F467376
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 594 | 278 | 1188 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300047320|Ga0495672_0221807|Ga0495672_0221807_37_888 |
| Length | 283 |
| Sequence | LPANKLLFLGSSSDFHSASSSPGGEADVYPNQLQHDREGGSAMKMIRYVRGIAASVLGFTSLVLPVAAEQPTKIDFSNETVGAEPKAIVPVVGIWRIESEGGKNVLAVDGRQWKEGQSSAGVADKARALYGERYAEFLDRVQAYAYYPYAVTKEVEDFRGGEITVRFEGLSGRIDQGAGILFNLKPNGDYLTLRANCLENNLVLWKFEKGRRSSVSWVRNAPAGTKQWHDLKVRVAGAKVEGYLDGKLYLQYTLPASVSGRIGLWSKADSYMHFSDYTVTSAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 38 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 45 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 46 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 50 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 60 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 61 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 62 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 63 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 127 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 128 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 129 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 130 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 139 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 140 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 143 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 145 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 147 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 152 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 153 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 154 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 157 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 158 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 159 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 160 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 161 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 162 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 163 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 164 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 165 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 224 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 225 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 226 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 227 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 228 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 229 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 232 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 233 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 234 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 235 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 236 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 237 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 241 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 256 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 257 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 258 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 259 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 260 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 261 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 262 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 263 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 264 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 265 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 266 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 267 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 268 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 269 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 270 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 271 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 272 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 273 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 274 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 275 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 276 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 277 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 278 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.8 |
| Metatranscriptomes | 0 |
| Isolates | 3.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.85 |
| Nodule | 3.2 |
| Rhizoplane | 12.12 |
| Rhizosphere | 79.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495672_0221807 | 3300047320 | Bacteria | 933 |
| 2 | JGI25406J46586_10043718 | 3300003203 | Bacteria | 1557 |
| 3 | JGI25406J46586_10062071 | 3300003203 | Bacteria | 1202 |
| 4 | JGI25406J46586_10087195 | 3300003203 | Bacteria | 947 |
| 5 | JGI25404J52841_10013128 | 3300003659 | Bacteria | 1797 |
| 6 | JGI25404J52841_10023204 | 3300003659 | Bacteria | 1339 |
| 7 | JGI25405J52794_10003598 | 3300003911 | Plasmid | 2728 |
| 8 | Ga0070683_100075135 | 3300005329 | Bacteria | 3157 |
| 9 | Ga0070682_100467668 | 3300005337 | Bacteria | 970 |
| 10 | Ga0070689_100212929 | 3300005340 | Bacteria | 1582 |
| 11 | Ga0070661_100284738 | 3300005344 | Bacteria | 1283 |
| 12 | Ga0070692_10188531 | 3300005345 | Bacteria | 1200 |
| 13 | Ga0070668_100012647 | 3300005347 | Bacteria | 6282 |
| 14 | Ga0070668_100039864 | 3300005347 | Bacteria | 3592 |
| 15 | Ga0070671_100037745 | 3300005355 | Bacteria | 4007 |
| 16 | Ga0070673_100070693 | 3300005364 | Bacteria | 2802 |
| 17 | Ga0070667_100099333 | 3300005367 | Bacteria | 2512 |
| 18 | Ga0070709_10082782 | 3300005434 | Bacteria | 2098 |
| 19 | Ga0070709_10087689 | 3300005434 | Unclassified | 2045 |
| 20 | Ga0070714_100101999 | 3300005435 | Bacteria | 2529 |
| 21 | Ga0070714_100177339 | 3300005435 | Bacteria | 1937 |
| 22 | Ga0070714_100303107 | 3300005435 | Bacteria | 1490 |
| 23 | Ga0070713_100134991 | 3300005436 | Bacteria | 2180 |
| 24 | Ga0070713_100566434 | 3300005436 | Bacteria | 1077 |
| 25 | Ga0070710_10044260 | 3300005437 | Unclassified | 2469 |
| 26 | Ga0070710_10070692 | 3300005437 | Bacteria | 2011 |
| 27 | Ga0070710_10150112 | 3300005437 | Bacteria | 1437 |
| 28 | Ga0070710_10255691 | 3300005437 | Bacteria | 1128 |
| 29 | Ga0070710_10287067 | 3300005437 | Bacteria | 1070 |
| 30 | Ga0070711_100062040 | 3300005439 | Bacteria | 2604 |
| 31 | Ga0070711_100072248 | 3300005439 | Bacteria | 2433 |
| 32 | Ga0070711_100117103 | 3300005439 | Bacteria | 1964 |
| 33 | Ga0070711_100117545 | 3300005439 | Bacteria | 1961 |
| 34 | Ga0070711_100162059 | 3300005439 | Unclassified | 1696 |
| 35 | Ga0070711_100169912 | 3300005439 | Bacteria | 1661 |
| 36 | Ga0070711_100382288 | 3300005439 | Unclassified | 1139 |
| 37 | Ga0070711_100566887 | 3300005439 | Bacteria | 944 |
| 38 | Ga0070700_100255513 | 3300005441 | Unclassified | 1259 |
| 39 | Ga0070708_100210768 | 3300005445 | Bacteria | 1820 |
| 40 | Ga0070708_100585485 | 3300005445 | Bacteria | 1052 |
| 41 | Ga0070663_100311296 | 3300005455 | Unclassified | 1263 |
| 42 | Ga0070662_100186129 | 3300005457 | Bacteria | 1639 |
| 43 | Ga0070681_10277343 | 3300005458 | Bacteria | 1587 |
| 44 | Ga0070706_100028406 | 3300005467 | Bacteria | 5149 |
| 45 | Ga0070706_100264550 | 3300005467 | Bacteria | 1605 |
| 46 | Ga0070707_100086724 | 3300005468 | Bacteria | 3027 |
| 47 | Ga0070698_100069744 | 3300005471 | Bacteria | 3528 |
| 48 | Ga0070698_100121168 | 3300005471 | Bacteria | 2576 |
| 49 | Ga0070699_100008545 | 3300005518 | Bacteria | 8873 |
| 50 | Ga0070684_100011674 | 3300005535 | Bacteria | 7005 |
| 51 | Ga0070697_100096214 | 3300005536 | Bacteria | 2456 |
| 52 | Ga0070696_100139020 | 3300005546 | Bacteria | 1773 |
