F467273
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 343 | 552 | 248 |
Family's Representative Sequence
| Representative Sequence | 3300048924|Ga0496121_0027993|Ga0496121_0027993_739_1623 |
| Length | 294 |
| Sequence | MAVIFQVCDVLCSDAPYAGVKGTPIGYHTRLIRESIMQNPSSVPPGDTSSPGTTHFGFKTVQETEKAGKVAEVFHSVASRYDVMNDLMSGGMHRIWKAFTIGRAAVRPGMKVLDIAGGTGDLARAFARRAGPDGQVWLTDINDSMLRVGRDRLADNGLLLPLAVCDAERLPFPSGYFDRVSVAFGLRNMTHKDRALAEMTRVLKPGGKLLVLEFSRVAKPLAPVYDWYSFNVLPWLGRKVAKDEASYRYLAESIRMHPDQETLAGMLRDAGLERVQYFNLSAGVVALHEGVRLT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 2 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 3 | 2602042066 | Enterobacter sp. NFIX45 | Isolate | Rhizoplane |
| 4 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 5 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 6 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 7 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 8 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 9 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 10 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 11 | 2711768156 | Atlantibacter hermannii DDE1 | Isolate | Unclassified |
| 12 | 2734482258 | Glomeribacter sp. phylotype 3 | Isolate | Unclassified |
| 13 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 14 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 15 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 16 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 17 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 18 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 19 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 20 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 21 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 22 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 23 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 24 | 2857576091 | Pigmentiphaga sp. R-72090 | Isolate | Unclassified |
| 25 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 26 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 27 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 28 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 29 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 30 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 31 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 32 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 33 | 2939568625 | Lelliottia sp. 489 | Isolate | Rhizosphere |
| 34 | 2939642701 | Lelliottia nimipressuralis 2756 | Isolate | Rhizosphere |
| 35 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 36 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 37 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 38 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 39 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 40 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 41 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 45 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 49 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 51 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 72 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 75 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 78 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 86 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 87 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 88 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 89 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 90 