F467376

General Info

Members Datasets Scaffolds Average Seq Length
594 278 1188 240

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0221807|Ga0495672_0221807_37_888
Length 283
Sequence LPANKLLFLGSSSDFHSASSSPGGEADVYPNQLQHDREGGSAMKMIRYVRGIAASVLGFTSLVLPVAAEQPTKIDFSNETVGAEPKAIVPVVGIWRIESEGGKNVLAVDGRQWKEGQSSAGVADKARALYGERYAEFLDRVQAYAYYPYAVTKEVEDFRGGEITVRFEGLSGRIDQGAGILFNLKPNGDYLTLRANCLENNLVLWKFEKGRRSSVSWVRNAPAGTKQWHDLKVRVAGAKVEGYLDGKLYLQYTLPASVSGRIGLWSKADSYMHFSDYTVTSAN

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
127 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
128 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
129 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
130 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
167 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
170 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
173 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
178 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
181 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
187 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
188 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
195 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
219 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
220 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
221 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
232 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
236 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
256 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
257 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
258 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
259 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
260 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
261 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
262 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
263 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
264 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
265 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
266 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
267 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
268 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
269 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
270 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
271 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
272 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
273 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
274 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
275 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
276 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
277 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
278 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.8
Metatranscriptomes 0
Isolates 3.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 3.2
Rhizoplane 12.12
Rhizosphere 79.97
Stem 0
Stem Tuber 0
Unclassified 11.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0221807 3300047320 Bacteria 933
2 JGI25406J46586_10043718 3300003203 Bacteria 1557
3 JGI25406J46586_10062071 3300003203 Bacteria 1202
4 JGI25406J46586_10087195 3300003203 Bacteria 947
5 JGI25404J52841_10013128 3300003659 Bacteria 1797
6 JGI25404J52841_10023204 3300003659 Bacteria 1339
7 JGI25405J52794_10003598 3300003911 Plasmid 2728
8 Ga0070683_100075135 3300005329 Bacteria 3157
9 Ga0070682_100467668 3300005337 Bacteria 970
10 Ga0070689_100212929 3300005340 Bacteria 1582
11 Ga0070661_100284738 3300005344 Bacteria 1283
12 Ga0070692_10188531 3300005345 Bacteria 1200
13 Ga0070668_100012647 3300005347 Bacteria 6282
14 Ga0070668_100039864 3300005347 Bacteria 3592
15 Ga0070671_100037745 3300005355 Bacteria 4007
16 Ga0070673_100070693 3300005364 Bacteria 2802
17 Ga0070667_100099333 3300005367 Bacteria 2512
18 Ga0070709_10082782 3300005434 Bacteria 2098
19 Ga0070709_10087689 3300005434 Unclassified 2045
20 Ga0070714_100101999 3300005435 Bacteria 2529
21 Ga0070714_100177339 3300005435 Bacteria 1937
22 Ga0070714_100303107 3300005435 Bacteria 1490
23 Ga0070713_100134991 3300005436 Bacteria 2180
24 Ga0070713_100566434 3300005436 Bacteria 1077
25 Ga0070710_10044260 3300005437 Unclassified 2469
26 Ga0070710_10070692 3300005437 Bacteria 2011
27 Ga0070710_10150112 3300005437 Bacteria 1437
28 Ga0070710_10255691 3300005437 Bacteria 1128
29 Ga0070710_10287067 3300005437 Bacteria 1070
30 Ga0070711_100062040 3300005439 Bacteria 2604
31 Ga0070711_100072248 3300005439 Bacteria 2433
32 Ga0070711_100117103 3300005439 Bacteria 1964
33 Ga0070711_100117545 3300005439 Bacteria 1961
34 Ga0070711_100162059 3300005439 Unclassified 1696
35 Ga0070711_100169912 3300005439 Bacteria 1661
36 Ga0070711_100382288 3300005439 Unclassified 1139
37 Ga0070711_100566887 3300005439 Bacteria 944
38 Ga0070700_100255513 3300005441 Unclassified 1259
39 Ga0070708_100210768 3300005445 Bacteria 1820
40 Ga0070708_100585485 3300005445 Bacteria 1052
41 Ga0070663_100311296 3300005455 Unclassified 1263
42 Ga0070662_100186129 3300005457 Bacteria 1639
43 Ga0070681_10277343 3300005458 Bacteria 1587
44 Ga0070706_100028406 3300005467 Bacteria 5149
45 Ga0070706_100264550 3300005467 Bacteria 1605
46 Ga0070707_100086724 3300005468 Bacteria 3027
47 Ga0070698_100069744 3300005471 Bacteria 3528
48 Ga0070698_100121168 3300005471 Bacteria 2576
49 Ga0070699_100008545 3300005518 Bacteria 8873
50 Ga0070684_100011674 3300005535 Bacteria 7005
51 Ga0070697_100096214 3300005536 Bacteria 2456
52 Ga0070696_100139020 3300005546 Bacteria 1773
53 Ga0070665_100007736 3300005548 Bacteria 10909
54 Ga0070665_100271470 3300005548 Unclassified 1698
55 Ga0070704_100350076 3300005549 Unclassified 1247
56 Ga0068857_100071786 3300005577 Bacteria 3085
57 Ga0068856_100196750 3300005614 Bacteria 2030