| 53 | Ga0070665_100007736 | 3300005548 | Bacteria | 10909 |
| 54 | Ga0070665_100271470 | 3300005548 | Unclassified | 1698 |
| 55 | Ga0070704_100350076 | 3300005549 | Unclassified | 1247 |
| 56 | Ga0068857_100071786 | 3300005577 | Bacteria | 3085 |
| 57 | Ga0068856_100196750 | 3300005614 | Bacteria | 2030 |
| 58 | Ga0070702_100214746 | 3300005615 | Bacteria | 1283 |
| 59 | Ga0068864_100279546 | 3300005618 | Unclassified | 1558 |
| 60 | Ga0068864_100359492 | 3300005618 | Bacteria | 1376 |
| 61 | Ga0068866_10186946 | 3300005718 | Bacteria | 1228 |
| 62 | Ga0068861_100011838 | 3300005719 | Bacteria | 6072 |
| 63 | Ga0068863_100086690 | 3300005841 | Bacteria | 2967 |
| 64 | Ga0068863_100431455 | 3300005841 | Bacteria | 1292 |
| 65 | Ga0081455_10001307 | 3300005937 | Bacteria | 30905 |
| 66 | Ga0081455_10002863 | 3300005937 | Bacteria | 20325 |
| 67 | Ga0081455_10036867 | 3300005937 | Bacteria | 4348 |
| 68 | Ga0081455_10362453 | 3300005937 | Bacteria | 1019 |
| 69 | Ga0081540_1000397 | 3300005983 | Bacteria | 43084 |
| 70 | Ga0081540_1006400 | 3300005983 | Bacteria | 8583 |
| 71 | Ga0081540_1006853 | 3300005983 | Bacteria | 8224 |
| 72 | Ga0081540_1010207 | 3300005983 | Bacteria | 6379 |
| 73 | Ga0081540_1013288 | 3300005983 | Bacteria | 5360 |
| 74 | Ga0081540_1023998 | 3300005983 | Bacteria | 3549 |
| 75 | Ga0081540_1024451 | 3300005983 | Bacteria | 3505 |
| 76 | Ga0081540_1028018 | 3300005983 | Bacteria | 3175 |
| 77 | Ga0081540_1028641 | 3300005983 | Bacteria | 3122 |
| 78 | Ga0081540_1038197 | 3300005983 | Bacteria | 2534 |
| 79 | Ga0081540_1041477 | 3300005983 | Bacteria | 2385 |
| 80 | Ga0081540_1043446 | 3300005983 | Bacteria | 2305 |
| 81 | Ga0081540_1047944 | 3300005983 | Bacteria | 2144 |
| 82 | Ga0081540_1050292 | 3300005983 | Bacteria | 2071 |
| 83 | Ga0081540_1069369 | 3300005983 | Bacteria | 1639 |
| 84 | Ga0081540_1095627 | 3300005983 | Bacteria | 1294 |
| 85 | Ga0081539_10002257 | 3300005985 | Bacteria | 28023 |
| 86 | Ga0081539_10032436 | 3300005985 | Bacteria | 3199 |
| 87 | Ga0081539_10036033 | 3300005985 | Bacteria | 2966 |
| 88 | Ga0081539_10045099 | 3300005985 | Unclassified | 2539 |
| 89 | Ga0081539_10164450 | 3300005985 | Bacteria | 1055 |
| 90 | Ga0070717_10029588 | 3300006028 | Bacteria | 4394 |
| 91 | Ga0070717_10113751 | 3300006028 | Bacteria | 2311 |
| 92 | Ga0070717_10135207 | 3300006028 | Bacteria | 2123 |
| 93 | Ga0070717_10197856 | 3300006028 | Unclassified | 1759 |
| 94 | Ga0070717_10418143 | 3300006028 | Bacteria | 1206 |
| 95 | Ga0075365_10019536 | 3300006038 | Bacteria | 4184 |
| 96 | Ga0075365_10026743 | 3300006038 | Bacteria | 3666 |
| 97 | Ga0075365_10316217 | 3300006038 | Bacteria | 1099 |
| 98 | Ga0075432_10009289 | 3300006058 | Bacteria | 3348 |
| 99 | Ga0075432_10044809 | 3300006058 | Bacteria | 1551 |
| 100 | Ga0070715_10016056 | 3300006163 | Bacteria | 2805 |
| 101 | Ga0070715_10066791 | 3300006163 | Unclassified | 1595 |
| 102 | Ga0070715_10076823 | 3300006163 | Bacteria | 1506 |
| 103 | Ga0070715_10120034 | 3300006163 | Bacteria | 1252 |
| 104 | Ga0070716_100089878 | 3300006173 | Bacteria | 1856 |
| 105 | Ga0070716_100155600 | 3300006173 | Unclassified | 1475 |
| 106 | Ga0070716_100176282 | 3300006173 | Bacteria | 1399 |
| 107 | Ga0070712_100016436 | 3300006175 | Bacteria | 4780 |
| 108 | Ga0070712_100033575 | 3300006175 | Bacteria | 3473 |
| 109 | Ga0070712_100045144 | 3300006175 | Bacteria | 3041 |
| 110 | Ga0070712_100130540 | 3300006175 | Bacteria | 1903 |
| 111 | Ga0070712_100132592 | 3300006175 | Bacteria | 1890 |
| 112 | Ga0070712_100174531 | 3300006175 | Unclassified | 1670 |
| 113 | Ga0070712_100657551 | 3300006175 | Bacteria | 891 |
| 114 | Ga0075427_10000548 | 3300006194 | Unclassified | 4345 |
| 115 | Ga0097621_100475075 | 3300006237 | Bacteria | 1129 |
| 116 | Ga0068871_100057418 | 3300006358 | Bacteria | 3166 |
| 117 | Ga0075428_100012679 | 3300006844 | Bacteria | 9373 |
| 118 | Ga0075428_100043882 | 3300006844 | Bacteria | 4915 |
| 119 | Ga0075428_100418145 | 3300006844 | Unclassified | 1436 |
| 120 | Ga0075428_100692482 | 3300006844 | Unclassified | 1086 |
| 121 | Ga0075428_100889565 | 3300006844 | Bacteria | 945 |
| 122 | Ga0075430_100007070 | 3300006846 | Bacteria | 9463 |
| 123 | Ga0075430_100115462 | 3300006846 | Bacteria | 2237 |
| 124 | Ga0075430_100119086 | 3300006846 | Bacteria | 2201 |
| 125 | Ga0075431_100005987 | 3300006847 | Bacteria | 12049 |
| 126 | Ga0075431_100021184 | 3300006847 | Bacteria | 6643 |
| 127 | Ga0075431_100165683 | 3300006847 | Unclassified | 2272 |
| 128 | Ga0075433_10066918 | 3300006852 | Bacteria | 3153 |
| 129 | Ga0075433_10069679 | 3300006852 | Unclassified | 3089 |
| 130 | Ga0075434_100133923 | 3300006871 | Bacteria | 2498 |
| 131 | Ga0075434_100169864 | 3300006871 | Bacteria | 2201 |
| 132 | Ga0075434_100182617 | 3300006871 | Unclassified | 2118 |
| 133 | Ga0075434_100237193 | 3300006871 | Bacteria | 1844 |
| 134 | Ga0075434_100632247 | 3300006871 | Unclassified | 1089 |
| 135 | Ga0075429_100009244 | 3300006880 | Bacteria | 8555 |
| 136 | Ga0075429_100031987 | 3300006880 | Bacteria | 4574 |
| 137 | Ga0075436_100465316 | 3300006914 | Unclassified | 922 |
| 138 | Ga0099825_1029095 | 3300006941 | Bacteria | 2607 |
| 139 | Ga0099824_1016795 | 3300006942 | Bacteria | 6537 |
| 140 | Ga0075435_100154253 | 3300007076 | Bacteria | 1932 |
| 141 | Ga0075435_100214384 | 3300007076 | Unclassified | 1634 |
| 142 | Ga0075435_100227149 | 3300007076 | Bacteria | 1586 |
| 143 | Ga0099794_10002357 | 3300007265 | Bacteria | 6954 |
| 144 | Ga0099794_10012914 | 3300007265 | Bacteria | 3622 |
| 145 | Ga0099794_10032758 | 3300007265 | Bacteria | 2441 |
| 146 | Ga0099794_10261864 | 3300007265 | Bacteria | 893 |
| 147 | Ga0099795_10004704 | 3300007788 | Bacteria | 3553 |
| 148 | Ga0099795_10006018 | 3300007788 | Bacteria | 3276 |
| 149 | Ga0099795_10015015 | 3300007788 | Bacteria | 2415 |
| 150 | Ga0099795_10022067 | 3300007788 | Bacteria | 2097 |
| 151 | Ga0099795_10037347 | 3300007788 | Bacteria | 1709 |
| 152 | Ga0105240_10482882 | 3300009093 | Bacteria | 1381 |
| 153 | Ga0111539_10074870 | 3300009094 | Bacteria | 3989 |
| 154 | Ga0111539_10184047 | 3300009094 | Bacteria | 2440 |
| 155 | Ga0111539_10263631 | 3300009094 | Bacteria | 2006 |
| 156 | Ga0111539_10529744 | 3300009094 | Bacteria | 1372 |
| 157 | Ga0111539_11345053 | 3300009094 | Unclassified | 829 |
| 158 | Ga0105245_10366144 | 3300009098 | Bacteria | 1432 |
| 159 | Ga0105247_10358366 | 3300009101 | Unclassified | 1028 |
| 160 | Ga0114129_10007454 | 3300009147 | Bacteria | 15584 |
| 161 | Ga0114129_10015432 | 3300009147 | Bacteria | 10866 |
| 162 | Ga0114129_10019770 | 3300009147 | Bacteria | 9586 |
| 163 | Ga0114129_10107515 | 3300009147 | Bacteria | 3852 |
| 164 | Ga0114129_10213700 | 3300009147 | Bacteria | 2606 |
| 165 | Ga0114129_10234919 | 3300009147 | Bacteria | 2467 |
| 166 | Ga0114129_11607431 | 3300009147 | Bacteria | 796 |
| 167 | Ga0105243_10082322 | 3300009148 | Bacteria | 2630 |
| 168 | Ga0105243_10362303 | 3300009148 | Unclassified | 1335 |
| 169 | Ga0105243_10806963 | 3300009148 | Bacteria | 925 |
| 170 | Ga0105242_10291943 | 3300009176 | Bacteria | 1485 |
| 171 | Ga0105248_10230454 | 3300009177 | Bacteria | 2085 |
| 172 | Ga0105237_10068117 | 3300009545 | Bacteria | 3553 |
| 173 | Ga0105237_10280558 | 3300009545 | Bacteria | 1668 |
| 174 | Ga0105238_10037471 | 3300009551 | Bacteria | 4930 |
| 175 | Ga0105249_10067728 | 3300009553 | Bacteria | 3290 |
| 176 | Ga0105249_10228639 | 3300009553 | Bacteria | 1834 |
| 177 | Ga0105249_10578114 | 3300009553 | Bacteria | 1176 |
| 178 | Ga0099796_10009373 | 3300010159 | Bacteria | 2648 |
| 179 | Ga0099796_10012632 | 3300010159 | Unclassified | 2390 |
| 180 | Ga0099796_10020962 | 3300010159 | Bacteria | 2005 |