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 91 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 100 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 101 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 102 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 104 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 105 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 106 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 107 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 108 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 109 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 110 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 111 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 113 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 114 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 197 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 198 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 200 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 201 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 202 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 210 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 211 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 212 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 213 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 214 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 215 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 216 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 217 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 218 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 220 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 221 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 222 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 223 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 224 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 228 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 229 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 231 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 232 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 233 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 234 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 235 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 236 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 237 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 238 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 239 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 240 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 241 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 242 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 243 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 244 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 245 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 246 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 247 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 248 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 282 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 283 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 284 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 285 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 286 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 287 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 288 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 289 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 290 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 291 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 292 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 293 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 294 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 316 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 321 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 322 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 323 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 339 | 8002392321 | Alcaligenes faecalis Mc250 | Isolate | Rhizosphere |
| 340 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 341 | 8018221730 | Enterobacter sp. CM29 | Isolate | Unclassified |
| 342 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 343 | 8055225921 | Achromobacter panacis KCTC 42751 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.09 |
| Metatranscriptomes | 0 |
| Isolates | 6.91 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.53 |
| Nodule | 0.34 |
| Rhizoplane | 3.04 |
| Rhizosphere | 84.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25151J46595_10000170 | 3300003187 | Bacteria | 84454 |
| 2 | rootH2_10019123 | 3300003320 | Bacteria | 25137 |
| 3 | Ga0055529_1001572 | 3300003763 | Bacteria | 6387 |
| 4 | Ga0065704_10000585 | 3300005289 | Bacteria | 32775 |
| 5 | Ga0065707_10165357 | 3300005295 | Bacteria | 1527 |
| 6 | Ga0070658_10007033 | 3300005327 | Bacteria | 9081 |
| 7 | Ga0070658_10038614 | 3300005327 | Bacteria | 3849 |
| 8 | Ga0070676_10140338 | 3300005328 | Bacteria | 1537 |
| 9 | Ga0070676_10354499 | 3300005328 | Bacteria | 1009 |
| 10 | Ga0070683_100250872 | 3300005329 | Bacteria | 1683 |
| 11 | Ga0070683_100283544 | 3300005329 | Bacteria | 1576 |
| 12 | Ga0068869_100043956 | 3300005334 | Bacteria | 3211 |
| 13 | Ga0068869_100165829 | 3300005334 | Bacteria | 1723 |
| 14 | Ga0070666_10019243 | 3300005335 | Bacteria | 4404 |
| 15 | Ga0070666_10022564 | 3300005335 | Bacteria | 4088 |
| 16 | Ga0070680_100138758 | 3300005336 | Bacteria | 2038 |
| 17 | Ga0070682_100018065 | 3300005337 | Bacteria | 4116 |
| 18 | Ga0068868_100022580 | 3300005338 | Bacteria | 4751 |
| 19 | Ga0070660_100159519 | 3300005339 | Bacteria | 1817 |
| 20 | Ga0070689_100010523 | 3300005340 | Bacteria | 6592 |
| 21 | Ga0070689_100070088 | 3300005340 | Bacteria | 2736 |
| 22 | Ga0070689_100133744 | 3300005340 | Bacteria | 1990 |
| 23 | Ga0070689_100446496 | 3300005340 | Bacteria | 1100 |
| 24 | Ga0070691_10013529 | 3300005341 | Bacteria | 3738 |
| 25 | Ga0070687_100053342 | 3300005343 | Bacteria | 2102 |
| 26 | Ga0070661_100022098 | 3300005344 | Bacteria | 4550 |
| 27 | Ga0070692_10004559 | 3300005345 | Bacteria | 5801 |
| 28 | Ga0070692_10238697 | 3300005345 | Bacteria | 1082 |
| 29 | Ga0070668_100019415 | 3300005347 | Bacteria | 5115 |
| 30 | Ga0070668_100021699 | 3300005347 | Bacteria | 4851 |
| 31 | Ga0070668_100213894 | 3300005347 | Bacteria | 1587 |
| 32 | Ga0070668_100412177 | 3300005347 | Bacteria | 1155 |
| 33 | Ga0070669_100084565 | 3300005353 | Bacteria | 2368 |
| 34 | Ga0070669_100384937 | 3300005353 | Bacteria | 1144 |
| 35 | Ga0070675_100011290 | 3300005354 | Bacteria | 6992 |
| 36 | Ga0070675_100346649 | 3300005354 | Bacteria | 1316 |
| 37 | Ga0070671_100025228 | 3300005355 | Bacteria | 4876 |
| 38 | Ga0070674_100029049 | 3300005356 | Bacteria | 3637 |
| 39 | Ga0070674_100036503 | 3300005356 | Bacteria | 3300 |
| 40 | Ga0070674_100159431 | 3300005356 | Bacteria | 1710 |