58 Ga0070702_100214746 3300005615 Bacteria 1283
59 Ga0068864_100279546 3300005618 Unclassified 1558
60 Ga0068864_100359492 3300005618 Bacteria 1376
61 Ga0068866_10186946 3300005718 Bacteria 1228
62 Ga0068861_100011838 3300005719 Bacteria 6072
63 Ga0068863_100086690 3300005841 Bacteria 2967
64 Ga0068863_100431455 3300005841 Bacteria 1292
65 Ga0081455_10001307 3300005937 Bacteria 30905
66 Ga0081455_10002863 3300005937 Bacteria 20325
67 Ga0081455_10036867 3300005937 Bacteria 4348
68 Ga0081455_10362453 3300005937 Bacteria 1019
69 Ga0081540_1000397 3300005983 Bacteria 43084
70 Ga0081540_1006400 3300005983 Bacteria 8583
71 Ga0081540_1006853 3300005983 Bacteria 8224
72 Ga0081540_1010207 3300005983 Bacteria 6379
73 Ga0081540_1013288 3300005983 Bacteria 5360
74 Ga0081540_1023998 3300005983 Bacteria 3549
75 Ga0081540_1024451 3300005983 Bacteria 3505
76 Ga0081540_1028018 3300005983 Bacteria 3175
77 Ga0081540_1028641 3300005983 Bacteria 3122
78 Ga0081540_1038197 3300005983 Bacteria 2534
79 Ga0081540_1041477 3300005983 Bacteria 2385
80 Ga0081540_1043446 3300005983 Bacteria 2305
81 Ga0081540_1047944 3300005983 Bacteria 2144
82 Ga0081540_1050292 3300005983 Bacteria 2071
83 Ga0081540_1069369 3300005983 Bacteria 1639
84 Ga0081540_1095627 3300005983 Bacteria 1294
85 Ga0081539_10002257 3300005985 Bacteria 28023
86 Ga0081539_10032436 3300005985 Bacteria 3199
87 Ga0081539_10036033 3300005985 Bacteria 2966
88 Ga0081539_10045099 3300005985 Unclassified 2539
89 Ga0081539_10164450 3300005985 Bacteria 1055
90 Ga0070717_10029588 3300006028 Bacteria 4394
91 Ga0070717_10113751 3300006028 Bacteria 2311
92 Ga0070717_10135207 3300006028 Bacteria 2123
93 Ga0070717_10197856 3300006028 Unclassified 1759
94 Ga0070717_10418143 3300006028 Bacteria 1206
95 Ga0075365_10019536 3300006038 Bacteria 4184
96 Ga0075365_10026743 3300006038 Bacteria 3666
97 Ga0075365_10316217 3300006038 Bacteria 1099
98 Ga0075432_10009289 3300006058 Bacteria 3348
99 Ga0075432_10044809 3300006058 Bacteria 1551
100 Ga0070715_10016056 3300006163 Bacteria 2805
101 Ga0070715_10066791 3300006163 Unclassified 1595
102 Ga0070715_10076823 3300006163 Bacteria 1506
103 Ga0070715_10120034 3300006163 Bacteria 1252
104 Ga0070716_100089878 3300006173 Bacteria 1856
105 Ga0070716_100155600 3300006173 Unclassified 1475
106 Ga0070716_100176282 3300006173 Bacteria 1399
107 Ga0070712_100016436 3300006175 Bacteria 4780
108 Ga0070712_100033575 3300006175 Bacteria 3473
109 Ga0070712_100045144 3300006175 Bacteria 3041
110 Ga0070712_100130540 3300006175 Bacteria 1903
111 Ga0070712_100132592 3300006175 Bacteria 1890
112 Ga0070712_100174531 3300006175 Unclassified 1670
113 Ga0070712_100657551 3300006175 Bacteria 891
114 Ga0075427_10000548 3300006194 Unclassified 4345
115 Ga0097621_100475075 3300006237 Bacteria 1129
116 Ga0068871_100057418 3300006358 Bacteria 3166
117 Ga0075428_100012679 3300006844 Bacteria 9373
118 Ga0075428_100043882 3300006844 Bacteria 4915
119 Ga0075428_100418145 3300006844 Unclassified 1436
120 Ga0075428_100692482 3300006844 Unclassified 1086
121 Ga0075428_100889565 3300006844 Bacteria 945
122 Ga0075430_100007070 3300006846 Bacteria 9463
123 Ga0075430_100115462 3300006846 Bacteria 2237
124 Ga0075430_100119086 3300006846 Bacteria 2201
125 Ga0075431_100005987 3300006847 Bacteria 12049
126 Ga0075431_100021184 3300006847 Bacteria 6643
127 Ga0075431_100165683 3300006847 Unclassified 2272
128 Ga0075433_10066918 3300006852 Bacteria 3153
129 Ga0075433_10069679 3300006852 Unclassified 3089
130 Ga0075434_100133923 3300006871 Bacteria 2498
131 Ga0075434_100169864 3300006871 Bacteria 2201
132 Ga0075434_100182617 3300006871 Unclassified 2118
133 Ga0075434_100237193 3300006871 Bacteria 1844
134 Ga0075434_100632247 3300006871 Unclassified 1089
135 Ga0075429_100009244 3300006880 Bacteria 8555
136 Ga0075429_100031987 3300006880 Bacteria 4574
137 Ga0075436_100465316 3300006914 Unclassified 922
138 Ga0099825_1029095 3300006941 Bacteria 2607
139 Ga0099824_1016795 3300006942 Bacteria 6537
140 Ga0075435_100154253 3300007076 Bacteria 1932
141 Ga0075435_100214384 3300007076 Unclassified 1634
142 Ga0075435_100227149 3300007076 Bacteria 1586
143 Ga0099794_10002357 3300007265 Bacteria 6954
144 Ga0099794_10012914 3300007265 Bacteria 3622
145 Ga0099794_10032758 3300007265 Bacteria 2441
146 Ga0099794_10261864 3300007265 Bacteria 893
147 Ga0099795_10004704 3300007788 Bacteria 3553
148 Ga0099795_10006018 3300007788 Bacteria 3276
149 Ga0099795_10015015 3300007788 Bacteria 2415
150 Ga0099795_10022067 3300007788 Bacteria 2097
151 Ga0099795_10037347 3300007788 Bacteria 1709
152 Ga0105240_10482882 3300009093 Bacteria 1381
153 Ga0111539_10074870 3300009094 Bacteria 3989
154 Ga0111539_10184047 3300009094 Bacteria 2440
155 Ga0111539_10263631 3300009094 Bacteria 2006
156 Ga0111539_10529744 3300009094 Bacteria 1372
157 Ga0111539_11345053 3300009094 Unclassified 829
158 Ga0105245_10366144 3300009098 Bacteria 1432
159 Ga0105247_10358366 3300009101 Unclassified 1028
160 Ga0114129_10007454 3300009147 Bacteria 15584
161 Ga0114129_10015432 3300009147 Bacteria 10866
162 Ga0114129_10019770 3300009147 Bacteria 9586
163 Ga0114129_10107515 3300009147 Bacteria 3852
164 Ga0114129_10213700 3300009147 Bacteria 2606
165 Ga0114129_10234919 3300009147 Bacteria 2467
166 Ga0114129_11607431 3300009147 Bacteria 796
167 Ga0105243_10082322 3300009148 Bacteria 2630
168 Ga0105243_10362303 3300009148 Unclassified 1335
169 Ga0105243_10806963 3300009148 Bacteria 925
170 Ga0105242_10291943 3300009176 Bacteria 1485
171 Ga0105248_10230454 3300009177 Bacteria 2085
172 Ga0105237_10068117 3300009545 Bacteria 3553
173 Ga0105237_10280558 3300009545 Bacteria 1668
174 Ga0105238_10037471 3300009551 Bacteria 4930
175 Ga0105249_10067728 3300009553 Bacteria 3290
176 Ga0105249_10228639 3300009553 Bacteria 1834
177 Ga0105249_10578114 3300009553 Bacteria 1176
178 Ga0099796_10009373 3300010159 Bacteria 2648