| 181 | Ga0099796_10053212 | 3300010159 | Bacteria | 1412 |
| 182 | Ga0105239_10233345 | 3300010375 | Bacteria | 2065 |
| 183 | Ga0105239_10283517 | 3300010375 | Bacteria | 1865 |
| 184 | Ga0105239_10589793 | 3300010375 | Bacteria | 1267 |
| 185 | Ga0105246_10216999 | 3300011119 | Bacteria | 1497 |
| 186 | Ga0157374_10278766 | 3300013296 | Bacteria | 1650 |
| 187 | Ga0163162_10693185 | 3300013306 | Bacteria | 1140 |
| 188 | Ga0157375_10344811 | 3300013308 | Bacteria | 1655 |
| 189 | Ga0163163_10155611 | 3300014325 | Bacteria | 2330 |
| 190 | Ga0163163_10194488 | 3300014325 | Bacteria | 2076 |
| 191 | Ga0163163_10466465 | 3300014325 | Bacteria | 1323 |
| 192 | Ga0157377_10068556 | 3300014745 | Bacteria | 2044 |
| 193 | Ga0157379_10017434 | 3300014968 | Bacteria | 6323 |
| 194 | Ga0157379_10096442 | 3300014968 | Bacteria | 2654 |
| 195 | Ga0157376_10034227 | 3300014969 | Bacteria | 4101 |
| 196 | Ga0157376_10105812 | 3300014969 | Bacteria | 2467 |
| 197 | Ga0157376_10361955 | 3300014969 | Bacteria | 1391 |
| 198 | Ga0207692_10010085 | 3300025898 | Bacteria | 3968 |
| 199 | Ga0207692_10033350 | 3300025898 | Bacteria | 2483 |
| 200 | Ga0207692_10079209 | 3300025898 | Bacteria | 1752 |
| 201 | Ga0207692_10080124 | 3300025898 | Bacteria | 1744 |
| 202 | Ga0207692_10165677 | 3300025898 | Bacteria | 1277 |
| 203 | Ga0207710_10004063 | 3300025900 | Bacteria | 6435 |
| 204 | Ga0207688_10001335 | 3300025901 | Bacteria | 12832 |
| 205 | Ga0207680_10356080 | 3300025903 | Bacteria | 1029 |
| 206 | Ga0207647_10056681 | 3300025904 | Bacteria | 2404 |
| 207 | Ga0207685_10029722 | 3300025905 | Bacteria | 1938 |
| 208 | Ga0207685_10032653 | 3300025905 | Bacteria | 1874 |
| 209 | Ga0207685_10158972 | 3300025905 | Unclassified | 1030 |
| 210 | Ga0207699_10046846 | 3300025906 | Plasmid | 2532 |
| 211 | Ga0207699_10065616 | 3300025906 | Bacteria | 2201 |
| 212 | Ga0207699_10203222 | 3300025906 | Bacteria | 1344 |
| 213 | Ga0207645_10025861 | 3300025907 | Bacteria | 3796 |
| 214 | Ga0207643_10008495 | 3300025908 | Bacteria | 5507 |
| 215 | Ga0207684_10061745 | 3300025910 | Bacteria | 3182 |
| 216 | Ga0207684_10087454 | 3300025910 | Bacteria | 2655 |
| 217 | Ga0207684_10100159 | 3300025910 | Bacteria | 2476 |
| 218 | Ga0207684_10399092 | 3300025910 | Bacteria | 1182 |
| 219 | Ga0207707_10235244 | 3300025912 | Bacteria | 1594 |
| 220 | Ga0207671_10172543 | 3300025914 | Bacteria | 1680 |
| 221 | Ga0207693_10014179 | 3300025915 | Bacteria | 6416 |
| 222 | Ga0207693_10034737 | 3300025915 | Bacteria | 3977 |
| 223 | Ga0207693_10058686 | 3300025915 | Bacteria | 3015 |
| 224 | Ga0207693_10156901 | 3300025915 | Bacteria | 1790 |
| 225 | Ga0207693_10220648 | 3300025915 | Bacteria | 1490 |
| 226 | Ga0207693_10226407 | 3300025915 | Unclassified | 1469 |
| 227 | Ga0207663_10032179 | 3300025916 | Bacteria | 3111 |
| 228 | Ga0207663_10035946 | 3300025916 | Bacteria | 2976 |
| 229 | Ga0207663_10288326 | 3300025916 | Bacteria | 1222 |
| 230 | Ga0207660_10700202 | 3300025917 | Bacteria | 826 |
| 231 | Ga0207662_10009040 | 3300025918 | Bacteria | 5473 |
| 232 | Ga0207649_10183385 | 3300025920 | Bacteria | 1466 |
| 233 | Ga0207646_10336136 | 3300025922 | Unclassified | 1364 |
| 234 | Ga0207694_10054764 | 3300025924 | Bacteria | 3095 |
| 235 | Ga0207650_10007900 | 3300025925 | Bacteria | 7249 |
| 236 | Ga0207687_10247930 | 3300025927 | Bacteria | 1414 |
| 237 | Ga0207700_10024183 | 3300025928 | Bacteria | 4200 |
| 238 | Ga0207700_10067633 | 3300025928 | Bacteria | 2736 |
| 239 | Ga0207700_10209611 | 3300025928 | Bacteria | 1647 |
| 240 | Ga0207664_10151238 | 3300025929 | Bacteria | 1972 |
| 241 | Ga0207664_10225996 | 3300025929 | Bacteria | 1625 |
| 242 | Ga0207664_10344084 | 3300025929 | Bacteria | 1319 |
| 243 | Ga0207706_10303281 | 3300025933 | Bacteria | 1391 |
| 244 | Ga0207706_10529441 | 3300025933 | Bacteria | 1016 |
| 245 | Ga0207709_10128804 | 3300025935 | Bacteria | 1721 |
| 246 | Ga0207665_10049435 | 3300025939 | Bacteria | 2825 |
| 247 | Ga0207665_10053045 | 3300025939 | Bacteria | 2732 |
| 248 | Ga0207665_10054933 | 3300025939 | Bacteria | 2686 |
| 249 | Ga0207665_10350172 | 3300025939 | Bacteria | 1115 |
| 250 | Ga0207691_10047002 | 3300025940 | Bacteria | 3963 |
| 251 | Ga0207711_10890746 | 3300025941 | Bacteria | 827 |
| 252 | Ga0207689_10040112 | 3300025942 | Bacteria | 3876 |
| 253 | Ga0207661_10005022 | 3300025944 | Bacteria | 9276 |
| 254 | Ga0207661_10010196 | 3300025944 | Bacteria | 6756 |
| 255 | Ga0207661_10381336 | 3300025944 | Bacteria | 1276 |
| 256 | Ga0207712_10089307 | 3300025961 | Bacteria | 2265 |
| 257 | Ga0207712_10133367 | 3300025961 | Bacteria | 1896 |
| 258 | Ga0207712_10188451 | 3300025961 | Bacteria | 1626 |
| 259 | Ga0207712_10817285 | 3300025961 | Bacteria | 820 |
| 260 | Ga0207668_10005233 | 3300025972 | Bacteria | 7633 |
| 261 | Ga0207658_10007886 | 3300025986 | Bacteria | 7251 |
| 262 | Ga0207703_10048097 | 3300026035 | Bacteria | 3441 |
| 263 | Ga0207678_10098772 | 3300026067 | Bacteria | 2494 |
| 264 | Ga0207702_10597415 | 3300026078 | Bacteria | 1083 |
| 265 | Ga0207641_10358136 | 3300026088 | Bacteria | 1392 |
| 266 | Ga0207648_10181552 | 3300026089 | Bacteria | 1863 |
| 267 | Ga0207676_10345179 | 3300026095 | Unclassified | 1375 |
| 268 | Ga0207676_10660821 | 3300026095 | Bacteria | 1009 |
| 269 | Ga0207674_10024320 | 3300026116 | Bacteria | 6476 |
| 270 | Ga0207674_10364783 | 3300026116 | Bacteria | 1396 |
| 271 | Ga0207674_10807944 | 3300026116 | Bacteria | 905 |
| 272 | Ga0207675_100048385 | 3300026118 | Bacteria | 3969 |
| 273 | Ga0209389_1000094 | 3300027296 | Bacteria | 80555 |
| 274 | Ga0209389_1000235 | 3300027296 | Bacteria | 36612 |
| 275 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 276 | Ga0209589_1001753 | 3300027357 | Bacteria | 36436 |
| 277 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 278 | Ga0209489_100597 | 3300027361 | Bacteria | 69726 |
| 279 | Ga0209489_105972 | 3300027361 | Bacteria | 20211 |
| 280 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 281 | Ga0209700_100374 | 3300027363 | Bacteria | 81273 |
| 282 | Ga0209179_1013902 | 3300027512 | Bacteria | 1470 |
| 283 | Ga0209588_1003105 | 3300027671 | Unclassified | 4579 |
| 284 | Ga0209588_1009480 | 3300027671 | Bacteria | 2911 |
| 285 | Ga0209588_1056467 | 3300027671 | Bacteria | 1269 |
| 286 | Ga0209588_1131571 | 3300027671 | Unclassified | 798 |
| 287 | Ga0207428_10004480 | 3300027907 | Bacteria | 13247 |
| 288 | Ga0207428_10105099 | 3300027907 | Bacteria | 2178 |
| 289 | Ga0268266_10000914 | 3300028379 | Bacteria | 37986 |
| 290 | Ga0268265_10020884 | 3300028380 | Bacteria | 4577 |
| 291 | Ga0307508_10106408 | 3300031616 | Bacteria | 2403 |
| 292 | Ga0307416_100112395 | 3300032002 | Unclassified | 2404 |
| 293 | Ga0307416_100225416 | 3300032002 | Bacteria | 1802 |
| 294 | Ga0307411_10031829 | 3300032005 | Plasmid | 3251 |
| 295 | Ga0373938_0069095 | 3300034957 | Bacteria | 841 |
| 296 | Ga0373926_0046235 | 3300035083 | Bacteria | 1562 |
| 297 | Ga0373944_0003203 | 3300035089 | Bacteria | 4206 |
| 298 | Ga0373944_0013545 | 3300035089 | Unclassified | 2264 |
| 299 | Ga0373923_0144232 | 3300035111 | Bacteria | 1078 |
| 300 | Ga0373936_0217915 | 3300035113 | Bacteria | 846 |
| 301 | Ga0373945_0003444 | 3300035116 | Bacteria | 4976 |
| 302 | Ga0373954_0176545 | 3300035118 | Bacteria | 1047 |
| 303 | Ga0373943_0000094 | 3300035170 | Bacteria | 32911 |
| 304 | Ga0373943_0271064 | 3300035170 | Bacteria | 957 |
| 305 | Ga0373943_0271953 | 3300035170 | Bacteria | 956 |
| 306 | Ga0373946_0000421 | 3300035171 | Bacteria | 13804 |
| 307 | Ga0373946_0035408 | 3300035171 | Bacteria | 2020 |
| 308 | Ga0373946_0036794 | 3300035171 | Bacteria | 1987 |