| 41 | Ga0070673_100003959 | 3300005364 | Bacteria | 9309 |
| 42 | Ga0070673_100204382 | 3300005364 | Bacteria | 1702 |
| 43 | Ga0070688_100415606 | 3300005365 | Bacteria | 999 |
| 44 | Ga0070667_100029724 | 3300005367 | Bacteria | 4555 |
| 45 | Ga0070713_100005849 | 3300005436 | Bacteria | 8456 |
| 46 | Ga0070710_10514635 | 3300005437 | Bacteria | 821 |
| 47 | Ga0070701_10008691 | 3300005438 | Bacteria | 4408 |
| 48 | Ga0070701_10028989 | 3300005438 | Bacteria | 2725 |
| 49 | Ga0070701_10043261 | 3300005438 | Bacteria | 2303 |
| 50 | Ga0070705_100012308 | 3300005440 | Bacteria | 4346 |
| 51 | Ga0070705_100366497 | 3300005440 | Bacteria | 1056 |
| 52 | Ga0070700_100000758 | 3300005441 | Bacteria | 15945 |
| 53 | Ga0070700_100022402 | 3300005441 | Bacteria | 3683 |
| 54 | Ga0070700_100122762 | 3300005441 | Bacteria | 1743 |
| 55 | Ga0070700_100212520 | 3300005441 | Bacteria | 1366 |
| 56 | Ga0070694_100034598 | 3300005444 | Bacteria | 3333 |
| 57 | Ga0070678_100003117 | 3300005456 | Bacteria | 9190 |
| 58 | Ga0070678_100058374 | 3300005456 | Bacteria | 2832 |
| 59 | Ga0070678_100072140 | 3300005456 | Bacteria | 2587 |
| 60 | Ga0070681_10012999 | 3300005458 | Bacteria | 8267 |
| 61 | Ga0068867_100006064 | 3300005459 | Bacteria | 8568 |
| 62 | Ga0068867_100070528 | 3300005459 | Bacteria | 2613 |
| 63 | Ga0068867_100085086 | 3300005459 | Bacteria | 2390 |
| 64 | Ga0068867_100177470 | 3300005459 | Bacteria | 1691 |
| 65 | Ga0070685_10115923 | 3300005466 | Bacteria | 1657 |
| 66 | Ga0070706_100203339 | 3300005467 | Bacteria | 1850 |
| 67 | Ga0070707_100044433 | 3300005468 | Bacteria | 4253 |
| 68 | Ga0070699_100140535 | 3300005518 | Bacteria | 2132 |
| 69 | Ga0070697_100147720 | 3300005536 | Bacteria | 1980 |
| 70 | Ga0070697_100226496 | 3300005536 | Bacteria | 1594 |
| 71 | Ga0070697_100259956 | 3300005536 | Bacteria | 1486 |
| 72 | Ga0068853_100015312 | 3300005539 | Bacteria | 6302 |
| 73 | Ga0070672_100011362 | 3300005543 | Bacteria | 6209 |
| 74 | Ga0070672_100542727 | 3300005543 | Bacteria | 1009 |
| 75 | Ga0070686_100016080 | 3300005544 | Bacteria | 4347 |
| 76 | Ga0070686_100024252 | 3300005544 | Bacteria | 3634 |
| 77 | Ga0070696_100038676 | 3300005546 | Bacteria | 3293 |
| 78 | Ga0070704_100003984 | 3300005549 | Bacteria | 8516 |
| 79 | Ga0070704_100029000 | 3300005549 | Bacteria | 3689 |
| 80 | Ga0070704_100040506 | 3300005549 | Bacteria | 3207 |
| 81 | Ga0070704_100091644 | 3300005549 | Bacteria | 2267 |
| 82 | Ga0068855_100029680 | 3300005563 | Bacteria | 6537 |
| 83 | Ga0068857_100076682 | 3300005577 | Bacteria | 2981 |
| 84 | Ga0068857_101041002 | 3300005577 | Bacteria | 789 |
| 85 | Ga0070702_100066675 | 3300005615 | Bacteria | 2112 |
| 86 | Ga0068852_100004709 | 3300005616 | Bacteria | 9677 |
| 87 | Ga0068852_100068965 | 3300005616 | Bacteria | 3097 |
| 88 | Ga0068859_100006763 | 3300005617 | Bacteria | 11645 |
| 89 | Ga0068859_100011579 | 3300005617 | Bacteria | 8871 |
| 90 | Ga0068859_100162687 | 3300005617 | Bacteria | 2311 |
| 91 | Ga0068859_100854986 | 3300005617 | Bacteria | 996 |
| 92 | Ga0068864_100246641 | 3300005618 | Bacteria | 1656 |
| 93 | Ga0068866_10000263 | 3300005718 | Bacteria | 24809 |
| 94 | Ga0068866_10070956 | 3300005718 | Bacteria | 1840 |
| 95 | Ga0068861_100001018 | 3300005719 | Bacteria | 17136 |
| 96 | Ga0068861_100034016 | 3300005719 | Bacteria | 3765 |
| 97 | Ga0068861_100041979 | 3300005719 | Bacteria | 3428 |
| 98 | Ga0068861_100071772 | 3300005719 | Bacteria | 2684 |
| 99 | Ga0068861_100199586 | 3300005719 | Bacteria | 1678 |