179 Ga0099796_10012632 3300010159 Unclassified 2390
180 Ga0099796_10020962 3300010159 Bacteria 2005
181 Ga0099796_10053212 3300010159 Bacteria 1412
182 Ga0105239_10233345 3300010375 Bacteria 2065
183 Ga0105239_10283517 3300010375 Bacteria 1865
184 Ga0105239_10589793 3300010375 Bacteria 1267
185 Ga0105246_10216999 3300011119 Bacteria 1497
186 Ga0157374_10278766 3300013296 Bacteria 1650
187 Ga0163162_10693185 3300013306 Bacteria 1140
188 Ga0157375_10344811 3300013308 Bacteria 1655
189 Ga0163163_10155611 3300014325 Bacteria 2330
190 Ga0163163_10194488 3300014325 Bacteria 2076
191 Ga0163163_10466465 3300014325 Bacteria 1323
192 Ga0157377_10068556 3300014745 Bacteria 2044
193 Ga0157379_10017434 3300014968 Bacteria 6323
194 Ga0157379_10096442 3300014968 Bacteria 2654
195 Ga0157376_10034227 3300014969 Bacteria 4101
196 Ga0157376_10105812 3300014969 Bacteria 2467
197 Ga0157376_10361955 3300014969 Bacteria 1391
198 Ga0207692_10010085 3300025898 Bacteria 3968
199 Ga0207692_10033350 3300025898 Bacteria 2483
200 Ga0207692_10079209 3300025898 Bacteria 1752
201 Ga0207692_10080124 3300025898 Bacteria 1744
202 Ga0207692_10165677 3300025898 Bacteria 1277
203 Ga0207710_10004063 3300025900 Bacteria 6435
204 Ga0207688_10001335 3300025901 Bacteria 12832
205 Ga0207680_10356080 3300025903 Bacteria 1029
206 Ga0207647_10056681 3300025904 Bacteria 2404
207 Ga0207685_10029722 3300025905 Bacteria 1938
208 Ga0207685_10032653 3300025905 Bacteria 1874
209 Ga0207685_10158972 3300025905 Unclassified 1030
210 Ga0207699_10046846 3300025906 Plasmid 2532
211 Ga0207699_10065616 3300025906 Bacteria 2201
212 Ga0207699_10203222 3300025906 Bacteria 1344
213 Ga0207645_10025861 3300025907 Bacteria 3796
214 Ga0207643_10008495 3300025908 Bacteria 5507
215 Ga0207684_10061745 3300025910 Bacteria 3182
216 Ga0207684_10087454 3300025910 Bacteria 2655
217 Ga0207684_10100159 3300025910 Bacteria 2476
218 Ga0207684_10399092 3300025910 Bacteria 1182
219 Ga0207707_10235244 3300025912 Bacteria 1594
220 Ga0207671_10172543 3300025914 Bacteria 1680
221 Ga0207693_10014179 3300025915 Bacteria 6416
222 Ga0207693_10034737 3300025915 Bacteria 3977
223 Ga0207693_10058686 3300025915 Bacteria 3015
224 Ga0207693_10156901 3300025915 Bacteria 1790
225 Ga0207693_10220648 3300025915 Bacteria 1490
226 Ga0207693_10226407 3300025915 Unclassified 1469
227 Ga0207663_10032179 3300025916 Bacteria 3111
228 Ga0207663_10035946 3300025916 Bacteria 2976
229 Ga0207663_10288326 3300025916 Bacteria 1222
230 Ga0207660_10700202 3300025917 Bacteria 826
231 Ga0207662_10009040 3300025918 Bacteria 5473
232 Ga0207649_10183385 3300025920 Bacteria 1466
233 Ga0207646_10336136 3300025922 Unclassified 1364
234 Ga0207694_10054764 3300025924 Bacteria 3095
235 Ga0207650_10007900 3300025925 Bacteria 7249
236 Ga0207687_10247930 3300025927 Bacteria 1414
237 Ga0207700_10024183 3300025928 Bacteria 4200
238 Ga0207700_10067633 3300025928 Bacteria 2736
239 Ga0207700_10209611 3300025928 Bacteria 1647
240 Ga0207664_10151238 3300025929 Bacteria 1972
241 Ga0207664_10225996 3300025929 Bacteria 1625
242 Ga0207664_10344084 3300025929 Bacteria 1319
243 Ga0207706_10303281 3300025933 Bacteria 1391
244 Ga0207706_10529441 3300025933 Bacteria 1016
245 Ga0207709_10128804 3300025935 Bacteria 1721
246 Ga0207665_10049435 3300025939 Bacteria 2825
247 Ga0207665_10053045 3300025939 Bacteria 2732
248 Ga0207665_10054933 3300025939 Bacteria 2686
249 Ga0207665_10350172 3300025939 Bacteria 1115
250 Ga0207691_10047002 3300025940 Bacteria 3963
251 Ga0207711_10890746 3300025941 Bacteria 827
252 Ga0207689_10040112 3300025942 Bacteria 3876
253 Ga0207661_10005022 3300025944 Bacteria 9276
254 Ga0207661_10010196 3300025944 Bacteria 6756
255 Ga0207661_10381336 3300025944 Bacteria 1276
256 Ga0207712_10089307 3300025961 Bacteria 2265
257 Ga0207712_10133367 3300025961 Bacteria 1896
258 Ga0207712_10188451 3300025961 Bacteria 1626
259 Ga0207712_10817285 3300025961 Bacteria 820
260 Ga0207668_10005233 3300025972 Bacteria 7633
261 Ga0207658_10007886 3300025986 Bacteria 7251
262 Ga0207703_10048097 3300026035 Bacteria 3441
263 Ga0207678_10098772 3300026067 Bacteria 2494
264 Ga0207702_10597415 3300026078 Bacteria 1083
265 Ga0207641_10358136 3300026088 Bacteria 1392
266 Ga0207648_10181552 3300026089 Bacteria 1863
267 Ga0207676_10345179 3300026095 Unclassified 1375
268 Ga0207676_10660821 3300026095 Bacteria 1009
269 Ga0207674_10024320 3300026116 Bacteria 6476
270 Ga0207674_10364783 3300026116 Bacteria 1396
271 Ga0207674_10807944 3300026116 Bacteria 905
272 Ga0207675_100048385 3300026118 Bacteria 3969
273 Ga0209389_1000094 3300027296 Bacteria 80555
274 Ga0209389_1000235 3300027296 Bacteria 36612
275 Ga0209589_1000007 3300027357 Bacteria 425699
276 Ga0209589_1001753 3300027357 Bacteria 36436
277 Ga0209489_100008 3300027361 Bacteria 425699
278 Ga0209489_100597 3300027361 Bacteria 69726
279 Ga0209489_105972 3300027361 Bacteria 20211
280 Ga0209700_100009 3300027363 Bacteria 425699
281 Ga0209700_100374 3300027363 Bacteria 81273
282 Ga0209179_1013902 3300027512 Bacteria 1470
283 Ga0209588_1003105 3300027671 Unclassified 4579
284 Ga0209588_1009480 3300027671 Bacteria 2911
285 Ga0209588_1056467 3300027671 Bacteria 1269
286 Ga0209588_1131571 3300027671 Unclassified 798
287 Ga0207428_10004480 3300027907 Bacteria 13247
288 Ga0207428_10105099 3300027907 Bacteria 2178
289 Ga0268266_10000914 3300028379 Bacteria 37986
290 Ga0268265_10020884 3300028380 Bacteria 4577
291 Ga0307508_10106408 3300031616 Bacteria 2403
292 Ga0307416_100112395 3300032002 Unclassified 2404
293 Ga0307416_100225416 3300032002 Bacteria 1802
294 Ga0307411_10031829 3300032005 Plasmid 3251
295 Ga0373938_0069095 3300034957 Bacteria 841
296 Ga0373926_0046235 3300035083 Bacteria 1562
297 Ga0373944_0003203 3300035089 Bacteria 4206
298 Ga0373944_0013545 3300035089 Unclassified 2264
299 Ga0373923_0144232 3300035111 Bacteria 1078
