1127	281
413	3300046459	Ga0495629_0048100	Ga0495629_0048100_1786_2646	281
414	3300046460	Ga0495638_0046748	Ga0495638_0046748_1812_2672	281
415	3300046476	Ga0495662_0005005	Ga0495662_0005005_3448_4383	281
416	3300046499	Ga0495594_0013319	Ga0495594_0013319_2959_3819	281
417	3300046507	Ga0495606_0002434	Ga0495606_0002434_9567_10421	281
418	3300046507	Ga0495606_0029651	Ga0495606_0029651_281_1141	281
419	3300046513	Ga0495616_0019472	Ga0495616_0019472_1866_2726	281
420	3300046515	Ga0495620_0002832	Ga0495620_0002832_1835_2695	281
421	3300046522	Ga0495643_0002926	Ga0495643_0002926_5182_6042	281
422	3300046524	Ga0495648_0073097	Ga0495648_0073097_173_1033	281
423	3300046526	Ga0495666_0037075	Ga0495666_0037075_310_1170	281
424	3300046529	Ga0495652_0053565	Ga0495652_0053565_420_1280	281
425	3300046538	Ga0495609_0087041	Ga0495609_0087041_455_1315	281
426	3300046542	Ga0495597_0037118	Ga0495597_0037118_49_909	281
427	3300046557	Ga0495622_0022529	Ga0495622_0022529_388_1248	281
428	3300046558	Ga0495633_0028245	Ga0495633_0028245_844_1704	281
429	3300046616	Ga0495668_0000256	Ga0495668_0000256_17291_18145	281
430	3300046616	Ga0495668_0026125	Ga0495668_0026125_112_972	281
431	3300046648	Ga0495611_0090797	Ga0495611_0090797_524_1384	281
432	3300046660	Ga0495625_0002602	Ga0495625_0002602_1493_2347	281
433	3300046663	Ga0495635_0055714	Ga0495635_0055714_1543_2403	281
434	3300046674	Ga0495588_0018096	Ga0495588_0018096_1046_1915	281
435	3300046689	Ga0495613_0123300	Ga0495613_0123300_357_1217	281
436	3300046689	Ga0495613_0133151	Ga0495613_0133151_563_1423	281
437	3300046689	Ga0495613_0194210	Ga0495613_0194210_223_1083	281
438	3300046690	Ga0495624_0033908	Ga0495624_0033908_246_1106	281
439	3300046694	Ga0495649_0045243	Ga0495649_0045243_1020_1880	281
440	3300046694	Ga0495649_0083488	Ga0495649_0083488_407_1285	281
441	3300046809	Ga0495600_0050824	Ga0495600_0050824_1426_2286	281
442	3300047318	Ga0495636_0006213	Ga0495636_0006213_3475_4335	281
443	3300047318	Ga0495636_0017926	Ga0495636_0017926_967_1827	281
444	3300047320	Ga0495672_0197450	Ga0495672_0197450_89_949	281
445	3300047321	Ga0495676_0010308	Ga0495676_0010308_622_1482	281
446	3300047321	Ga0495676_0114269	Ga0495676_0114269_164_1024	281
447	3300047447	Ga0495685_002612	Ga0495685_002612_2571_3431	281
448	3300047447	Ga0495685_024178	Ga0495685_024178_174_1034	281
449	3300047470	Ga0495681_0054561	Ga0495681_0054561_883_1743	281
450	3300047472	Ga0495686_0091843	Ga0495686_0091843_359_1219	281
451	3300048089	Ga0495614_0104834	Ga0495614_0104834_154_1014	281
452	3300048090	Ga0495615_0020638	Ga0495615_0020638_556_1428	281
453	3300048091	Ga0495626_0000088	Ga0495626_0000088_57547_58401	281
454	3300048905	Ga0496102_0059350	Ga0496102_0059350_82_954	281
455	3300048905	Ga0496102_0248856	Ga0496102_0248856_533_1399	281
456	3300048921	Ga0496118_0003621	Ga0496118_0003621_721_1587	281
457	3300048922	Ga0496119_0216006	Ga0496119_0216006_11_874	281
458	3300048928	Ga0496125_0000242	Ga0496125_0000242_27982_28860	281
459	3300048929	Ga0496126_0000496	Ga0496126_0000496_67834_68739	281
460	3300049568	Ga0501031_0316827	Ga0501031_0316827_124_987	281
461	3300049569	Ga0501032_0011509	Ga0501032_0011509_308_1168	281
462	3300049569	Ga0501032_0218654	Ga0501032_0218654_95_1006	281
463	3300049570	Ga0501033_0027959	Ga0501033_0027959_742_1635	281
464	3300049572	Ga0501036_0035345	Ga0501036_0035345_1937_2830	281
465	3300049573	Ga0501037_0183163	Ga0501037_0183163_150_1043	281
466	3300049579	Ga0501043_0014714	Ga0501043_0014714_5112_6005	281
467	3300049581	Ga0501047_0077776	Ga0501047_0077776_1627_2520	281
468	3300049584	Ga0501068_0325198	Ga0501068_0325198_36_929	281
469	3300049586	Ga0501070_0238443	Ga0501070_0238443_432_1331	281
470	3300049588	Ga0501072_0016192	Ga0501072_0016192_2170_3033	281
471	3300049590	Ga0501074_0132134	Ga0501074_0132134_753_1646	281