| 309 | Ga0373955_0176587 | 3300035172 | Bacteria | 1266 |
| 310 | Ga0373924_0011887 | 3300035410 | Bacteria | 3242 |
| 311 | Ga0373931_0024441 | 3300035691 | Bacteria | 3061 |
| 312 | Ga0373935_0000839 | 3300035692 | Bacteria | 16556 |
| 313 | Ga0373935_0004453 | 3300035692 | Bacteria | 8225 |
| 314 | Ga0373935_0131156 | 3300035692 | Bacteria | 1684 |
| 315 | Ga0373935_0508777 | 3300035692 | Bacteria | 875 |
| 316 | Ga0373927_0004203 | 3300035695 | Bacteria | 10115 |
| 317 | Ga0373927_0052929 | 3300035695 | Bacteria | 2625 |
| 318 | Ga0373927_0055861 | 3300035695 | Bacteria | 2552 |
| 319 | Ga0373927_0093990 | 3300035695 | Unclassified | 1948 |
| 320 | Ga0373927_0335683 | 3300035695 | Bacteria | 995 |
| 321 | Ga0373927_0406288 | 3300035695 | Bacteria | 898 |
| 322 | Ga0373933_0104547 | 3300035724 | Unclassified | 1760 |
| 323 | Ga0373947_0000225 | 3300035725 | Bacteria | 31624 |
| 324 | Ga0373947_0016095 | 3300035725 | Unclassified | 4297 |
| 325 | Ga0373947_0017149 | 3300035725 | Bacteria | 4164 |
| 326 | Ga0373947_0049426 | 3300035725 | Bacteria | 2526 |
| 327 | Ga0373947_0308707 | 3300035725 | Bacteria | 1056 |
| 328 | Ga0373947_0582453 | 3300035725 | Bacteria | 762 |
| 329 | Ga0373937_0031934 | 3300036401 | Bacteria | 4774 |
| 330 | Ga0373937_0047796 | 3300036401 | Bacteria | 3916 |
| 331 | Ga0373937_0573972 | 3300036401 | Unclassified | 1071 |
| 332 | Ga0373925_0002349 | 3300037068 | Bacteria | 15193 |
| 333 | Ga0373925_0057968 | 3300037068 | Bacteria | 2903 |
| 334 | Ga0373925_0073670 | 3300037068 | Unclassified | 2585 |
| 335 | Ga0373925_0087810 | 3300037068 | Bacteria | 2374 |
| 336 | Ga0373925_0099699 | 3300037068 | Unclassified | 2231 |
| 337 | Ga0373925_0157193 | 3300037068 | Bacteria | 1789 |
| 338 | Ga0395898_0260182 | 3300037466 | Bacteria | 1655 |
| 339 | Ga0395898_0267852 | 3300037466 | Unclassified | 1629 |
| 340 | Ga0395905_0024997 | 3300037471 | Bacteria | 5634 |
| 341 | Ga0395905_0337620 | 3300037471 | Bacteria | 1398 |
| 342 | Ga0395901_0162853 | 3300038443 | Bacteria | 2342 |
| 343 | Ga0436365_0999519 | 3300039437 | Bacteria | 1042 |
| 344 | Ga0436360_0922892 | 3300039438 | Bacteria | 1273 |
| 345 | Ga0436361_0193135 | 3300039447 | Bacteria | 1422 |
| 346 | Ga0436363_1626812 | 3300039450 | Unclassified | 2817 |
| 347 | Ga0436362_0902649 | 3300039453 | Bacteria | 991 |
| 348 | Ga0453683_0181180 | 3300044673 | Bacteria | 1336 |
| 349 | Ga0495592_0117412 | 3300046454 | Bacteria | 1876 |
| 350 | Ga0495603_0005289 | 3300046455 | Bacteria | 7695 |
| 351 | Ga0495603_0020067 | 3300046455 | Bacteria | 4050 |
| 352 | Ga0495603_0028694 | 3300046455 | Bacteria | 3357 |
| 353 | Ga0495590_0085013 | 3300046457 | Bacteria | 1116 |
| 354 | Ga0495638_0137508 | 3300046460 | Bacteria | 1429 |
| 355 | Ga0495641_0023927 | 3300046461 | Bacteria | 3025 |
| 356 | Ga0495653_0065254 | 3300046463 | Bacteria | 2741 |
| 357 | Ga0495580_0071274 | 3300046472 | Unclassified | 2427 |
| 358 | Ga0495580_0199964 | 3300046472 | Bacteria | 1377 |
| 359 | Ga0495580_0365977 | 3300046472 | Bacteria | 975 |
| 360 | Ga0495580_0393542 | 3300046472 | Bacteria | 935 |
| 361 | Ga0495582_0224243 | 3300046473 | Bacteria | 1076 |
| 362 | Ga0495605_0038449 | 3300046474 | Bacteria | 2400 |
| 363 | Ga0495605_0049542 | 3300046474 | Bacteria | 2052 |
| 364 | Ga0495605_0234224 | 3300046474 | Bacteria | 790 |
| 365 | Ga0495639_0037065 | 3300046475 | Unclassified | 2186 |
| 366 | Ga0495662_0003937 | 3300046476 | Bacteria | 7492 |
| 367 | Ga0495662_0049468 | 3300046476 | Bacteria | 2029 |
| 368 | Ga0495662_0060195 | 3300046476 | Bacteria | 1834 |
| 369 | Ga0495664_0000553 | 3300046477 | Bacteria | 18839 |
| 370 | Ga0495664_0109969 | 3300046477 | Bacteria | 1663 |
| 371 | Ga0495664_0173142 | 3300046477 | Bacteria | 1309 |
| 372 | Ga0495664_0420343 | 3300046477 | Unclassified | 802 |
| 373 | Ga0495584_0194725 | 3300046491 | Bacteria | 1030 |
| 374 | Ga0495584_0219885 | 3300046491 | Bacteria | 965 |
| 375 | Ga0495585_0156942 | 3300046492 | Bacteria | 1183 |
| 376 | Ga0495594_0029927 | 3300046499 | Bacteria | 2944 |
| 377 | Ga0495594_0271317 | 3300046499 | Bacteria | 966 |
| 378 | Ga0495606_0069257 | 3300046507 | Bacteria | 2229 |
| 379 | Ga0495608_0435731 | 3300046511 | Unclassified | 799 |
| 380 | Ga0495618_0030956 | 3300046514 | Plasmid | 3345 |
| 381 | Ga0495618_0038815 | 3300046514 | Bacteria | 2993 |
| 382 | Ga0495618_0062623 | 3300046514 | Bacteria | 2361 |
| 383 | Ga0495618_0138129 | 3300046514 | Bacteria | 1559 |
| 384 | Ga0495630_0001809 | 3300046517 | Bacteria | 14917 |
| 385 | Ga0495630_0017957 | 3300046517 | Bacteria | 5190 |
| 386 | Ga0495630_0065405 | 3300046517 | Bacteria | 2733 |
| 387 | Ga0495630_0127932 | 3300046517 | Bacteria | 1928 |
| 388 | Ga0495630_0194403 | 3300046517 | Bacteria | 1548 |
| 389 | Ga0495630_0224296 | 3300046517 | Bacteria | 1435 |
| 390 | Ga0495648_0013972 | 3300046524 | Bacteria | 5906 |
| 391 | Ga0495648_0113455 | 3300046524 | Bacteria | 1470 |
| 392 | Ga0495663_0081704 | 3300046525 | Bacteria | 1042 |
| 393 | Ga0495666_0011739 | 3300046526 | Plasmid | 4367 |
| 394 | Ga0495666_0074524 | 3300046526 | Bacteria | 1610 |
| 395 | Ga0495652_0038212 | 3300046529 | Bacteria | 4160 |
| 396 | Ga0495652_0080501 | 3300046529 | Bacteria | 2690 |
| 397 | Ga0495665_0002591 | 3300046531 | Bacteria | 9760 |
| 398 | Ga0495665_0178540 | 3300046531 | Bacteria | 1104 |
| 399 | Ga0495640_0004271 | 3300046533 | Bacteria | 11421 |
| 400 | Ga0495640_0016119 | 3300046533 | Bacteria | 5595 |
| 401 | Ga0495640_0103019 | 3300046533 | Bacteria | 1872 |
| 402 | Ga0495640_0109912 | 3300046533 | Bacteria | 1802 |
| 403 | Ga0495640_0306146 | 3300046533 | Bacteria | 986 |
| 404 | Ga0495586_0076648 | 3300046535 | Unclassified | 1832 |
| 405 | Ga0495609_0048268 | 3300046538 | Bacteria | 1903 |
| 406 | Ga0495621_0014117 | 3300046539 | Bacteria | 2522 |
| 407 | Ga0495621_0017959 | 3300046539 | Bacteria | 2293 |
| 408 | Ga0495645_0043851 | 3300046543 | Unclassified | 3263 |
| 409 | Ga0495622_0053599 | 3300046557 | Bacteria | 1872 |
| 410 | Ga0495622_0110297 | 3300046557 | Bacteria | 1260 |
| 411 | Ga0495633_0097688 | 3300046558 | Bacteria | 1364 |
| 412 | Ga0495667_0436546 | 3300046559 | Bacteria | 823 |
| 413 | Ga0495656_0031594 | 3300046615 | Bacteria | 2149 |
| 414 | Ga0495656_0109420 | 3300046615 | Bacteria | 1290 |
| 415 | Ga0495656_0184073 | 3300046615 | Bacteria | 1028 |
| 416 | Ga0495634_0053792 | 3300046642 | Plasmid | 2695 |
| 417 | Ga0495634_0056977 | 3300046642 | Unclassified | 2609 |
| 418 | Ga0495634_0079598 | 3300046642 | Unclassified | 2145 |
| 419 | Ga0495611_0058894 | 3300046648 | Bacteria | 1743 |
| 420 | Ga0495611_0136179 | 3300046648 | Bacteria | 1147 |
| 421 | Ga0495625_0111007 | 3300046660 | Bacteria | 1874 |
| 422 | Ga0495635_0012795 | 3300046663 | Bacteria | 5877 |
| 423 | Ga0495635_0043871 | 3300046663 | Unclassified | 3085 |
| 424 | Ga0495635_0200423 | 3300046663 | Bacteria | 1354 |
| 425 | Ga0495588_0011436 | 3300046674 | Bacteria | 4166 |
| 426 | Ga0495646_0141487 | 3300046680 | Bacteria | 1345 |
| 427 | Ga0495647_0007035 | 3300046681 | Bacteria | 3751 |
| 428 | Ga0495647_0044442 | 3300046681 | Bacteria | 1704 |
| 429 | Ga0495658_0063679 | 3300046683 | Bacteria | 2122 |
| 430 | Ga0495658_0214430 | 3300046683 | Unclassified | 1204 |
| 431 | Ga0495669_0195386 | 3300046684 | Bacteria | 966 |
| 432 | Ga0495613_0010864 | 3300046689 | Bacteria | 6756 |
| 433 | Ga0495613_0147326 | 3300046689 | Bacteria | 1680 |
| 434 | Ga0495624_0001669 | 3300046690 | Bacteria | 17009 |
| 435 | Ga0495670_0101398 | 3300046691 | Bacteria | 1483 |
| 436 | Ga0495671_0079552 | 3300046692 | Bacteria | 1607 |
| 437 | Ga0495671_0080318 | 3300046692 | Bacteria | 1598 |