300 Ga0373936_0217915 3300035113 Bacteria 846
301 Ga0373945_0003444 3300035116 Bacteria 4976
302 Ga0373954_0176545 3300035118 Bacteria 1047
303 Ga0373943_0000094 3300035170 Bacteria 32911
304 Ga0373943_0271064 3300035170 Bacteria 957
305 Ga0373943_0271953 3300035170 Bacteria 956
306 Ga0373946_0000421 3300035171 Bacteria 13804
307 Ga0373946_0035408 3300035171 Bacteria 2020
308 Ga0373946_0036794 3300035171 Bacteria 1987
309 Ga0373955_0176587 3300035172 Bacteria 1266
310 Ga0373924_0011887 3300035410 Bacteria 3242
311 Ga0373931_0024441 3300035691 Bacteria 3061
312 Ga0373935_0000839 3300035692 Bacteria 16556
313 Ga0373935_0004453 3300035692 Bacteria 8225
314 Ga0373935_0131156 3300035692 Bacteria 1684
315 Ga0373935_0508777 3300035692 Bacteria 875
316 Ga0373927_0004203 3300035695 Bacteria 10115
317 Ga0373927_0052929 3300035695 Bacteria 2625
318 Ga0373927_0055861 3300035695 Bacteria 2552
319 Ga0373927_0093990 3300035695 Unclassified 1948
320 Ga0373927_0335683 3300035695 Bacteria 995
321 Ga0373927_0406288 3300035695 Bacteria 898
322 Ga0373933_0104547 3300035724 Unclassified 1760
323 Ga0373947_0000225 3300035725 Bacteria 31624
324 Ga0373947_0016095 3300035725 Unclassified 4297
325 Ga0373947_0017149 3300035725 Bacteria 4164
326 Ga0373947_0049426 3300035725 Bacteria 2526
327 Ga0373947_0308707 3300035725 Bacteria 1056
328 Ga0373947_0582453 3300035725 Bacteria 762
329 Ga0373937_0031934 3300036401 Bacteria 4774
330 Ga0373937_0047796 3300036401 Bacteria 3916
331 Ga0373937_0573972 3300036401 Unclassified 1071
332 Ga0373925_0002349 3300037068 Bacteria 15193
333 Ga0373925_0057968 3300037068 Bacteria 2903
334 Ga0373925_0073670 3300037068 Unclassified 2585
335 Ga0373925_0087810 3300037068 Bacteria 2374
336 Ga0373925_0099699 3300037068 Unclassified 2231
337 Ga0373925_0157193 3300037068 Bacteria 1789
338 Ga0395898_0260182 3300037466 Bacteria 1655
339 Ga0395898_0267852 3300037466 Unclassified 1629
340 Ga0395905_0024997 3300037471 Bacteria 5634
341 Ga0395905_0337620 3300037471 Bacteria 1398
342 Ga0395901_0162853 3300038443 Bacteria 2342
343 Ga0436365_0999519 3300039437 Bacteria 1042
344 Ga0436360_0922892 3300039438 Bacteria 1273
345 Ga0436361_0193135 3300039447 Bacteria 1422
346 Ga0436363_1626812 3300039450 Unclassified 2817
347 Ga0436362_0902649 3300039453 Bacteria 991
348 Ga0453683_0181180 3300044673 Bacteria 1336
349 Ga0495592_0117412 3300046454 Bacteria 1876
350 Ga0495603_0005289 3300046455 Bacteria 7695
351 Ga0495603_0020067 3300046455 Bacteria 4050
352 Ga0495603_0028694 3300046455 Bacteria 3357
353 Ga0495590_0085013 3300046457 Bacteria 1116
354 Ga0495638_0137508 3300046460 Bacteria 1429
355 Ga0495641_0023927 3300046461 Bacteria 3025
356 Ga0495653_0065254 3300046463 Bacteria 2741
357 Ga0495580_0071274 3300046472 Unclassified 2427
358 Ga0495580_0199964 3300046472 Bacteria 1377
359 Ga0495580_0365977 3300046472 Bacteria 975
360 Ga0495580_0393542 3300046472 Bacteria 935
361 Ga0495582_0224243 3300046473 Bacteria 1076
362 Ga0495605_0038449 3300046474 Bacteria 2400
363 Ga0495605_0049542 3300046474 Bacteria 2052
364 Ga0495605_0234224 3300046474 Bacteria 790
365 Ga0495639_0037065 3300046475 Unclassified 2186
366 Ga0495662_0003937 3300046476 Bacteria 7492
367 Ga0495662_0049468 3300046476 Bacteria 2029
368 Ga0495662_0060195 3300046476 Bacteria 1834
369 Ga0495664_0000553 3300046477 Bacteria 18839
370 Ga0495664_0109969 3300046477 Bacteria 1663
371 Ga0495664_0173142 3300046477 Bacteria 1309
372 Ga0495664_0420343 3300046477 Unclassified 802
373 Ga0495584_0194725 3300046491 Bacteria 1030
374 Ga0495584_0219885 3300046491 Bacteria 965
375 Ga0495585_0156942 3300046492 Bacteria 1183
376 Ga0495594_0029927 3300046499 Bacteria 2944
377 Ga0495594_0271317 3300046499 Bacteria 966
378 Ga0495606_0069257 3300046507 Bacteria 2229
379 Ga0495608_0435731 3300046511 Unclassified 799
380 Ga0495618_0030956 3300046514 Plasmid 3345
381 Ga0495618_0038815 3300046514 Bacteria 2993
382 Ga0495618_0062623 3300046514 Bacteria 2361
383 Ga0495618_0138129 3300046514 Bacteria 1559
384 Ga0495630_0001809 3300046517 Bacteria 14917
385 Ga0495630_0017957 3300046517 Bacteria 5190
386 Ga0495630_0065405 3300046517 Bacteria 2733
387 Ga0495630_0127932 3300046517 Bacteria 1928
388 Ga0495630_0194403 3300046517 Bacteria 1548
389 Ga0495630_0224296 3300046517 Bacteria 1435
390 Ga0495648_0013972 3300046524 Bacteria 5906
391 Ga0495648_0113455 3300046524 Bacteria 1470
392 Ga0495663_0081704 3300046525 Bacteria 1042
393 Ga0495666_0011739 3300046526 Plasmid 4367
394 Ga0495666_0074524 3300046526 Bacteria 1610
395 Ga0495652_0038212 3300046529 Bacteria 4160
396 Ga0495652_0080501 3300046529 Bacteria 2690
397 Ga0495665_0002591 3300046531 Bacteria 9760
398 Ga0495665_0178540 3300046531 Bacteria 1104
399 Ga0495640_0004271 3300046533 Bacteria 11421
400 Ga0495640_0016119 3300046533 Bacteria 5595
401 Ga0495640_0103019 3300046533 Bacteria 1872
402 Ga0495640_0109912 3300046533 Bacteria 1802
403 Ga0495640_0306146 3300046533 Bacteria 986
404 Ga0495586_0076648 3300046535 Unclassified 1832
405 Ga0495609_0048268 3300046538 Bacteria 1903
406 Ga0495621_0014117 3300046539 Bacteria 2522
407 Ga0495621_0017959 3300046539 Bacteria 2293
408 Ga0495645_0043851 3300046543 Unclassified 3263
409 Ga0495622_0053599 3300046557 Bacteria 1872
410 Ga0495622_0110297 3300046557 Bacteria 1260
411 Ga0495633_0097688 3300046558 Bacteria 1364
412 Ga0495667_0436546 3300046559 Bacteria 823
413 Ga0495656_0031594 3300046615 Bacteria 2149
414 Ga0495656_0109420 3300046615 Bacteria 1290
415 Ga0495656_0184073 3300046615 Bacteria 1028
416 Ga0495634_0053792 3300046642 Plasmid 2695
417 Ga0495634_0056977 3300046642 Unclassified 2609
418 Ga0495634_0079598 3300046642 Unclassified 2145
419 Ga0495611_0058894 3300046648 Bacteria 1743
420 Ga0495611_0136179 3300046648 Bacteria 1147
421 Ga0495625_0111007 3300046660 Bacteria 1874