472	3300049742	Ga0501080_0016560	Ga0501080_0016560_3012_3905	281
473	3300049822	Ga0501035_0019015	Ga0501035_0019015_3926_4819	281
474	3300049823	Ga0501044_0007902	Ga0501044_0007902_1488_2351	281
475	3300049823	Ga0501044_0046159	Ga0501044_0046159_2470_3363	281
476	3300049824	Ga0501045_0045755	Ga0501045_0045755_445_1308	281
477	3300050491	nmdc:mga00v17_70131_c1	nmdc:mga00v17_70131_c1_814_1692	281
478	3300050492	nmdc:mga0yw44_290215_c1	nmdc:mga0yw44_290215_c1_131_1009	281
479	3300050494	nmdc:mga06z11_6817_c1	nmdc:mga06z11_6817_c1_863_1741	281
480	3300050510	nmdc:mga06r32_89267_c1	nmdc:mga06r32_89267_c1_101_967	281
481	3300050511	nmdc:mga08y16_28492_c1	nmdc:mga08y16_28492_c1_1839_2696	281
482	3300053080	Ga0500635_0000066	Ga0500635_0000066_28250_29113	281
483	3300053104	Ga0500556_0096567	Ga0500556_0096567_70_930	281
484	3300053146	Ga0500588_0015599	Ga0500588_0015599_635_1495	281
485	3300053153	Ga0500616_0000302	Ga0500616_0000302_35821_36702	281
486	3300054114	Ga0501084_0361821	Ga0501084_0361821_55_918	281
487	iso_pu_bacteria	2508501039	2508671650	281
488	iso_pu_bacteria	2626541554	2626637432	281
489	iso_pu_bacteria	2643221604	2644032659	281
490	iso_pu_bacteria	2675902999	2676200679	281
491	iso_pu_bacteria	2687453737	2689963174	281
492	iso_pu_bacteria	2731639228	2731906241	281
493	iso_pu_bacteria	2773857921	2774845257	281
494	iso_pu_bacteria	2799112218	2799183318	281
495	iso_pu_bacteria	2837268691	2837272056	281
496	iso_pu_bacteria	2868088558	2868095213	281
497	iso_pu_bacteria	8002775197	8002779544	281
498	iso_pu_bacteria	8008485437	8008489297	281
499	iso_pu_bacteria	8025524527	8025527351	281
500	3300001990	JGI24737J22298_10004010	JGI24737J22298_100040107	282
501	3300005577	Ga0068857_100030124	Ga0068857_1000301243	282
502	3300005617	Ga0068859_100001317	Ga0068859_10000131720	282
503	3300005617	Ga0068859_100018393	Ga0068859_1000183939	282
504	3300005844	Ga0068862_100000252	Ga0068862_10000025241	282
505	3300006844	Ga0075428_100022635	Ga0075428_10002263510	282
506	3300006844	Ga0075428_100033288	Ga0075428_1000332887	282
507	3300006847	Ga0075431_100000146	Ga0075431_10000014638	282
508	3300006847	Ga0075431_100054635	Ga0075431_1000546355	282
509	3300006931	Ga0097620_100001317	Ga0097620_10000131720	282
510	3300006931	Ga0097620_100018394	Ga0097620_1000183949	282
511	3300009094	Ga0111539_10936212	Ga0111539_109362121	282
512	3300009147	Ga0114129_10007962	Ga0114129_100079629	282
513	3300009147	Ga0114129_10087134	Ga0114129_100871345	282
514	3300009177	Ga0105248_10000475	Ga0105248_100004759	282
515	3300009553	Ga0105249_10019654	Ga0105249_100196544	282
516	3300013307	Ga0157372_10085202	Ga0157372_100852023	282
517	3300013307	Ga0157372_10162153	Ga0157372_101621533	282
518	3300013307	Ga0157372_10637407	Ga0157372_106374072	282
519	3300014325	Ga0163163_10041475	Ga0163163_100414754	282
520	3300014325	Ga0163163_10379904	Ga0163163_103799042	282
521	3300025904	Ga0207647_10014184	Ga0207647_100141843	282
522	3300025941	Ga0207711_10000403	Ga0207711_1000040310	282
523	3300025961	Ga0207712_10016812	Ga0207712_100168124	282
524	3300026078	Ga0207702_10242922	Ga0207702_102429222	282
525	3300026088	Ga0207641_10002900	Ga0207641_100029008	282
526	3300026116	Ga0207674_10040935	Ga0207674_100409356	282
527	3300028379	Ga0268266_10669242	Ga0268266_106692421	282
528	3300028380	Ga0268265_10000244	Ga0268265_1000024439	282
529	3300031548	Ga0307408_100458899	Ga0307408_1004588992	282
530	3300031728	Ga0316578_10079215	Ga0316578_100792152	282
531	3300031728	Ga0316578_10104232	Ga0316578_101042322	282
532	3300035398	Ga0316574_0008894	Ga0316574_0008894_2485_3366	282
533	3300037418	Ga0395900_0031379	Ga0395900_0031379_723_1586	282
534	3300037466	Ga0395898_0059923	Ga0395898_0059923_304_1167	282
535	3300037471	Ga0395905_0072591	Ga0395905_0072591_1954_2817	282