| 100 | Ga0068851_10002142 | 3300005834 | Bacteria | 8674 |
| 101 | Ga0068870_10003609 | 3300005840 | Bacteria | 6567 |
| 102 | Ga0068870_10126032 | 3300005840 | Bacteria | 1481 |
| 103 | Ga0068863_100111412 | 3300005841 | Bacteria | 2607 |
| 104 | Ga0068858_100002092 | 3300005842 | Bacteria | 20289 |
| 105 | Ga0068860_100016816 | 3300005843 | Bacteria | 7132 |
| 106 | Ga0068862_100000835 | 3300005844 | Bacteria | 30463 |
| 107 | Ga0068862_100047704 | 3300005844 | Bacteria | 3656 |
| 108 | Ga0068862_100637354 | 3300005844 | Bacteria | 1027 |
| 109 | Ga0081538_10004229 | 3300005981 | Bacteria | 13316 |
| 110 | Ga0081539_10105142 | 3300005985 | Bacteria | 1431 |
| 111 | Ga0075364_10006847 | 3300006051 | Bacteria | 6727 |
| 112 | Ga0075364_10015869 | 3300006051 | Bacteria | 4675 |
| 113 | Ga0075364_10228407 | 3300006051 | Bacteria | 1264 |
| 114 | Ga0070715_10118218 | 3300006163 | Bacteria | 1260 |
| 115 | Ga0070716_100064441 | 3300006173 | Bacteria | 2131 |
| 116 | Ga0070712_100409810 | 3300006175 | Bacteria | 1121 |
| 117 | Ga0097621_100002988 | 3300006237 | Bacteria | 11616 |
| 118 | Ga0097621_100028370 | 3300006237 | Bacteria | 4411 |
| 119 | Ga0097621_100084532 | 3300006237 | Bacteria | 2646 |
| 120 | Ga0097621_100150406 | 3300006237 | Bacteria | 1996 |
| 121 | Ga0097621_100538199 | 3300006237 | Bacteria | 1062 |
| 122 | Ga0068871_100002180 | 3300006358 | Bacteria | 13302 |
| 123 | Ga0068871_100024831 | 3300006358 | Bacteria | 4653 |
| 124 | Ga0068871_100060002 | 3300006358 | Bacteria | 3101 |
| 125 | Ga0068871_100116835 | 3300006358 | Bacteria | 2249 |
| 126 | Ga0075428_100002299 | 3300006844 | Bacteria | 20682 |
| 127 | Ga0075428_100005442 | 3300006844 | Bacteria | 14150 |
| 128 | Ga0075428_100026865 | 3300006844 | Bacteria | 6374 |
| 129 | Ga0075428_100243273 | 3300006844 | Bacteria | 1941 |
| 130 | Ga0075431_100037313 | 3300006847 | Bacteria | 5007 |
| 131 | Ga0075433_10115381 | 3300006852 | Bacteria | 2383 |
| 132 | Ga0075433_10242990 | 3300006852 | Bacteria | 1598 |
| 133 | Ga0075433_10329291 | 3300006852 | Bacteria | 1351 |
| 134 | Ga0075434_100000011 | 3300006871 | Bacteria | 86261 |
| 135 | Ga0075429_100056565 | 3300006880 | Bacteria | 3414 |
| 136 | Ga0075429_100114050 | 3300006880 | Bacteria | 2362 |
| 137 | Ga0075429_100150302 | 3300006880 | Bacteria | 2039 |
| 138 | Ga0075429_100222786 | 3300006880 | Bacteria | 1652 |
| 139 | Ga0068865_100000539 | 3300006881 | Bacteria | 21055 |
| 140 | Ga0068865_100032279 | 3300006881 | Bacteria | 3497 |
| 141 | Ga0075436_100058806 | 3300006914 | Bacteria | 2655 |
| 142 | Ga0075436_100405512 | 3300006914 | Bacteria | 988 |
| 143 | Ga0097620_100006762 | 3300006931 | Bacteria | 11645 |
| 144 | Ga0097620_100011579 | 3300006931 | Bacteria | 8871 |
| 145 | Ga0097620_100162693 | 3300006931 | Bacteria | 2311 |
| 146 | Ga0097620_100855022 | 3300006931 | Bacteria | 996 |
| 147 | Ga0075435_100003109 | 3300007076 | Bacteria | 11216 |
| 148 | Ga0075435_100371975 | 3300007076 | Bacteria | 1227 |
| 149 | Ga0099794_10001720 | 3300007265 | Bacteria | 7761 |
| 150 | Ga0105240_10173408 | 3300009093 | Bacteria | 2552 |
| 151 | Ga0105240_10203168 | 3300009093 | Bacteria | 2321 |
| 152 | Ga0105240_10912210 | 3300009093 | Bacteria | 944 |
| 153 | Ga0111539_10000625 | 3300009094 | Bacteria | 45822 |
| 154 | Ga0111539_10006426 | 3300009094 | Bacteria | 15157 |
| 155 | Ga0111539_10413049 | 3300009094 | Bacteria | 1572 |
| 156 | Ga0105245_10002726 | 3300009098 | Bacteria | 15903 |
| 157 | Ga0114129_10377692 | 3300009147 | Bacteria | 1872 |