422 Ga0495635_0012795 3300046663 Bacteria 5877
423 Ga0495635_0043871 3300046663 Unclassified 3085
424 Ga0495635_0200423 3300046663 Bacteria 1354
425 Ga0495588_0011436 3300046674 Bacteria 4166
426 Ga0495646_0141487 3300046680 Bacteria 1345
427 Ga0495647_0007035 3300046681 Bacteria 3751
428 Ga0495647_0044442 3300046681 Bacteria 1704
429 Ga0495658_0063679 3300046683 Bacteria 2122
430 Ga0495658_0214430 3300046683 Unclassified 1204
431 Ga0495669_0195386 3300046684 Bacteria 966
432 Ga0495613_0010864 3300046689 Bacteria 6756
433 Ga0495613_0147326 3300046689 Bacteria 1680
434 Ga0495624_0001669 3300046690 Bacteria 17009
435 Ga0495670_0101398 3300046691 Bacteria 1483
436 Ga0495671_0079552 3300046692 Bacteria 1607
437 Ga0495671_0080318 3300046692 Bacteria 1598
438 Ga0495649_0217772 3300046694 Bacteria 988
439 Ga0495649_0308375 3300046694 Bacteria 805
440 Ga0495660_0140395 3300046810 Bacteria 1203
441 Ga0495581_0033022 3300047315 Plasmid 2996
442 Ga0495581_0038167 3300047315 Bacteria 2780
443 Ga0495581_0071682 3300047315 Bacteria 2005
444 Ga0495581_0088491 3300047315 Bacteria 1796
445 Ga0495581_0348810 3300047315 Unclassified 864
446 Ga0495674_0022324 3300047319 Bacteria 5837
447 Ga0495674_0037999 3300047319 Unclassified 4324
448 Ga0495674_0300357 3300047319 Unclassified 1311
449 Ga0495676_0006465 3300047321 Bacteria 10800
450 Ga0495676_0084499 3300047321 Bacteria 2395
451 Ga0495676_0101873 3300047321 Bacteria 2123
452 Ga0495676_0197252 3300047321 Bacteria 1400
453 Ga0495680_0376460 3300047322 Bacteria 984
454 Ga0495683_0134180 3300047323 Bacteria 1165
455 Ga0495685_024646 3300047447 Bacteria 2071
456 Ga0495684_0001394 3300047471 Bacteria 19398
457 Ga0495684_0001619 3300047471 Bacteria 18049
458 Ga0495684_0093288 3300047471 Bacteria 2280
459 Ga0495684_0247658 3300047471 Bacteria 1297
460 Ga0495593_0065657 3300047673 Unclassified 1892
461 Ga0495615_0006467 3300048090 Bacteria 2173
462 Ga0496100_0141203 3300048903 Bacteria 1707
463 Ga0496100_0171862 3300048903 Bacteria 1561
464 Ga0496100_0261847 3300048903 Bacteria 1283
465 Ga0496100_0274090 3300048903 Bacteria 1255
466 Ga0496102_0015465 3300048905 Bacteria 6647
467 Ga0496102_0168698 3300048905 Bacteria 2060
468 Ga0496102_0302150 3300048905 Bacteria 1508
469 Ga0496102_0393179 3300048905 Bacteria 1304
470 Ga0496102_0531373 3300048905 Bacteria 1099
471 Ga0496102_0551713 3300048905 Bacteria 1075
472 Ga0496102_0817255 3300048905 Bacteria 854
473 Ga0496103_0020160 3300048906 Bacteria 4003
474 Ga0496103_0207093 3300048906 Bacteria 1261
475 Ga0496104_0000125 3300048907 Bacteria 71005
476 Ga0496104_0000284 3300048907 Bacteria 44754
477 Ga0496104_0000669 3300048907 Bacteria 29403
478 Ga0496104_0013454 3300048907 Bacteria 7372
479 Ga0496104_0043912 3300048907 Bacteria 4199
480 Ga0496104_0363200 3300048907 Unclassified 1360
481 Ga0496104_0564956 3300048907 Bacteria 1048
482 Ga0496105_0001756 3300048908 Bacteria 15507
483 Ga0496105_0029278 3300048908 Bacteria 4507
484 Ga0496105_0089709 3300048908 Bacteria 2540
485 Ga0496105_0259328 3300048908 Unclassified 1406
486 Ga0496106_0030978 3300048909 Bacteria 3987
487 Ga0496106_0055282 3300048909 Bacteria 3000
488 Ga0496106_0116921 3300048909 Unclassified 2080
489 Ga0496106_0148891 3300048909 Bacteria 1845
490 Ga0496107_0191914 3300048910 Bacteria 1518
491 Ga0496107_0295662 3300048910 Bacteria 1205
492 Ga0496107_0298807 3300048910 Bacteria 1198
493 Ga0496108_0000869 3300048911 Bacteria 23545
494 Ga0496108_0037611 3300048911 Bacteria 4032
495 Ga0496108_0101255 3300048911 Bacteria 2458
496 Ga0496109_0000537 3300048912 Bacteria 32125
497 Ga0496109_0001938 3300048912 Bacteria 17205
498 Ga0496109_0012274 3300048912 Bacteria 7396
499 Ga0496109_0054455 3300048912 Bacteria 3649
500 Ga0496109_0061619 3300048912 Bacteria 3430
501 Ga0496109_0106182 3300048912 Bacteria 2608
502 Ga0496109_0157109 3300048912 Bacteria 2130
503 Ga0496110_0001099 3300048913 Bacteria 19068
504 Ga0496110_0010615 3300048913 Bacteria 7498
505 Ga0496110_0027567 3300048913 Bacteria 4870
506 Ga0496110_0060949 3300048913 Bacteria 3328
507 Ga0496110_0232159 3300048913 Bacteria 1678
508 Ga0496110_0253633 3300048913 Bacteria 1601
509 Ga0496110_0492578 3300048913 Bacteria 1116
510 Ga0496110_0594639 3300048913 Bacteria 1004
511 Ga0496111_0012027 3300048914 Bacteria 5850
512 Ga0496111_0013338 3300048914 Bacteria 5589
513 Ga0496111_0017665 3300048914 Bacteria 4932
514 Ga0496111_0032208 3300048914 Bacteria 3737
515 Ga0496111_0106047 3300048914 Bacteria 2068
516 Ga0496111_0201670 3300048914 Bacteria 1479
517 Ga0496111_0402821 3300048914 Bacteria 1011
518 Ga0496112_0001765 3300048915 Bacteria 16964
519 Ga0496112_0002723 3300048915 Bacteria 14308
520 Ga0496112_0002865 3300048915 Bacteria 14019
521 Ga0496112_0005705 3300048915 Bacteria 10814
522 Ga0496112_0022193 3300048915 Bacteria 6050
523 Ga0496112_0250726 3300048915 Unclassified 1721
524 Ga0496113_0000616 3300048916 Bacteria 17846
525 Ga0496113_0013892 3300048916 Bacteria 5473
526 Ga0496113_0013976 3300048916 Bacteria 5462
527 Ga0496113_0074247 3300048916 Bacteria 2592
528 Ga0496113_0357050 3300048916 Unclassified 1172
529 Ga0496114_0092980 3300048917 Bacteria 2563
530 Ga0496114_0124642 3300048917 Bacteria 2219
531 Ga0496115_0018528 3300048918 Bacteria 5348
532 Ga0496115_0027299 3300048918 Bacteria 4464
533 Ga0496115_0250677 3300048918 Bacteria 1458
534 Ga0496121_0106445 3300048924 Bacteria 2150
535 Ga0496124_0022281 3300048927 Bacteria 5812
536 Ga0496125_0039579 3300048928 Bacteria 4056
537 nmdc:mga0yw44_33352_c1 3300050492 Bacteria 3008
538 nmdc:mga0yw44_39925_c1 3300050492 Bacteria 2785
539 nmdc:mga06z11_8864_c1 3300050494 Bacteria 4215
540 nmdc:mga05p37_1225660_c1 3300050507 Unclassified 772
541 nmdc:mga05p37_132792_c1 3300050507 Unclassified 3054
542 nmdc:mga05p37_13638_c1 3300050507 Bacteria 9739
543 nmdc:mga05p37_19437_c1 3300050507 Bacteria 8218