536	3300038443	Ga0395901_0005579	Ga0395901_0005579_9127_9990	282
537	3300038443	Ga0395901_0385999	Ga0395901_0385999_348_1268	282
538	3300044658	Ga0466972_0075290	Ga0466972_0075290_398_1273	282
539	3300044694	Ga0466963_0016752	Ga0466963_0016752_372_1280	282
540	3300044735	Ga0466968_0026868	Ga0466968_0026868_759_1625	282
541	3300044735	Ga0466968_0101816	Ga0466968_0101816_327_1193	282
542	3300044765	Ga0466970_0047994	Ga0466970_0047994_1215_2090	282
543	3300044901	Ga0466960_0196152	Ga0466960_0196152_161_1069	282
544	3300045976	Ga0466967_0193409	Ga0466967_0193409_19_927	282
545	3300046461	Ga0495641_0047649	Ga0495641_0047649_1003_1866	282
546	3300046559	Ga0495667_0066766	Ga0495667_0066766_1421_2287	282
547	3300046675	Ga0495657_0212125	Ga0495657_0212125_125_991	282
548	3300047321	Ga0495676_0348648	Ga0495676_0348648_70_936	282
549	3300048905	Ga0496102_0323540	Ga0496102_0323540_148_1014	282
550	3300048907	Ga0496104_0012418	Ga0496104_0012418_3998_4861	282
551	3300048911	Ga0496108_0059433	Ga0496108_0059433_154_1017	282
552	3300048912	Ga0496109_0071766	Ga0496109_0071766_1345_2208	282
553	3300048913	Ga0496110_0005324	Ga0496110_0005324_4511_5374	282
554	3300048913	Ga0496110_0197758	Ga0496110_0197758_14_877	282
555	3300048914	Ga0496111_0480362	Ga0496111_0480362_35_901	282
556	3300048916	Ga0496113_0117225	Ga0496113_0117225_422_1279	282
557	3300048917	Ga0496114_0229703	Ga0496114_0229703_740_1603	282
558	3300048917	Ga0496114_0276078	Ga0496114_0276078_517_1380	282
559	3300048917	Ga0496114_0520390	Ga0496114_0520390_22_888	282
560	3300049573	Ga0501037_0223019	Ga0501037_0223019_399_1265	282
561	3300049576	Ga0501040_0023542	Ga0501040_0023542_2924_3913	282
562	3300049576	Ga0501040_0106833	Ga0501040_0106833_809_1675	282
563	3300049577	Ga0501041_0264490	Ga0501041_0264490_22_894	282
564	3300049578	Ga0501042_0268859	Ga0501042_0268859_326_1192	282
565	3300049578	Ga0501042_0484564	Ga0501042_0484564_12_878	282
566	3300049581	Ga0501047_0000016	Ga0501047_0000016_30440_31348	282
567	3300049583	Ga0501067_0082762	Ga0501067_0082762_339_1205	282
568	3300049584	Ga0501068_0011087	Ga0501068_0011087_2406_3272	282
569	3300049588	Ga0501072_0022834	Ga0501072_0022834_3735_4601	282
570	3300049590	Ga0501074_0003698	Ga0501074_0003698_5384_6250	282
571	3300049593	Ga0501077_0012606	Ga0501077_0012606_2097_2963	282
572	3300049593	Ga0501077_0301191	Ga0501077_0301191_42_908	282
573	3300049741	Ga0501079_0007138	Ga0501079_0007138_4433_5299	282
574	3300049742	Ga0501080_0025913	Ga0501080_0025913_2595_3461	282
575	3300049744	Ga0501083_0014915	Ga0501083_0014915_2225_3091	282
576	3300049823	Ga0501044_0041114	Ga0501044_0041114_3920_4777	282
577	3300049823	Ga0501044_0283969	Ga0501044_0283969_379_1245	282
578	3300050507	nmdc:mga05p37_301660_c1	nmdc:mga05p37_301660_c1_302_1159	282
579	3300050507	nmdc:mga05p37_512_c1	nmdc:mga05p37_512_c1_29131_29997	282
580	3300050507	nmdc:mga05p37_81293_c1	nmdc:mga05p37_81293_c1_1745_2608	282
581	3300050508	nmdc:mga09592_225_c1	nmdc:mga09592_225_c1_18571_19437	282
582	3300050508	nmdc:mga09592_47276_c1	nmdc:mga09592_47276_c1_1836_2693	282
583	3300050509	nmdc:mga0qj67_20502_c1	nmdc:mga0qj67_20502_c1_1390_2256	282
584	3300050510	nmdc:mga06r32_25182_c1	nmdc:mga06r32_25182_c1_1780_2646	282
585	3300050510	nmdc:mga06r32_27569_c1	nmdc:mga06r32_27569_c1_3559_4416	282
586	3300050510	nmdc:mga06r32_439_c1	nmdc:mga06r32_439_c1_18938_19804	282
587	3300050511	nmdc:mga08y16_504643_c1	nmdc:mga08y16_504643_c1_157_1023	282
588	3300054114	Ga0501084_0009890	Ga0501084_0009890_1910_2776	282
589	3300060353	Ga0501082_0014619	Ga0501082_0014619_1727_2593	282
590	iso_pu_bacteria	2517572101	2517761549	282
591	iso_pu_bacteria	2739367898	2740168778	282
592	iso_pu_bacteria	2816332119	2816422434	282
593	iso_pu_bacteria	8002784119	8002789504	282
594	iso_pu_bacteria	8054609563	8054611685	282