| 158 | Ga0105243_10001210 | 3300009148 | Bacteria | 23241 |
| 159 | Ga0105243_10013102 | 3300009148 | Bacteria | 6266 |
| 160 | Ga0105241_10557618 | 3300009174 | Bacteria | 1030 |
| 161 | Ga0105242_10000462 | 3300009176 | Bacteria | 32275 |
| 162 | Ga0105242_10018901 | 3300009176 | Bacteria | 5395 |
| 163 | Ga0105248_10083321 | 3300009177 | Bacteria | 3597 |
| 164 | Ga0105248_10114240 | 3300009177 | Bacteria | 3045 |
| 165 | Ga0105248_10153955 | 3300009177 | Bacteria | 2594 |
| 166 | Ga0105248_10257199 | 3300009177 | Bacteria | 1966 |
| 167 | Ga0105248_10531122 | 3300009177 | Bacteria | 1327 |
| 168 | Ga0105237_10033220 | 3300009545 | Bacteria | 5226 |
| 169 | Ga0105238_10070931 | 3300009551 | Bacteria | 3482 |
| 170 | Ga0105238_10232752 | 3300009551 | Bacteria | 1819 |
| 171 | Ga0105238_10369651 | 3300009551 | Bacteria | 1424 |
| 172 | Ga0105238_10610802 | 3300009551 | Bacteria | 1099 |
| 173 | Ga0105249_10023789 | 3300009553 | Bacteria | 5502 |
| 174 | Ga0105249_10136404 | 3300009553 | Bacteria | 2348 |
| 175 | Ga0105249_10170647 | 3300009553 | Bacteria | 2109 |
| 176 | Ga0105249_10262863 | 3300009553 | Bacteria | 1716 |
| 177 | Ga0157370_10008938 | 3300013104 | Bacteria | 10762 |
| 178 | Ga0157374_10252172 | 3300013296 | Bacteria | 1737 |
| 179 | Ga0157378_10011077 | 3300013297 | Bacteria | 7892 |
| 180 | Ga0157378_10029096 | 3300013297 | Bacteria | 4877 |
| 181 | Ga0157378_10531455 | 3300013297 | Bacteria | 1179 |
| 182 | Ga0163162_10105460 | 3300013306 | Bacteria | 2913 |
| 183 | Ga0163162_10174291 | 3300013306 | Bacteria | 2276 |
| 184 | Ga0163162_10698221 | 3300013306 | Bacteria | 1136 |
| 185 | Ga0157372_10434269 | 3300013307 | Bacteria | 1530 |
| 186 | Ga0157375_10005831 | 3300013308 | Bacteria | 10718 |
| 187 | Ga0157375_10241644 | 3300013308 | Bacteria | 1965 |
| 188 | Ga0157375_10383433 | 3300013308 | Bacteria | 1572 |
| 189 | Ga0157375_10415529 | 3300013308 | Bacteria | 1511 |
| 190 | Ga0163163_10799810 | 3300014325 | Bacteria | 1006 |
| 191 | Ga0157380_10002619 | 3300014326 | Bacteria | 12174 |
| 192 | Ga0157380_10009614 | 3300014326 | Bacteria | 6935 |
| 193 | Ga0157380_10028796 | 3300014326 | Bacteria | 4240 |
| 194 | Ga0157380_10034923 | 3300014326 | Bacteria | 3880 |
| 195 | Ga0157380_10046728 | 3300014326 | Bacteria | 3402 |
| 196 | Ga0157380_10120187 | 3300014326 | Bacteria | 2224 |
| 197 | Ga0157380_10330570 | 3300014326 | Bacteria | 1417 |
| 198 | Ga0157380_10614064 | 3300014326 | Bacteria | 1078 |
| 199 | Ga0157379_10013625 | 3300014968 | Bacteria | 7124 |
| 200 | Ga0157379_10019956 | 3300014968 | Bacteria | 5922 |
| 201 | Ga0157379_10567252 | 3300014968 | Bacteria | 1057 |
| 202 | Ga0157376_10510232 | 3300014969 | Bacteria | 1183 |
| 203 | Ga0163161_10187541 | 3300017792 | Bacteria | 1588 |
| 204 | Ga0209258_102671 | 3300025242 | Bacteria | 4395 |
| 205 | Ga0209455_1000477 | 3300025272 | Bacteria | 29930 |
| 206 | Ga0209676_1002511 | 3300025292 | Bacteria | 12842 |
| 207 | Ga0209025_1000071 | 3300025294 | Bacteria | 287297 |
| 208 | Ga0209050_1002083 | 3300025298 | Bacteria | 18319 |
| 209 | Ga0207697_10003881 | 3300025315 | Bacteria | 7291 |
| 210 | Ga0207656_10045210 | 3300025321 | Bacteria | 1884 |
| 211 | Ga0207682_10002916 | 3300025893 | Bacteria | 7543 |
| 212 | Ga0207682_10021226 | 3300025893 | Bacteria | 2554 |
| 213 | Ga0207642_10014964 | 3300025899 | Bacteria | 2878 |
| 214 | Ga0207642_10020911 | 3300025899 | Bacteria | 2565 |
| 215 | Ga0207680_10013971 | 3300025903 | Bacteria | 4140 |