| 438 | Ga0495649_0217772 | 3300046694 | Bacteria | 988 |
| 439 | Ga0495649_0308375 | 3300046694 | Bacteria | 805 |
| 440 | Ga0495660_0140395 | 3300046810 | Bacteria | 1203 |
| 441 | Ga0495581_0033022 | 3300047315 | Plasmid | 2996 |
| 442 | Ga0495581_0038167 | 3300047315 | Bacteria | 2780 |
| 443 | Ga0495581_0071682 | 3300047315 | Bacteria | 2005 |
| 444 | Ga0495581_0088491 | 3300047315 | Bacteria | 1796 |
| 445 | Ga0495581_0348810 | 3300047315 | Unclassified | 864 |
| 446 | Ga0495674_0022324 | 3300047319 | Bacteria | 5837 |
| 447 | Ga0495674_0037999 | 3300047319 | Unclassified | 4324 |
| 448 | Ga0495674_0300357 | 3300047319 | Unclassified | 1311 |
| 449 | Ga0495676_0006465 | 3300047321 | Bacteria | 10800 |
| 450 | Ga0495676_0084499 | 3300047321 | Bacteria | 2395 |
| 451 | Ga0495676_0101873 | 3300047321 | Bacteria | 2123 |
| 452 | Ga0495676_0197252 | 3300047321 | Bacteria | 1400 |
| 453 | Ga0495680_0376460 | 3300047322 | Bacteria | 984 |
| 454 | Ga0495683_0134180 | 3300047323 | Bacteria | 1165 |
| 455 | Ga0495685_024646 | 3300047447 | Bacteria | 2071 |
| 456 | Ga0495684_0001394 | 3300047471 | Bacteria | 19398 |
| 457 | Ga0495684_0001619 | 3300047471 | Bacteria | 18049 |
| 458 | Ga0495684_0093288 | 3300047471 | Bacteria | 2280 |
| 459 | Ga0495684_0247658 | 3300047471 | Bacteria | 1297 |
| 460 | Ga0495593_0065657 | 3300047673 | Unclassified | 1892 |
| 461 | Ga0495615_0006467 | 3300048090 | Bacteria | 2173 |
| 462 | Ga0496100_0141203 | 3300048903 | Bacteria | 1707 |
| 463 | Ga0496100_0171862 | 3300048903 | Bacteria | 1561 |
| 464 | Ga0496100_0261847 | 3300048903 | Bacteria | 1283 |
| 465 | Ga0496100_0274090 | 3300048903 | Bacteria | 1255 |
| 466 | Ga0496102_0015465 | 3300048905 | Bacteria | 6647 |
| 467 | Ga0496102_0168698 | 3300048905 | Bacteria | 2060 |
| 468 | Ga0496102_0302150 | 3300048905 | Bacteria | 1508 |
| 469 | Ga0496102_0393179 | 3300048905 | Bacteria | 1304 |
| 470 | Ga0496102_0531373 | 3300048905 | Bacteria | 1099 |
| 471 | Ga0496102_0551713 | 3300048905 | Bacteria | 1075 |
| 472 | Ga0496102_0817255 | 3300048905 | Bacteria | 854 |
| 473 | Ga0496103_0020160 | 3300048906 | Bacteria | 4003 |
| 474 | Ga0496103_0207093 | 3300048906 | Bacteria | 1261 |
| 475 | Ga0496104_0000125 | 3300048907 | Bacteria | 71005 |
| 476 | Ga0496104_0000284 | 3300048907 | Bacteria | 44754 |
| 477 | Ga0496104_0000669 | 3300048907 | Bacteria | 29403 |
| 478 | Ga0496104_0013454 | 3300048907 | Bacteria | 7372 |
| 479 | Ga0496104_0043912 | 3300048907 | Bacteria | 4199 |
| 480 | Ga0496104_0363200 | 3300048907 | Unclassified | 1360 |
| 481 | Ga0496104_0564956 | 3300048907 | Bacteria | 1048 |
| 482 | Ga0496105_0001756 | 3300048908 | Bacteria | 15507 |
| 483 | Ga0496105_0029278 | 3300048908 | Bacteria | 4507 |
| 484 | Ga0496105_0089709 | 3300048908 | Bacteria | 2540 |
| 485 | Ga0496105_0259328 | 3300048908 | Unclassified | 1406 |
| 486 | Ga0496106_0030978 | 3300048909 | Bacteria | 3987 |
| 487 | Ga0496106_0055282 | 3300048909 | Bacteria | 3000 |
| 488 | Ga0496106_0116921 | 3300048909 | Unclassified | 2080 |
| 489 | Ga0496106_0148891 | 3300048909 | Bacteria | 1845 |
| 490 | Ga0496107_0191914 | 3300048910 | Bacteria | 1518 |
| 491 | Ga0496107_0295662 | 3300048910 | Bacteria | 1205 |
| 492 | Ga0496107_0298807 | 3300048910 | Bacteria | 1198 |
| 493 | Ga0496108_0000869 | 3300048911 | Bacteria | 23545 |
| 494 | Ga0496108_0037611 | 3300048911 | Bacteria | 4032 |
| 495 | Ga0496108_0101255 | 3300048911 | Bacteria | 2458 |
| 496 | Ga0496109_0000537 | 3300048912 | Bacteria | 32125 |
| 497 | Ga0496109_0001938 | 3300048912 | Bacteria | 17205 |
| 498 | Ga0496109_0012274 | 3300048912 | Bacteria | 7396 |
| 499 | Ga0496109_0054455 | 3300048912 | Bacteria | 3649 |
| 500 | Ga0496109_0061619 | 3300048912 | Bacteria | 3430 |
| 501 | Ga0496109_0106182 | 3300048912 | Bacteria | 2608 |
| 502 | Ga0496109_0157109 | 3300048912 | Bacteria | 2130 |
| 503 | Ga0496110_0001099 | 3300048913 | Bacteria | 19068 |
| 504 | Ga0496110_0010615 | 3300048913 | Bacteria | 7498 |
| 505 | Ga0496110_0027567 | 3300048913 | Bacteria | 4870 |
| 506 | Ga0496110_0060949 | 3300048913 | Bacteria | 3328 |
| 507 | Ga0496110_0232159 | 3300048913 | Bacteria | 1678 |
| 508 | Ga0496110_0253633 | 3300048913 | Bacteria | 1601 |
| 509 | Ga0496110_0492578 | 3300048913 | Bacteria | 1116 |
| 510 | Ga0496110_0594639 | 3300048913 | Bacteria | 1004 |
| 511 | Ga0496111_0012027 | 3300048914 | Bacteria | 5850 |
| 512 | Ga0496111_0013338 | 3300048914 | Bacteria | 5589 |
| 513 | Ga0496111_0017665 | 3300048914 | Bacteria | 4932 |
| 514 | Ga0496111_0032208 | 3300048914 | Bacteria | 3737 |
| 515 | Ga0496111_0106047 | 3300048914 | Bacteria | 2068 |
| 516 | Ga0496111_0201670 | 3300048914 | Bacteria | 1479 |
| 517 | Ga0496111_0402821 | 3300048914 | Bacteria | 1011 |
| 518 | Ga0496112_0001765 | 3300048915 | Bacteria | 16964 |
| 519 | Ga0496112_0002723 | 3300048915 | Bacteria | 14308 |
| 520 | Ga0496112_0002865 | 3300048915 | Bacteria | 14019 |
| 521 | Ga0496112_0005705 | 3300048915 | Bacteria | 10814 |
| 522 | Ga0496112_0022193 | 3300048915 | Bacteria | 6050 |
| 523 | Ga0496112_0250726 | 3300048915 | Unclassified | 1721 |
| 524 | Ga0496113_0000616 | 3300048916 | Bacteria | 17846 |
| 525 | Ga0496113_0013892 | 3300048916 | Bacteria | 5473 |
| 526 | Ga0496113_0013976 | 3300048916 | Bacteria | 5462 |
| 527 | Ga0496113_0074247 | 3300048916 | Bacteria | 2592 |
| 528 | Ga0496113_0357050 | 3300048916 | Unclassified | 1172 |
| 529 | Ga0496114_0092980 | 3300048917 | Bacteria | 2563 |
| 530 | Ga0496114_0124642 | 3300048917 | Bacteria | 2219 |
| 531 | Ga0496115_0018528 | 3300048918 | Bacteria | 5348 |
| 532 | Ga0496115_0027299 | 3300048918 | Bacteria | 4464 |
| 533 | Ga0496115_0250677 | 3300048918 | Bacteria | 1458 |
| 534 | Ga0496121_0106445 | 3300048924 | Bacteria | 2150 |
| 535 | Ga0496124_0022281 | 3300048927 | Bacteria | 5812 |
| 536 | Ga0496125_0039579 | 3300048928 | Bacteria | 4056 |
| 537 | nmdc:mga0yw44_33352_c1 | 3300050492 | Bacteria | 3008 |
| 538 | nmdc:mga0yw44_39925_c1 | 3300050492 | Bacteria | 2785 |
| 539 | nmdc:mga06z11_8864_c1 | 3300050494 | Bacteria | 4215 |
| 540 | nmdc:mga05p37_1225660_c1 | 3300050507 | Unclassified | 772 |
| 541 | nmdc:mga05p37_132792_c1 | 3300050507 | Unclassified | 3054 |
| 542 | nmdc:mga05p37_13638_c1 | 3300050507 | Bacteria | 9739 |
| 543 | nmdc:mga05p37_19437_c1 | 3300050507 | Bacteria | 8218 |
| 544 | nmdc:mga05p37_60071_c1 | 3300050507 | Bacteria | 4681 |
| 545 | nmdc:mga09592_54902_c1 | 3300050508 | Bacteria | 3366 |
| 546 | nmdc:mga0qj67_401446_c1 | 3300050509 | Unclassified | 1106 |
| 547 | nmdc:mga0qj67_44958_c1 | 3300050509 | Bacteria | 3483 |
| 548 | nmdc:mga06r32_148358_c1 | 3300050510 | Unclassified | 2323 |
| 549 | nmdc:mga06r32_33628_c1 | 3300050510 | Bacteria | 4829 |
| 550 | nmdc:mga06r32_455128_c1 | 3300050510 | Bacteria | 1259 |
| 551 | nmdc:mga08y16_58506_c1 | 3300050511 | Bacteria | 4027 |
| 552 | nmdc:mga0n895_157272_c1 | 3300050512 | Bacteria | 2303 |
| 553 | nmdc:mga0n895_172862_c1 | 3300050512 | Bacteria | 2192 |
| 554 | nmdc:mga0n895_239391_c1 | 3300050512 | Unclassified | 1841 |
| 555 | nmdc:mga0n895_24032_c1 | 3300050512 | Bacteria | 5737 |
| 556 | nmdc:mga0n895_289346_c1 | 3300050512 | Bacteria | 1661 |
| 557 | nmdc:mga0n895_369561_c1 | 3300050512 | Bacteria | 1452 |
| 558 | nmdc:mga0n895_539482_c1 | 3300050512 | Unclassified | 1173 |
| 559 | nmdc:mga0rr50_306501_c1 | 3300050513 | Unclassified | 1329 |
| 560 | nmdc:mga0rr50_371315_c1 | 3300050513 | Bacteria | 1205 |
| 561 | nmdc:mga0rr50_77751_c1 | 3300050513 | Bacteria | 2551 |
| 562 | nmdc:mga0a205_54072_c1 | 3300050515 | Bacteria | 3876 |
| 563 | nmdc:mga0a205_583887_c1 | 3300050515 | Bacteria | 971 |
| 564 | Ga0495601_0007089 | 3300053077 | Bacteria | 6567 |