544 nmdc:mga05p37_60071_c1 3300050507 Bacteria 4681
545 nmdc:mga09592_54902_c1 3300050508 Bacteria 3366
546 nmdc:mga0qj67_401446_c1 3300050509 Unclassified 1106
547 nmdc:mga0qj67_44958_c1 3300050509 Bacteria 3483
548 nmdc:mga06r32_148358_c1 3300050510 Unclassified 2323
549 nmdc:mga06r32_33628_c1 3300050510 Bacteria 4829
550 nmdc:mga06r32_455128_c1 3300050510 Bacteria 1259
551 nmdc:mga08y16_58506_c1 3300050511 Bacteria 4027
552 nmdc:mga0n895_157272_c1 3300050512 Bacteria 2303
553 nmdc:mga0n895_172862_c1 3300050512 Bacteria 2192
554 nmdc:mga0n895_239391_c1 3300050512 Unclassified 1841
555 nmdc:mga0n895_24032_c1 3300050512 Bacteria 5737
556 nmdc:mga0n895_289346_c1 3300050512 Bacteria 1661
557 nmdc:mga0n895_369561_c1 3300050512 Bacteria 1452
558 nmdc:mga0n895_539482_c1 3300050512 Unclassified 1173
559 nmdc:mga0rr50_306501_c1 3300050513 Unclassified 1329
560 nmdc:mga0rr50_371315_c1 3300050513 Bacteria 1205
561 nmdc:mga0rr50_77751_c1 3300050513 Bacteria 2551
562 nmdc:mga0a205_54072_c1 3300050515 Bacteria 3876
563 nmdc:mga0a205_583887_c1 3300050515 Bacteria 971
564 Ga0495601_0007089 3300053077 Bacteria 6567
565 Ga0495601_0030308 3300053077 Bacteria 3358
566 Ga0495612_0002960 3300053078 Bacteria 7047
567 Ga0495655_0042635 3300053083 Bacteria 1166
568 Ga0495595_0161102 3300053084 Bacteria 1107
569 Ga0495619_0001919 3300053085 Bacteria 13857
570 Ga0495619_0068153 3300053085 Bacteria 2376
571 Ga0500595_014968 3300053119 Bacteria 2926
572 Ga0500658_0010930 3300053134 Bacteria 3348
573 Ga0500589_068617 3300053147 Bacteria 1609
574 Ga0500634_0142161 3300053161 Bacteria 1135
575 Ga0500637_0200588 3300053178 Bacteria 1136
576 2513628354 2513237092 Bacteria 8341956
577 2513671497 2513237098 Bacteria 9902361
578 2524441714 2524023205 Bacteria 8918781
579 2524464803 2524023210 Bacteria 9029266
580 2745075022 2744054633 Bacteria 8678936
581 2824706172 2824704595 Bacteria 9667483
582 2824758702 2824753945 Bacteria 9787441
583 2824769018 2824763712 Bacteria 9792355
584 2847934988 2847930680 Bacteria 9342022
585 2876763810 2876761206 Bacteria 10111113
586 2876810764 2876808645 Bacteria 8824342
587 2879086382 2879083081 Bacteria 8587928
588 2879115972 2879110137 Bacteria 8907982
589 2881365493 2881364244 Bacteria 7710352
590 2885388484 2885383462 Bacteria 9473874
591 2903773327 2903768456 Bacteria 9749579
592 2904720195 2904711408 Bacteria 9771557
593 2922361238 2922361189 Bacteria 7436256
594 2935767980 2935760218 Bacteria 9817913
595 Ga0495672_0221807
596 JGI25406J46586_10043718
597 JGI25406J46586_10062071
598 JGI25406J46586_10087195
599 JGI25404J52841_10013128
600 JGI25404J52841_10023204
601 JGI25405J52794_10003598
602 Ga0070683_100075135
603 Ga0070682_100467668
604 Ga0070689_100212929
605 Ga0070661_100284738
606 Ga0070692_10188531
607 Ga0070668_100012647
608 Ga0070668_100039864
609 Ga0070671_100037745
610 Ga0070673_100070693
611 Ga0070667_100099333
612 Ga0070709_10082782
613 Ga0070709_10087689
614 Ga0070714_100101999
615 Ga0070714_100177339
616 Ga0070714_100303107
617 Ga0070713_100134991
618 Ga0070713_100566434
619 Ga0070710_10044260
620 Ga0070710_10070692
621 Ga0070710_10150112
622 Ga0070710_10255691
623 Ga0070710_10287067
624 Ga0070711_100062040
625 Ga0070711_100072248
626 Ga0070711_100117103
627 Ga0070711_100117545
628 Ga0070711_100162059
629 Ga0070711_100169912
630 Ga0070711_100382288
631 Ga0070711_100566887
632 Ga0070700_100255513
633 Ga0070708_100210768
634 Ga0070708_100585485
635 Ga0070663_100311296
636 Ga0070662_100186129
637 Ga0070681_10277343
638 Ga0070706_100028406
639 Ga0070706_100264550
640 Ga0070707_100086724
641 Ga0070698_100069744
642 Ga0070698_100121168
643 Ga0070699_100008545
644 Ga0070684_100011674
645 Ga0070697_100096214
646 Ga0070696_100139020
647 Ga0070665_100007736
648 Ga0070665_100271470
649 Ga0070704_100350076
650 Ga0068857_100071786
651 Ga0068856_100196750
652 Ga0070702_100214746
653 Ga0068864_100279546
654 Ga0068864_100359492
655 Ga0068866_10186946
656 Ga0068861_100011838
657 Ga0068863_100086690
658 Ga0068863_100431455
659 Ga0081455_10001307
660 Ga0081455_10002863
661 Ga0081455_10036867
662 Ga0081455_10362453
663 Ga0081540_1000397
664 Ga0081540_1006400
665 Ga0081540_1006853
666 Ga0081540_1010207
667 Ga0081540_1013288
668 Ga0081540_1023998
669 Ga0081540_1024451
670 Ga0081540_1028018
671 Ga0081540_1028641
672 Ga0081540_1038197
673 Ga0081540_1041477
674 Ga0081540_1043446
675 Ga0081540_1047944
676 Ga0081540_1050292
677 Ga0081540_1069369
678 Ga0081540_1095627
679 Ga0081539_10002257
680 Ga0081539_10032436
681 Ga0081539_10036033
682 Ga0081539_10045099
683 Ga0081539_10164450
684 Ga0070717_10029588
685 Ga0070717_10113751
686 Ga0070717_10135207
687 Ga0070717_10197856
688 Ga0070717_10418143
689 Ga0075365_10019536
690 Ga0075365_10026743
691 Ga0075365_10316217
692 Ga0075432_10009289
693 Ga0075432_10044809
694 Ga0070715_10016056
695 Ga0070715_10066791
696 Ga0070715_10076823
697 Ga0070715_10120034
698 Ga0070716_100089878
699 Ga0070716_100155600
700 Ga0070716_100176282
701 Ga0070712_100016436
702 Ga0070712_100033575
703 Ga0070712_100045144
704 Ga0070712_100130540
705 Ga0070712_100132592
706 Ga0070712_100174531
707 Ga0070712_100657551
708 Ga0075427_10000548
709 Ga0097621_100475075
710 Ga0068871_100057418
711 Ga0075428_100012679
712 Ga0075428_100043882
713 Ga0075428_100418145
714 Ga0075428_100692482
715 Ga0075428_100889565
716 Ga0075430_100007070
717 Ga0075430_100115462
718 Ga0075430_100119086
719 Ga0075431_100005987
720 Ga0075431_100021184
721 Ga0075431_100165683
722 Ga0075433_10066918
723 Ga0075433_10069679
724 Ga0075434_100133923
725 Ga0075434_100169864
726 Ga0075434_100182617
727 Ga0075434_100237193
728 Ga0075434_100632247
729 Ga0075429_100009244
730 Ga0075429_100031987
731 Ga0075436_100465316
732 Ga0099825_1029095
733 Ga0099824_1016795
734 Ga0075435_100154253
735 Ga0075435_100214384
736 Ga0075435_100227149
737 Ga0099794_10002357
738 Ga0099794_10012914