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

286

315

0.97 PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

178

269

0.95 PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

42

161

0.8 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3sat-assembly1.cif.gz_A	mutm slanted complex 6 with r112a mutation	0.8646	1	266
1k82-assembly4.cif.gz_D	crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna	0.8599	1	267
1kfv-assembly2.cif.gz_B	crystal structure of lactococcus lactis formamido-pyrimidine dna glycosylase (alias fpg or mutm) non covalently bound to an ap site containing dna.	0.8522	1	267
3sat-assembly1.cif.gz_A	mutm slanted complex 6 with r112a mutation	0.8519	1	266
1k82-assembly4.cif.gz_D	crystal structure of e.coli formamidopyrimidine-dna glycosylase (fpg) covalently trapped with dna	0.8506	1	267

ID	Description	Score	Start	End	Superfamily
af_L0T864_10_149_1.10.8.50	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.97	133	273	1.10.8.50
af_L0T864_10_149_1.10.8.50	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9633	133	273	1.10.8.50
3sarA02	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.9047	133	266	1.10.8.50
2y10M01	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.8973	152	203	1.10.8.50
3sarA02	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;	0.8907	133	266	1.10.8.50

ID	Description	Score	Start	End	GO Terms
AF-A0A2S8MER6-F1-model_v4	deleted	0.9828	1	106
AF-A0A0K2R0T4-F1-model_v4	deleted	0.9708	1	131
AF-A0A850CJ66-F1-model_v4	Fpg/Nei family DNA glycosylase	0.9659	1	221	GO:0003684 GO:0003906 GO:0006284 GO:0008270 GO:0016829 GO:0034039
AF-A0A0F4IEG8-F1-model_v4	DNA lyase	0.9635	9	148	GO:0003906 GO:0006284 GO:0008270 GO:0016829 GO:0019104
AF-A0A7X7NJS0-F1-model_v4	Fpg/Nei family DNA glycosylase	0.9628	1	249	GO:0003684 GO:0003906 GO:0006284 GO:0008270 GO:0016829 GO:0034039

Feature Viewer

pLDDT	pTM	Quality
92.49	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F467394

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF06827

zf-FPG_IleRS

Zinc finger found in FPG and IleRS

286

315

0.97

PF06831

H2TH

Formamidopyrimidine-DNA glycosylase H2TH domain

178

269

0.95

PF01149

Fapy_DNA_glyco

Formamidopyrimidine-DNA glycosylase N-terminal domain

42

161

0.8

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map