| 565 | Ga0495601_0030308 | 3300053077 | Bacteria | 3358 |
| 566 | Ga0495612_0002960 | 3300053078 | Bacteria | 7047 |
| 567 | Ga0495655_0042635 | 3300053083 | Bacteria | 1166 |
| 568 | Ga0495595_0161102 | 3300053084 | Bacteria | 1107 |
| 569 | Ga0495619_0001919 | 3300053085 | Bacteria | 13857 |
| 570 | Ga0495619_0068153 | 3300053085 | Bacteria | 2376 |
| 571 | Ga0500595_014968 | 3300053119 | Bacteria | 2926 |
| 572 | Ga0500658_0010930 | 3300053134 | Bacteria | 3348 |
| 573 | Ga0500589_068617 | 3300053147 | Bacteria | 1609 |
| 574 | Ga0500634_0142161 | 3300053161 | Bacteria | 1135 |
| 575 | Ga0500637_0200588 | 3300053178 | Bacteria | 1136 |
| 576 | 2513628354 | 2513237092 | Bacteria | 8341956 |
| 577 | 2513671497 | 2513237098 | Bacteria | 9902361 |
| 578 | 2524441714 | 2524023205 | Bacteria | 8918781 |
| 579 | 2524464803 | 2524023210 | Bacteria | 9029266 |
| 580 | 2745075022 | 2744054633 | Bacteria | 8678936 |
| 581 | 2824706172 | 2824704595 | Bacteria | 9667483 |
| 582 | 2824758702 | 2824753945 | Bacteria | 9787441 |
| 583 | 2824769018 | 2824763712 | Bacteria | 9792355 |
| 584 | 2847934988 | 2847930680 | Bacteria | 9342022 |
| 585 | 2876763810 | 2876761206 | Bacteria | 10111113 |
| 586 | 2876810764 | 2876808645 | Bacteria | 8824342 |
| 587 | 2879086382 | 2879083081 | Bacteria | 8587928 |
| 588 | 2879115972 | 2879110137 | Bacteria | 8907982 |
| 589 | 2881365493 | 2881364244 | Bacteria | 7710352 |
| 590 | 2885388484 | 2885383462 | Bacteria | 9473874 |
| 591 | 2903773327 | 2903768456 | Bacteria | 9749579 |
| 592 | 2904720195 | 2904711408 | Bacteria | 9771557 |
| 593 | 2922361238 | 2922361189 | Bacteria | 7436256 |
| 594 | 2935767980 | 2935760218 | Bacteria | 9817913 |
| 595 | Ga0495672_0221807 | |||
| 596 | JGI25406J46586_10043718 | |||
| 597 | JGI25406J46586_10062071 | |||
| 598 | JGI25406J46586_10087195 | |||
| 599 | JGI25404J52841_10013128 | |||
| 600 | JGI25404J52841_10023204 | |||
| 601 | JGI25405J52794_10003598 | |||
| 602 | Ga0070683_100075135 | |||
| 603 | Ga0070682_100467668 | |||
| 604 | Ga0070689_100212929 | |||
| 605 | Ga0070661_100284738 | |||
| 606 | Ga0070692_10188531 | |||
| 607 | Ga0070668_100012647 | |||
| 608 | Ga0070668_100039864 | |||
| 609 | Ga0070671_100037745 | |||
| 610 | Ga0070673_100070693 | |||
| 611 | Ga0070667_100099333 | |||
| 612 | Ga0070709_10082782 | |||
| 613 | Ga0070709_10087689 | |||
| 614 | Ga0070714_100101999 | |||
| 615 | Ga0070714_100177339 | |||
| 616 | Ga0070714_100303107 | |||
| 617 | Ga0070713_100134991 | |||
| 618 | Ga0070713_100566434 | |||
| 619 | Ga0070710_10044260 | |||
| 620 | Ga0070710_10070692 | |||
| 621 | Ga0070710_10150112 | |||
| 622 | Ga0070710_10255691 | |||
| 623 | Ga0070710_10287067 | |||
| 624 | Ga0070711_100062040 | |||
| 625 | Ga0070711_100072248 | |||
| 626 | Ga0070711_100117103 | |||
| 627 | Ga0070711_100117545 | |||
| 628 | Ga0070711_100162059 | |||
| 629 | Ga0070711_100169912 | |||
| 630 | Ga0070711_100382288 | |||
| 631 | Ga0070711_100566887 | |||
| 632 | Ga0070700_100255513 | |||
| 633 | Ga0070708_100210768 | |||
| 634 | Ga0070708_100585485 | |||
| 635 | Ga0070663_100311296 | |||
| 636 | Ga0070662_100186129 | |||
| 637 | Ga0070681_10277343 | |||
| 638 | Ga0070706_100028406 | |||
| 639 | Ga0070706_100264550 | |||
| 640 | Ga0070707_100086724 | |||
| 641 | Ga0070698_100069744 | |||
| 642 | Ga0070698_100121168 | |||
| 643 | Ga0070699_100008545 | |||
| 644 | Ga0070684_100011674 | |||
| 645 | Ga0070697_100096214 | |||
| 646 | Ga0070696_100139020 | |||
| 647 | Ga0070665_100007736 | |||
| 648 | Ga0070665_100271470 | |||
| 649 | Ga0070704_100350076 | |||
| 650 | Ga0068857_100071786 | |||
| 651 | Ga0068856_100196750 | |||
| 652 | Ga0070702_100214746 | |||
| 653 | Ga0068864_100279546 | |||
| 654 | Ga0068864_100359492 | |||
| 655 | Ga0068866_10186946 | |||
| 656 | Ga0068861_100011838 | |||
| 657 | Ga0068863_100086690 | |||
| 658 | Ga0068863_100431455 | |||
| 659 | Ga0081455_10001307 | |||
| 660 | Ga0081455_10002863 | |||
| 661 | Ga0081455_10036867 | |||
| 662 | Ga0081455_10362453 | |||
| 663 | Ga0081540_1000397 | |||
| 664 | Ga0081540_1006400 | |||
| 665 | Ga0081540_1006853 | |||
| 666 | Ga0081540_1010207 | |||
| 667 | Ga0081540_1013288 | |||
| 668 | Ga0081540_1023998 | |||
| 669 | Ga0081540_1024451 | |||
| 670 | Ga0081540_1028018 | |||
| 671 | Ga0081540_1028641 | |||
| 672 | Ga0081540_1038197 | |||
| 673 | Ga0081540_1041477 | |||
| 674 | Ga0081540_1043446 | |||
| 675 | Ga0081540_1047944 | |||
| 676 | Ga0081540_1050292 | |||
| 677 | Ga0081540_1069369 | |||
| 678 | Ga0081540_1095627 | |||
| 679 | Ga0081539_10002257 | |||
| 680 | Ga0081539_10032436 | |||
| 681 | Ga0081539_10036033 | |||
| 682 | Ga0081539_10045099 | |||
| 683 | Ga0081539_10164450 | |||
| 684 | Ga0070717_10029588 | |||
| 685 | Ga0070717_10113751 | |||
| 686 | Ga0070717_10135207 | |||
| 687 | Ga0070717_10197856 | |||
| 688 | Ga0070717_10418143 | |||
| 689 | Ga0075365_10019536 | |||
| 690 | Ga0075365_10026743 | |||
| 691 | Ga0075365_10316217 | |||
| 692 | Ga0075432_10009289 | |||
| 693 | Ga0075432_10044809 | |||
| 694 | Ga0070715_10016056 | |||
| 695 | Ga0070715_10066791 | |||
| 696 | Ga0070715_10076823 | |||
| 697 | Ga0070715_10120034 | |||
| 698 | Ga0070716_100089878 | |||
| 699 | Ga0070716_100155600 | |||
| 700 | Ga0070716_100176282 | |||
| 701 | Ga0070712_100016436 | |||
| 702 | Ga0070712_100033575 | |||
| 703 | Ga0070712_100045144 | |||
| 704 | Ga0070712_100130540 | |||
| 705 | Ga0070712_100132592 | |||
| 706 | Ga0070712_100174531 | |||
| 707 | Ga0070712_100657551 | |||
| 708 | Ga0075427_10000548 | |||
| 709 | Ga0097621_100475075 | |||
| 710 | Ga0068871_100057418 | |||
| 711 | Ga0075428_100012679 | |||
| 712 | Ga0075428_100043882 | |||
| 713 | Ga0075428_100418145 | |||
| 714 | Ga0075428_100692482 | |||
| 715 | Ga0075428_100889565 | |||
| 716 | Ga0075430_100007070 | |||
| 717 | Ga0075430_100115462 | |||
| 718 | Ga0075430_100119086 | |||
| 719 | Ga0075431_100005987 | |||
| 720 | Ga0075431_100021184 | |||
| 721 | Ga0075431_100165683 | |||
| 722 | Ga0075433_10066918 | |||
| 723 | Ga0075433_10069679 | |||
| 724 | Ga0075434_100133923 | |||
| 725 | Ga0075434_100169864 | |||
| 726 | Ga0075434_100182617 | |||
| 727 | Ga0075434_100237193 | |||
| 728 | Ga0075434_100632247 | |||
| 729 | Ga0075429_100009244 | |||
| 730 | Ga0075429_100031987 | |||
| 731 | Ga0075436_100465316 | |||
| 732 | Ga0099825_1029095 | |||
| 733 | Ga0099824_1016795 | |||
| 734 | Ga0075435_100154253 | |||
| 735 | Ga0075435_100214384 | |||
| 736 | Ga0075435_100227149 | |||
| 737 | Ga0099794_10002357 | |||
| 738 | Ga0099794_10012914 | |||
| 739 | Ga0099794_10032758 | |||
| 740 | Ga0099794_10261864 | |||
| 741 | Ga0099795_10004704 | |||
| 742 | Ga0099795_10006018 | |||
| 743 | Ga0099795_10015015 | |||
| 744 | Ga0099795_10022067 | |||
| 745 | Ga0099795_10037347 | |||
| 746 | Ga0105240_10482882 | |||
| 747 | Ga0111539_10074870 | |||
| 748 | Ga0111539_10184047 | |||
| 749 | Ga0111539_10263631 | |||
| 750 | Ga0111539_10529744 | |||
| 751 | Ga0111539_11345053 | |||
| 752 | Ga0105245_10366144 | |||
| 753 | Ga0105247_10358366 | |||
| 754 | Ga0114129_10007454 | |||
| 755 | Ga0114129_10015432 | |||
| 756 | Ga0114129_10019770 | |||
| 757 | Ga0114129_10107515 | |||
| 758 | Ga0114129_10213700 | |||
| 759 | Ga0114129_10234919 | |||
| 760 | Ga0114129_11607431 | |||
| 761 | Ga0105243_10082322 | |||
| 762 | Ga0105243_10362303 | |||
| 763 | Ga0105243_10806963 | |||
| 764 | Ga0105242_10291943 | |||
| 765 | Ga0105248_10230454 | |||
| 766 | Ga0105237_10068117 | |||
| 767 | Ga0105237_10280558 | |||
| 768 | Ga0105238_10037471 | |||
| 769 | Ga0105249_10067728 | |||
| 770 | Ga0105249_10228639 | |||
| 771 | Ga0105249_10578114 | |||
| 772 | Ga0099796_10009373 | |||