739 Ga0099794_10032758
740 Ga0099794_10261864
741 Ga0099795_10004704
742 Ga0099795_10006018
743 Ga0099795_10015015
744 Ga0099795_10022067
745 Ga0099795_10037347
746 Ga0105240_10482882
747 Ga0111539_10074870
748 Ga0111539_10184047
749 Ga0111539_10263631
750 Ga0111539_10529744
751 Ga0111539_11345053
752 Ga0105245_10366144
753 Ga0105247_10358366
754 Ga0114129_10007454
755 Ga0114129_10015432
756 Ga0114129_10019770
757 Ga0114129_10107515
758 Ga0114129_10213700
759 Ga0114129_10234919
760 Ga0114129_11607431
761 Ga0105243_10082322
762 Ga0105243_10362303
763 Ga0105243_10806963
764 Ga0105242_10291943
765 Ga0105248_10230454
766 Ga0105237_10068117
767 Ga0105237_10280558
768 Ga0105238_10037471
769 Ga0105249_10067728
770 Ga0105249_10228639
771 Ga0105249_10578114
772 Ga0099796_10009373
773 Ga0099796_10012632
774 Ga0099796_10020962
775 Ga0099796_10053212
776 Ga0105239_10233345
777 Ga0105239_10283517
778 Ga0105239_10589793
779 Ga0105246_10216999
780 Ga0157374_10278766
781 Ga0163162_10693185
782 Ga0157375_10344811
783 Ga0163163_10155611
784 Ga0163163_10194488
785 Ga0163163_10466465
786 Ga0157377_10068556
787 Ga0157379_10017434
788 Ga0157379_10096442
789 Ga0157376_10034227
790 Ga0157376_10105812
791 Ga0157376_10361955
792 Ga0207692_10010085
793 Ga0207692_10033350
794 Ga0207692_10079209
795 Ga0207692_10080124
796 Ga0207692_10165677
797 Ga0207710_10004063
798 Ga0207688_10001335
799 Ga0207680_10356080
800 Ga0207647_10056681
801 Ga0207685_10029722
802 Ga0207685_10032653
803 Ga0207685_10158972
804 Ga0207699_10046846
805 Ga0207699_10065616
806 Ga0207699_10203222
807 Ga0207645_10025861
808 Ga0207643_10008495
809 Ga0207684_10061745
810 Ga0207684_10087454
811 Ga0207684_10100159
812 Ga0207684_10399092
813 Ga0207707_10235244
814 Ga0207671_10172543
815 Ga0207693_10014179
816 Ga0207693_10034737
817 Ga0207693_10058686
818 Ga0207693_10156901
819 Ga0207693_10220648
820 Ga0207693_10226407
821 Ga0207663_10032179
822 Ga0207663_10035946
823 Ga0207663_10288326
824 Ga0207660_10700202
825 Ga0207662_10009040
826 Ga0207649_10183385
827 Ga0207646_10336136
828 Ga0207694_10054764
829 Ga0207650_10007900
830 Ga0207687_10247930
831 Ga0207700_10024183
832 Ga0207700_10067633
833 Ga0207700_10209611
834 Ga0207664_10151238
835 Ga0207664_10225996
836 Ga0207664_10344084
837 Ga0207706_10303281
838 Ga0207706_10529441
839 Ga0207709_10128804
840 Ga0207665_10049435
841 Ga0207665_10053045
842 Ga0207665_10054933
843 Ga0207665_10350172
844 Ga0207691_10047002
845 Ga0207711_10890746
846 Ga0207689_10040112
847 Ga0207661_10005022
848 Ga0207661_10010196
849 Ga0207661_10381336
850 Ga0207712_10089307
851 Ga0207712_10133367
852 Ga0207712_10188451
853 Ga0207712_10817285
854 Ga0207668_10005233
855 Ga0207658_10007886
856 Ga0207703_10048097
857 Ga0207678_10098772
858 Ga0207702_10597415
859 Ga0207641_10358136
860 Ga0207648_10181552
861 Ga0207676_10345179
862 Ga0207676_10660821
863 Ga0207674_10024320
864 Ga0207674_10364783
865 Ga0207674_10807944
866 Ga0207675_100048385
867 Ga0209389_1000094
868 Ga0209389_1000235
869 Ga0209589_1000007
870 Ga0209589_1001753
871 Ga0209489_100008
872 Ga0209489_100597
873 Ga0209489_105972
874 Ga0209700_100009
875 Ga0209700_100374
876 Ga0209179_1013902
877 Ga0209588_1003105
878 Ga0209588_1009480
879 Ga0209588_1056467
880 Ga0209588_1131571
881 Ga0207428_10004480
882 Ga0207428_10105099
883 Ga0268266_10000914
884 Ga0268265_10020884
885 Ga0307508_10106408
886 Ga0307416_100112395
887 Ga0307416_100225416
888 Ga0307411_10031829
889 Ga0373938_0069095
890 Ga0373926_0046235
891 Ga0373944_0003203
892 Ga0373944_0013545
893 Ga0373923_0144232
894 Ga0373936_0217915
895 Ga0373945_0003444
896 Ga0373954_0176545
897 Ga0373943_0000094
898 Ga0373943_0271064
899 Ga0373943_0271953
900 Ga0373946_0000421
901 Ga0373946_0035408
902 Ga0373946_0036794
903 Ga0373955_0176587
904 Ga0373924_0011887
905 Ga0373931_0024441
906 Ga0373935_0000839
907 Ga0373935_0004453
908 Ga0373935_0131156
909 Ga0373935_0508777
910 Ga0373927_0004203
911 Ga0373927_0052929
912 Ga0373927_0055861
913 Ga0373927_0093990
914 Ga0373927_0335683
915 Ga0373927_0406288
916 Ga0373933_0104547
917 Ga0373947_0000225
918 Ga0373947_0016095
919 Ga0373947_0017149
920 Ga0373947_0049426
921 Ga0373947_0308707
922 Ga0373947_0582453
923 Ga0373937_0031934
924 Ga0373937_0047796
925 Ga0373937_0573972
926 Ga0373925_0002349
927 Ga0373925_0057968
928 Ga0373925_0073670
929 Ga0373925_0087810
930 Ga0373925_0099699
931 Ga0373925_0157193
932 Ga0395898_0260182
933 Ga0395898_0267852
934 Ga0395905_0024997
935 Ga0395905_0337620
936 Ga0395901_0162853
937 Ga0436365_0999519
938 Ga0436360_0922892
939 Ga0436361_0193135
940 Ga0436363_1626812
941 Ga0436362_0902649
942 Ga0453683_0181180
943 Ga0495592_0117412
944 Ga0495603_0005289
945 Ga0495603_0020067
946 Ga0495603_0028694
947 Ga0495590_0085013
948 Ga0495638_0137508
949 Ga0495641_0023927
950 Ga0495653_0065254
951 Ga0495580_0071274
952 Ga0495580_0199964
953 Ga0495580_0365977
954 Ga0495580_0393542
955 Ga0495582_0224243
956 Ga0495605_0038449
957 Ga0495605_0049542
958 Ga0495605_0234224
959 Ga0495639_0037065
960 Ga0495662_0003937
961 Ga0495662_0049468
962 Ga0495662_0060195
963 Ga0495664_0000553
964 Ga0495664_0109969
965 Ga0495664_0173142
966 Ga0495664_0420343
967 Ga0495584_0194725
968 Ga0495584_0219885
969 Ga0495585_0156942
970 Ga0495594_0029927
971 Ga0495594_0271317
972 Ga0495606_0069257
973 Ga0495608_0435731
974 Ga0495618_0030956
975 Ga0495618_0038815
976 Ga0495618_0062623
977 Ga0495618_0138129
978 Ga0495630_0001809
979 Ga0495630_0017957
980 Ga0495630_0065405
981 Ga0495630_0127932
982 Ga0495630_0194403
983 Ga0495630_0224296
984 Ga0495648_0013972
985 Ga0495648_0113455
986 Ga0495663_0081704
987 Ga0495666_0011739
988 Ga0495666_0074524
989 Ga0495652_0038212
990 Ga0495652_0080501
991 Ga0495665_0002591
992 Ga0495665_0178540
993 Ga0495640_0004271
994 Ga0495640_0016119
995 Ga0495640_0103019
996 Ga0495640_0109912
997 Ga0495640_0306146