| 773 | Ga0099796_10012632 | |||
| 774 | Ga0099796_10020962 | |||
| 775 | Ga0099796_10053212 | |||
| 776 | Ga0105239_10233345 | |||
| 777 | Ga0105239_10283517 | |||
| 778 | Ga0105239_10589793 | |||
| 779 | Ga0105246_10216999 | |||
| 780 | Ga0157374_10278766 | |||
| 781 | Ga0163162_10693185 | |||
| 782 | Ga0157375_10344811 | |||
| 783 | Ga0163163_10155611 | |||
| 784 | Ga0163163_10194488 | |||
| 785 | Ga0163163_10466465 | |||
| 786 | Ga0157377_10068556 | |||
| 787 | Ga0157379_10017434 | |||
| 788 | Ga0157379_10096442 | |||
| 789 | Ga0157376_10034227 | |||
| 790 | Ga0157376_10105812 | |||
| 791 | Ga0157376_10361955 | |||
| 792 | Ga0207692_10010085 | |||
| 793 | Ga0207692_10033350 | |||
| 794 | Ga0207692_10079209 | |||
| 795 | Ga0207692_10080124 | |||
| 796 | Ga0207692_10165677 | |||
| 797 | Ga0207710_10004063 | |||
| 798 | Ga0207688_10001335 | |||
| 799 | Ga0207680_10356080 | |||
| 800 | Ga0207647_10056681 | |||
| 801 | Ga0207685_10029722 | |||
| 802 | Ga0207685_10032653 | |||
| 803 | Ga0207685_10158972 | |||
| 804 | Ga0207699_10046846 | |||
| 805 | Ga0207699_10065616 | |||
| 806 | Ga0207699_10203222 | |||
| 807 | Ga0207645_10025861 | |||
| 808 | Ga0207643_10008495 | |||
| 809 | Ga0207684_10061745 | |||
| 810 | Ga0207684_10087454 | |||
| 811 | Ga0207684_10100159 | |||
| 812 | Ga0207684_10399092 | |||
| 813 | Ga0207707_10235244 | |||
| 814 | Ga0207671_10172543 | |||
| 815 | Ga0207693_10014179 | |||
| 816 | Ga0207693_10034737 | |||
| 817 | Ga0207693_10058686 | |||
| 818 | Ga0207693_10156901 | |||
| 819 | Ga0207693_10220648 | |||
| 820 | Ga0207693_10226407 | |||
| 821 | Ga0207663_10032179 | |||
| 822 | Ga0207663_10035946 | |||
| 823 | Ga0207663_10288326 | |||
| 824 | Ga0207660_10700202 | |||
| 825 | Ga0207662_10009040 | |||
| 826 | Ga0207649_10183385 | |||
| 827 | Ga0207646_10336136 | |||
| 828 | Ga0207694_10054764 | |||
| 829 | Ga0207650_10007900 | |||
| 830 | Ga0207687_10247930 | |||
| 831 | Ga0207700_10024183 | |||
| 832 | Ga0207700_10067633 | |||
| 833 | Ga0207700_10209611 | |||
| 834 | Ga0207664_10151238 | |||
| 835 | Ga0207664_10225996 | |||
| 836 | Ga0207664_10344084 | |||
| 837 | Ga0207706_10303281 | |||
| 838 | Ga0207706_10529441 | |||
| 839 | Ga0207709_10128804 | |||
| 840 | Ga0207665_10049435 | |||
| 841 | Ga0207665_10053045 | |||
| 842 | Ga0207665_10054933 | |||
| 843 | Ga0207665_10350172 | |||
| 844 | Ga0207691_10047002 | |||
| 845 | Ga0207711_10890746 | |||
| 846 | Ga0207689_10040112 | |||
| 847 | Ga0207661_10005022 | |||
| 848 | Ga0207661_10010196 | |||
| 849 | Ga0207661_10381336 | |||
| 850 | Ga0207712_10089307 | |||
| 851 | Ga0207712_10133367 | |||
| 852 | Ga0207712_10188451 | |||
| 853 | Ga0207712_10817285 | |||
| 854 | Ga0207668_10005233 | |||
| 855 | Ga0207658_10007886 | |||
| 856 | Ga0207703_10048097 | |||
| 857 | Ga0207678_10098772 | |||
| 858 | Ga0207702_10597415 | |||
| 859 | Ga0207641_10358136 | |||
| 860 | Ga0207648_10181552 | |||
| 861 | Ga0207676_10345179 | |||
| 862 | Ga0207676_10660821 | |||
| 863 | Ga0207674_10024320 | |||
| 864 | Ga0207674_10364783 | |||
| 865 | Ga0207674_10807944 | |||
| 866 | Ga0207675_100048385 | |||
| 867 | Ga0209389_1000094 | |||
| 868 | Ga0209389_1000235 | |||
| 869 | Ga0209589_1000007 | |||
| 870 | Ga0209589_1001753 | |||
| 871 | Ga0209489_100008 | |||
| 872 | Ga0209489_100597 | |||
| 873 | Ga0209489_105972 | |||
| 874 | Ga0209700_100009 | |||
| 875 | Ga0209700_100374 | |||
| 876 | Ga0209179_1013902 | |||
| 877 | Ga0209588_1003105 | |||
| 878 | Ga0209588_1009480 | |||
| 879 | Ga0209588_1056467 | |||
| 880 | Ga0209588_1131571 | |||
| 881 | Ga0207428_10004480 | |||
| 882 | Ga0207428_10105099 | |||
| 883 | Ga0268266_10000914 | |||
| 884 | Ga0268265_10020884 | |||
| 885 | Ga0307508_10106408 | |||
| 886 | Ga0307416_100112395 | |||
| 887 | Ga0307416_100225416 | |||
| 888 | Ga0307411_10031829 | |||
| 889 | Ga0373938_0069095 | |||
| 890 | Ga0373926_0046235 | |||
| 891 | Ga0373944_0003203 | |||
| 892 | Ga0373944_0013545 | |||
| 893 | Ga0373923_0144232 | |||
| 894 | Ga0373936_0217915 | |||
| 895 | Ga0373945_0003444 | |||
| 896 | Ga0373954_0176545 | |||
| 897 | Ga0373943_0000094 | |||
| 898 | Ga0373943_0271064 | |||
| 899 | Ga0373943_0271953 | |||
| 900 | Ga0373946_0000421 | |||
| 901 | Ga0373946_0035408 | |||
| 902 | Ga0373946_0036794 | |||
| 903 | Ga0373955_0176587 | |||
| 904 | Ga0373924_0011887 | |||
| 905 | Ga0373931_0024441 | |||
| 906 | Ga0373935_0000839 | |||
| 907 | Ga0373935_0004453 | |||
| 908 | Ga0373935_0131156 | |||
| 909 | Ga0373935_0508777 | |||
| 910 | Ga0373927_0004203 | |||
| 911 | Ga0373927_0052929 | |||
| 912 | Ga0373927_0055861 | |||
| 913 | Ga0373927_0093990 | |||
| 914 | Ga0373927_0335683 | |||
| 915 | Ga0373927_0406288 | |||
| 916 | Ga0373933_0104547 | |||
| 917 | Ga0373947_0000225 | |||
| 918 | Ga0373947_0016095 | |||
| 919 | Ga0373947_0017149 | |||
| 920 | Ga0373947_0049426 | |||
| 921 | Ga0373947_0308707 | |||
| 922 | Ga0373947_0582453 | |||
| 923 | Ga0373937_0031934 | |||
| 924 | Ga0373937_0047796 | |||
| 925 | Ga0373937_0573972 | |||
| 926 | Ga0373925_0002349 | |||
| 927 | Ga0373925_0057968 | |||
| 928 | Ga0373925_0073670 | |||
| 929 | Ga0373925_0087810 | |||
| 930 | Ga0373925_0099699 | |||
| 931 | Ga0373925_0157193 | |||
| 932 | Ga0395898_0260182 | |||
| 933 | Ga0395898_0267852 | |||
| 934 | Ga0395905_0024997 | |||
| 935 | Ga0395905_0337620 | |||
| 936 | Ga0395901_0162853 | |||
| 937 | Ga0436365_0999519 | |||
| 938 | Ga0436360_0922892 | |||
| 939 | Ga0436361_0193135 | |||
| 940 | Ga0436363_1626812 | |||
| 941 | Ga0436362_0902649 | |||
| 942 | Ga0453683_0181180 | |||
| 943 | Ga0495592_0117412 | |||
| 944 | Ga0495603_0005289 | |||
| 945 | Ga0495603_0020067 | |||
| 946 | Ga0495603_0028694 | |||
| 947 | Ga0495590_0085013 | |||
| 948 | Ga0495638_0137508 | |||
| 949 | Ga0495641_0023927 | |||
| 950 | Ga0495653_0065254 | |||
| 951 | Ga0495580_0071274 | |||
| 952 | Ga0495580_0199964 | |||
| 953 | Ga0495580_0365977 | |||
| 954 | Ga0495580_0393542 | |||
| 955 | Ga0495582_0224243 | |||
| 956 | Ga0495605_0038449 | |||
| 957 | Ga0495605_0049542 | |||
| 958 | Ga0495605_0234224 | |||
| 959 | Ga0495639_0037065 | |||
| 960 | Ga0495662_0003937 | |||
| 961 | Ga0495662_0049468 | |||
| 962 | Ga0495662_0060195 | |||
| 963 | Ga0495664_0000553 | |||
| 964 | Ga0495664_0109969 | |||
| 965 | Ga0495664_0173142 | |||
| 966 | Ga0495664_0420343 | |||
| 967 | Ga0495584_0194725 | |||
| 968 | Ga0495584_0219885 | |||
| 969 | Ga0495585_0156942 | |||
| 970 | Ga0495594_0029927 | |||
| 971 | Ga0495594_0271317 | |||
| 972 | Ga0495606_0069257 | |||
| 973 | Ga0495608_0435731 | |||
| 974 | Ga0495618_0030956 | |||
| 975 | Ga0495618_0038815 | |||
| 976 | Ga0495618_0062623 | |||
| 977 | Ga0495618_0138129 | |||
| 978 | Ga0495630_0001809 | |||
| 979 | Ga0495630_0017957 | |||
| 980 | Ga0495630_0065405 | |||
| 981 | Ga0495630_0127932 | |||
| 982 | Ga0495630_0194403 | |||
| 983 | Ga0495630_0224296 | |||
| 984 | Ga0495648_0013972 | |||
| 985 | Ga0495648_0113455 | |||
| 986 | Ga0495663_0081704 | |||
| 987 | Ga0495666_0011739 | |||
| 988 | Ga0495666_0074524 | |||
| 989 | Ga0495652_0038212 | |||
| 990 | Ga0495652_0080501 | |||
| 991 | Ga0495665_0002591 | |||
| 992 | Ga0495665_0178540 | |||
| 993 | Ga0495640_0004271 | |||
| 994 | Ga0495640_0016119 | |||
| 995 | Ga0495640_0103019 | |||
| 996 | Ga0495640_0109912 | |||
| 997 | Ga0495640_0306146 | |||
| 998 | Ga0495586_0076648 | |||
| 999 | Ga0495609_0048268 | |||
| 1000 | Ga0495621_0014117 | |||
| 1001 | Ga0495621_0017959 | |||
| 1002 | Ga0495645_0043851 | |||
| 1003 | Ga0495622_0053599 | |||
| 1004 | Ga0495622_0110297 | |||
| 1005 | Ga0495633_0097688 | |||
| 1006 | Ga0495667_0436546 | |||
| 1007 | Ga0495656_0031594 | |||
| 1008 | Ga0495656_0109420 | |||
| 1009 | Ga0495656_0184073 | |||
| 1010 | Ga0495634_0053792 | |||
| 1011 | Ga0495634_0056977 | |||
| 1012 | Ga0495634_0079598 | |||
| 1013 | Ga0495611_0058894 | |||
| 1014 | Ga0495611_0136179 | |||
| 1015 | Ga0495625_0111007 | |||
| 1016 | Ga0495635_0012795 | |||
| 1017 | Ga0495635_0043871 | |||
| 1018 | Ga0495635_0200423 | |||
| 1019 | Ga0495588_0011436 | |||
| 1020 | Ga0495646_0141487 | |||
| 1021 | Ga0495647_0007035 | |||
| 1022 | Ga0495647_0044442 | |||
| 1023 | Ga0495658_0063679 | |||
| 1024 | Ga0495658_0214430 | |||
| 1025 | Ga0495669_0195386 | |||
| 1026 | Ga0495613_0010864 | |||
| 1027 | Ga0495613_0147326 | |||
| 1028 | Ga0495624_0001669 | |||
| 1029 | Ga0495670_0101398 | |||
| 1030 | Ga0495671_0079552 | |||
| 1031 | Ga0495671_0080318 | |||
| 1032 | Ga0495649_0217772 | |||
| 1033 | Ga0495649_0308375 | |||
| 1034 | Ga0495660_0140395 | |||
| 1035 | Ga0495581_0033022 | |||
| 1036 | Ga0495581_0038167 | |||
| 1037 | Ga0495581_0071682 | |||
| 1038 | Ga0495581_0088491 | |||
| 1039 | Ga0495581_0348810 | |||
| 1040 | Ga0495674_0022324 | |||
| 1041 | Ga0495674_0037999 | |||
| 1042 | Ga0495674_0300357 | |||
| 1043 | Ga0495676_0006465 | |||
| 1044 | Ga0495676_0084499 | |||
| 1045 | Ga0495676_0101873 | |||
| 1046 | Ga0495676_0197252 | |||
| 1047 | Ga0495680_0376460 | |||
| 1048 | Ga0495683_0134180 | |||
| 1049 | Ga0495685_024646 | |||
| 1050 | Ga0495684_0001394 | |||
| 1051 | Ga0495684_0001619 | |||
| 1052 | Ga0495684_0093288 | |||
| 1053 | Ga0495684_0247658 | |||
| 1054 | Ga0495593_0065657 | |||
| 1055 | Ga0495615_0006467 | |||
| 1056 | Ga0496100_0141203 | |||
| 1057 | Ga0496100_0171862 | |||
| 1058 | Ga0496100_0261847 | |||
| 1059 | Ga0496100_0274090 | |||
| 1060 | Ga0496102_0015465 | |||
| 1061 | Ga0496102_0168698 | |||
| 1062 | Ga0496102_0302150 | |||
| 1063 | Ga0496102_0393179 | |||
| 1064 | Ga0496102_0531373 | |||
| 1065 | Ga0496102_0551713 | |||
| 1066 | Ga0496102_0817255 | |||
| 1067 | Ga0496103_0020160 | |||
| 1068 | Ga0496103_0207093 | |||
| 1069 | Ga0496104_0000125 | |||
| 1070 | Ga0496104_0000284 | |||
| 1071 | Ga0496104_0000669 | |||
| 1072 | Ga0496104_0013454 | |||
| 1073 | Ga0496104_0043912 | |||
| 1074 | Ga0496104_0363200 | |||
| 1075 | Ga0496104_0564956 | |||
| 1076 | Ga0496105_0001756 | |||
| 1077 | Ga0496105_0029278 | |||
| 1078 | Ga0496105_0089709 | |||
| 1079 | Ga0496105_0259328 | |||
| 1080 | Ga0496106_0030978 | |||
| 1081 | Ga0496106_0055282 | |||
| 1082 | Ga0496106_0116921 | |||
| 1083 | Ga0496106_0148891 | |||
| 1084 | Ga0496107_0191914 | |||
| 1085 | Ga0496107_0295662 | |||
| 1086 | Ga0496107_0298807 | |||
| 1087 | Ga0496108_0000869 | |||
| 1088 | Ga0496108_0037611 | |||
| 1089 | Ga0496108_0101255 | |||
| 1090 | Ga0496109_0000537 | |||
| 1091 | Ga0496109_0001938 | |||
| 1092 | Ga0496109_0012274 | |||
| 1093 | Ga0496109_0054455 | |||
| 1094 | Ga0496109_0061619 | |||
| 1095 | Ga0496109_0106182 | |||
| 1096 | Ga0496109_0157109 | |||
| 1097 | Ga0496110_0001099 | |||
| 1098 | Ga0496110_0010615 | |||
| 1099 | Ga0496110_0027567 | |||
| 1100 | Ga0496110_0060949 | |||
| 1101 | Ga0496110_0232159 | |||
| 1102 | Ga0496110_0253633 | |||
| 1103 | Ga0496110_0492578 | |||
| 1104 | Ga0496110_0594639 | |||
| 1105 | Ga0496111_0012027 | |||
| 1106 | Ga0496111_0013338 | |||
| 1107 | Ga0496111_0017665 | |||
| 1108 | Ga0496111_0032208 | |||
| 1109 | Ga0496111_0106047 | |||
| 1110 | Ga0496111_0201670 | |||
| 1111 | Ga0496111_0402821 | |||
| 1112 | Ga0496112_0001765 | |||
| 1113 | Ga0496112_0002723 | |||
| 1114 | Ga0496112_0002865 | |||
| 1115 | Ga0496112_0005705 | |||
| 1116 | Ga0496112_0022193 | |||
| 1117 | Ga0496112_0250726 | |||
| 1118 | Ga0496113_0000616 | |||
| 1119 | Ga0496113_0013892 | |||
| 1120 | Ga0496113_0013976 | |||
| 1121 | Ga0496113_0074247 | |||
| 1122 | Ga0496113_0357050 | |||
| 1123 | Ga0496114_0092980 | |||
| 1124 | Ga0496114_0124642 | |||
| 1125 | Ga0496115_0018528 | |||
| 1126 | Ga0496115_0027299 | |||
| 1127 | Ga0496115_0250677 | |||
| 1128 | Ga0496121_0106445 | |||
| 1129 | Ga0496124_0022281 | |||
| 1130 | Ga0496125_0039579 | |||
| 1131 | nmdc:mga0yw44_33352_c1 | |||
| 1132 | nmdc:mga0yw44_39925_c1 | |||
| 1133 | nmdc:mga06z11_8864_c1 | |||
| 1134 | nmdc:mga05p37_1225660_c1 | |||
| 1135 | nmdc:mga05p37_132792_c1 | |||
| 1136 | nmdc:mga05p37_13638_c1 | |||
| 1137 | nmdc:mga05p37_19437_c1 | |||
| 1138 | nmdc:mga05p37_60071_c1 | |||
| 1139 | nmdc:mga09592_54902_c1 | |||
| 1140 | nmdc:mga0qj67_401446_c1 | |||
| 1141 | nmdc:mga0qj67_44958_c1 | |||
| 1142 | nmdc:mga06r32_148358_c1 | |||
| 1143 | nmdc:mga06r32_33628_c1 | |||
| 1144 | nmdc:mga06r32_455128_c1 | |||
| 1145 | nmdc:mga08y16_58506_c1 | |||
| 1146 | nmdc:mga0n895_157272_c1 | |||
| 1147 | nmdc:mga0n895_172862_c1 | |||
| 1148 | nmdc:mga0n895_239391_c1 | |||
| 1149 | nmdc:mga0n895_24032_c1 | |||
| 1150 | nmdc:mga0n895_289346_c1 | |||
| 1151 | nmdc:mga0n895_369561_c1 | |||
| 1152 | nmdc:mga0n895_539482_c1 | |||
| 1153 | nmdc:mga0rr50_306501_c1 | |||
| 1154 | nmdc:mga0rr50_371315_c1 | |||
| 1155 | nmdc:mga0rr50_77751_c1 | |||
| 1156 | nmdc:mga0a205_54072_c1 | |||
| 1157 | nmdc:mga0a205_583887_c1 | |||
| 1158 | Ga0495601_0007089 | |||
| 1159 | Ga0495601_0030308 | |||
| 1160 | Ga0495612_0002960 | |||
| 1161 | Ga0495655_0042635 | |||
| 1162 | Ga0495595_0161102 | |||
| 1163 | Ga0495619_0001919 | |||
| 1164 | Ga0495619_0068153 | |||
| 1165 | Ga0500595_014968 | |||
| 1166 | Ga0500658_0010930 | |||
| 1167 | Ga0500589_068617 | |||
| 1168 | Ga0500634_0142161 | |||
| 1169 | Ga0500637_0200588 | |||
| 1170 | 2513628354 | |||
| 1171 | 2513671497 | |||
| 1172 | 2524441714 | |||
| 1173 | 2524464803 | |||
| 1174 | 2745075022 | |||
| 1175 | 2824706172 | |||
| 1176 | 2824758702 | |||
| 1177 | 2824769018 | |||
| 1178 | 2847934988 | |||
| 1179 | 2876763810 | |||
| 1180 | 2876810764 | |||
| 1181 | 2879086382 | |||
| 1182 | 2879115972 | |||
| 1183 | 2881365493 | |||
| 1184 | 2885388484 | |||
| 1185 | 2903773327 | |||
| 1186 | 2904720195 | |||
| 1187 | 2922361238 | |||
| 1188 | 2935767980 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4b1m-assembly3.cif.gz_C | carbohydrate binding module cbm66 from bacillus subtilis | 0.8466 | 45 | 237 |
| 4b1m-assembly3.cif.gz_C | carbohydrate binding module cbm66 from bacillus subtilis | 0.8031 | 45 | 237 |
| 4ufm-assembly1.cif.gz_A | mouse galactocerebrosidase complexed with 1-deoxy-galacto-nojirimycin dgj | 0.7835 | 29 | 241 |
| 1ux6-assembly1.cif.gz_A | structure of a thrombospondin c-terminal fragment reveals a novel calcium core in the type 3 repeats | 0.7612 | 104 | 235 |
| 5nxb-assembly1.cif.gz_B | mouse galactocerebrosidase in complex with saposin a | 0.7559 | 29 | 241 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4b1mC00 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.8466 | 45 | 237 | 2.60.120.560 |
| af_A0A5K1K8Q0_451_608_2.60.120.560 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.8146 | 53 | 235 | 2.60.120.560 |
| 4b1mC00 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.8031 | 45 | 237 | 2.60.120.560 |
| af_Q58355_45_220_2.60.120.560 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.7903 | 30 | 235 | 2.60.120.560 |
| af_A0A5K1K8Q0_451_608_2.60.120.560 | Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 | 0.7814 | 53 | 235 | 2.60.120.560 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8QIQ4-F1-model_v4 | Uncharacterized protein | 0.9504 | 104 | 237 |
|
| AF-U2HC13-F1-model_v4 | 3-keto-disaccharide hydrolase domain-containing protein | 0.9451 | 27 | 239 |
|
| AF-A0A537T1R3-F1-model_v4 | DUF1080 domain-containing protein | 0.9428 | 28 | 241 |
|
| AF-A0A2R5EIK6-F1-model_v4 | 3-keto-disaccharide hydrolase domain-containing protein | 0.9298 | 24 | 241 |
GO:0016787
|
| AF-A0A432HQ77-F1-model_v4 | DUF1080 domain-containing protein | 0.9285 | 25 | 239 |
|