998 Ga0495586_0076648
999 Ga0495609_0048268
1000 Ga0495621_0014117
1001 Ga0495621_0017959
1002 Ga0495645_0043851
1003 Ga0495622_0053599
1004 Ga0495622_0110297
1005 Ga0495633_0097688
1006 Ga0495667_0436546
1007 Ga0495656_0031594
1008 Ga0495656_0109420
1009 Ga0495656_0184073
1010 Ga0495634_0053792
1011 Ga0495634_0056977
1012 Ga0495634_0079598
1013 Ga0495611_0058894
1014 Ga0495611_0136179
1015 Ga0495625_0111007
1016 Ga0495635_0012795
1017 Ga0495635_0043871
1018 Ga0495635_0200423
1019 Ga0495588_0011436
1020 Ga0495646_0141487
1021 Ga0495647_0007035
1022 Ga0495647_0044442
1023 Ga0495658_0063679
1024 Ga0495658_0214430
1025 Ga0495669_0195386
1026 Ga0495613_0010864
1027 Ga0495613_0147326
1028 Ga0495624_0001669
1029 Ga0495670_0101398
1030 Ga0495671_0079552
1031 Ga0495671_0080318
1032 Ga0495649_0217772
1033 Ga0495649_0308375
1034 Ga0495660_0140395
1035 Ga0495581_0033022
1036 Ga0495581_0038167
1037 Ga0495581_0071682
1038 Ga0495581_0088491
1039 Ga0495581_0348810
1040 Ga0495674_0022324
1041 Ga0495674_0037999
1042 Ga0495674_0300357
1043 Ga0495676_0006465
1044 Ga0495676_0084499
1045 Ga0495676_0101873
1046 Ga0495676_0197252
1047 Ga0495680_0376460
1048 Ga0495683_0134180
1049 Ga0495685_024646
1050 Ga0495684_0001394
1051 Ga0495684_0001619
1052 Ga0495684_0093288
1053 Ga0495684_0247658
1054 Ga0495593_0065657
1055 Ga0495615_0006467
1056 Ga0496100_0141203
1057 Ga0496100_0171862
1058 Ga0496100_0261847
1059 Ga0496100_0274090
1060 Ga0496102_0015465
1061 Ga0496102_0168698
1062 Ga0496102_0302150
1063 Ga0496102_0393179
1064 Ga0496102_0531373
1065 Ga0496102_0551713
1066 Ga0496102_0817255
1067 Ga0496103_0020160
1068 Ga0496103_0207093
1069 Ga0496104_0000125
1070 Ga0496104_0000284
1071 Ga0496104_0000669
1072 Ga0496104_0013454
1073 Ga0496104_0043912
1074 Ga0496104_0363200
1075 Ga0496104_0564956
1076 Ga0496105_0001756
1077 Ga0496105_0029278
1078 Ga0496105_0089709
1079 Ga0496105_0259328
1080 Ga0496106_0030978
1081 Ga0496106_0055282
1082 Ga0496106_0116921
1083 Ga0496106_0148891
1084 Ga0496107_0191914
1085 Ga0496107_0295662
1086 Ga0496107_0298807
1087 Ga0496108_0000869
1088 Ga0496108_0037611
1089 Ga0496108_0101255
1090 Ga0496109_0000537
1091 Ga0496109_0001938
1092 Ga0496109_0012274
1093 Ga0496109_0054455
1094 Ga0496109_0061619
1095 Ga0496109_0106182
1096 Ga0496109_0157109
1097 Ga0496110_0001099
1098 Ga0496110_0010615
1099 Ga0496110_0027567
1100 Ga0496110_0060949
1101 Ga0496110_0232159
1102 Ga0496110_0253633
1103 Ga0496110_0492578
1104 Ga0496110_0594639
1105 Ga0496111_0012027
1106 Ga0496111_0013338
1107 Ga0496111_0017665
1108 Ga0496111_0032208
1109 Ga0496111_0106047
1110 Ga0496111_0201670
1111 Ga0496111_0402821
1112 Ga0496112_0001765
1113 Ga0496112_0002723
1114 Ga0496112_0002865
1115 Ga0496112_0005705
1116 Ga0496112_0022193
1117 Ga0496112_0250726
1118 Ga0496113_0000616
1119 Ga0496113_0013892
1120 Ga0496113_0013976
1121 Ga0496113_0074247
1122 Ga0496113_0357050
1123 Ga0496114_0092980
1124 Ga0496114_0124642
1125 Ga0496115_0018528
1126 Ga0496115_0027299
1127 Ga0496115_0250677
1128 Ga0496121_0106445
1129 Ga0496124_0022281
1130 Ga0496125_0039579
1131 nmdc:mga0yw44_33352_c1
1132 nmdc:mga0yw44_39925_c1
1133 nmdc:mga06z11_8864_c1
1134 nmdc:mga05p37_1225660_c1
1135 nmdc:mga05p37_132792_c1
1136 nmdc:mga05p37_13638_c1
1137 nmdc:mga05p37_19437_c1
1138 nmdc:mga05p37_60071_c1
1139 nmdc:mga09592_54902_c1
1140 nmdc:mga0qj67_401446_c1
1141 nmdc:mga0qj67_44958_c1
1142 nmdc:mga06r32_148358_c1
1143 nmdc:mga06r32_33628_c1
1144 nmdc:mga06r32_455128_c1
1145 nmdc:mga08y16_58506_c1
1146 nmdc:mga0n895_157272_c1
1147 nmdc:mga0n895_172862_c1
1148 nmdc:mga0n895_239391_c1
1149 nmdc:mga0n895_24032_c1
1150 nmdc:mga0n895_289346_c1
1151 nmdc:mga0n895_369561_c1
1152 nmdc:mga0n895_539482_c1
1153 nmdc:mga0rr50_306501_c1
1154 nmdc:mga0rr50_371315_c1
1155 nmdc:mga0rr50_77751_c1
1156 nmdc:mga0a205_54072_c1
1157 nmdc:mga0a205_583887_c1
1158 Ga0495601_0007089
1159 Ga0495601_0030308
1160 Ga0495612_0002960
1161 Ga0495655_0042635
1162 Ga0495595_0161102
1163 Ga0495619_0001919
1164 Ga0495619_0068153
1165 Ga0500595_014968
1166 Ga0500658_0010930
1167 Ga0500589_068617
1168 Ga0500634_0142161
1169 Ga0500637_0200588
1170 2513628354
1171 2513671497
1172 2524441714
1173 2524464803
1174 2745075022
1175 2824706172
1176 2824758702
1177 2824769018
1178 2847934988
1179 2876763810
1180 2876810764
1181 2879086382
1182 2879115972
1183 2881365493
1184 2885388484
1185 2903773327
1186 2904720195
1187 2922361238
1188 2935767980

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.8466 45 237
4b1m-assembly3.cif.gz_C carbohydrate binding module cbm66 from bacillus subtilis 0.8031 45 237
4ufm-assembly1.cif.gz_A mouse galactocerebrosidase complexed with 1-deoxy-galacto-nojirimycin dgj 0.7835 29 241
1ux6-assembly1.cif.gz_A structure of a thrombospondin c-terminal fragment reveals a novel calcium core in the type 3 repeats 0.7612 104 235
5nxb-assembly1.cif.gz_B mouse galactocerebrosidase in complex with saposin a 0.7559 29 241
ID Description Score Start End Superfamily
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8466 45 237 2.60.120.560
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8146 53 235 2.60.120.560
4b1mC00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.8031 45 237 2.60.120.560
af_Q58355_45_220_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7903 30 235 2.60.120.560
af_A0A5K1K8Q0_451_608_2.60.120.560 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7814 53 235 2.60.120.560
ID Description Score Start End GO Terms
AF-A0A2V8QIQ4-F1-model_v4 Uncharacterized protein 0.9504 104 237
AF-U2HC13-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9451 27 239
AF-A0A537T1R3-F1-model_v4 DUF1080 domain-containing protein 0.9428 28 241
AF-A0A2R5EIK6-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9298 24 241 GO:0016787
AF-A0A432HQ77-F1-model_v4 DUF1080 domain-containing protein 0.9285 25 239

Map