| 216 | Ga0207680_10021017 | 3300025903 | Bacteria | 3525 |
| 217 | Ga0207699_10172275 | 3300025906 | Bacteria | 1449 |
| 218 | Ga0207643_10011438 | 3300025908 | Bacteria | 4793 |
| 219 | Ga0207705_10023581 | 3300025909 | Bacteria | 4389 |
| 220 | Ga0207705_10099620 | 3300025909 | Bacteria | 2137 |
| 221 | Ga0207707_10008055 | 3300025912 | Bacteria | 9152 |
| 222 | Ga0207707_10515518 | 3300025912 | Bacteria | 1019 |
| 223 | Ga0207695_10327053 | 3300025913 | Bacteria | 1422 |
| 224 | Ga0207693_10440218 | 3300025915 | Bacteria | 1019 |
| 225 | Ga0207660_10111741 | 3300025917 | Bacteria | 2057 |
| 226 | Ga0207660_10141848 | 3300025917 | Bacteria | 1837 |
| 227 | Ga0207662_10022779 | 3300025918 | Bacteria | 3595 |
| 228 | Ga0207662_10099739 | 3300025918 | Bacteria | 1798 |
| 229 | Ga0207646_10536002 | 3300025922 | Bacteria | 1053 |
| 230 | Ga0207681_10145648 | 3300025923 | Bacteria | 1769 |
| 231 | Ga0207694_10220169 | 3300025924 | Bacteria | 1548 |
| 232 | Ga0207694_10547245 | 3300025924 | Bacteria | 971 |
| 233 | Ga0207650_10004155 | 3300025925 | Bacteria | 9894 |
| 234 | Ga0207659_10046152 | 3300025926 | Bacteria | 3075 |
| 235 | Ga0207687_10000891 | 3300025927 | Bacteria | 20278 |
| 236 | Ga0207644_10012447 | 3300025931 | Bacteria | 5650 |
| 237 | Ga0207644_10136868 | 3300025931 | Bacteria | 1882 |
| 238 | Ga0207706_10011972 | 3300025933 | Bacteria | 7900 |
| 239 | Ga0207706_10092058 | 3300025933 | Bacteria | 2666 |
| 240 | Ga0207686_10010153 | 3300025934 | Bacteria | 5120 |
| 241 | Ga0207686_10194618 | 3300025934 | Bacteria | 1448 |
| 242 | Ga0207686_10359371 | 3300025934 | Bacteria | 1099 |
| 243 | Ga0207709_10008636 | 3300025935 | Bacteria | 5627 |
| 244 | Ga0207709_10046690 | 3300025935 | Bacteria | 2629 |
| 245 | Ga0207709_10062289 | 3300025935 | Bacteria | 2334 |
| 246 | Ga0207709_10434759 | 3300025935 | Bacteria | 1011 |
| 247 | Ga0207670_10014439 | 3300025936 | Bacteria | 4688 |
| 248 | Ga0207670_10015164 | 3300025936 | Bacteria | 4596 |
| 249 | Ga0207670_10040230 | 3300025936 | Bacteria | 3068 |
| 250 | Ga0207670_10079021 | 3300025936 | Bacteria | 2296 |
| 251 | Ga0207669_10021005 | 3300025937 | Bacteria | 3437 |
| 252 | Ga0207669_10035156 | 3300025937 | Bacteria | 2848 |
| 253 | Ga0207669_10039461 | 3300025937 | Bacteria | 2729 |
| 254 | Ga0207669_10081821 | 3300025937 | Bacteria | 2070 |
| 255 | Ga0207669_10562475 | 3300025937 | Bacteria | 922 |
| 256 | Ga0207704_10001006 | 3300025938 | Bacteria | 12508 |
| 257 | Ga0207704_10125263 | 3300025938 | Bacteria | 1767 |
| 258 | Ga0207704_10263683 | 3300025938 | Bacteria | 1300 |
| 259 | Ga0207691_10001377 | 3300025940 | Bacteria | 24280 |
| 260 | Ga0207691_10168399 | 3300025940 | Bacteria | 1919 |
| 261 | Ga0207691_10218365 | 3300025940 | Bacteria | 1654 |
| 262 | Ga0207711_10482779 | 3300025941 | Bacteria | 1154 |
| 263 | Ga0207689_10000044 | 3300025942 | Bacteria | 92835 |
| 264 | Ga0207689_10229037 | 3300025942 | Bacteria | 1536 |
| 265 | Ga0207661_10067119 | 3300025944 | Bacteria | 2916 |
| 266 | Ga0207679_10010038 | 3300025945 | Bacteria | 6085 |
| 267 | Ga0207667_10032498 | 3300025949 | Bacteria | 5622 |
| 268 | Ga0207667_10216674 | 3300025949 | Bacteria | 1962 |
| 269 | Ga0207651_10121516 | 3300025960 | Bacteria | 1981 |
| 270 | Ga0207651_10218018 | 3300025960 | Bacteria | 1541 |
| 271 | Ga0207651_10495392 | 3300025960 | Bacteria | 1055 |
| 272 | Ga0207712_10014466 | 3300025961 | Bacteria | 5078 |
| 273 | Ga0207712_10070305 | 3300025961 | Bacteria | 2514 |
| 274 | Ga0207712_10280777 | 3300025961 | Bacteria | 1359 |
| 275 | Ga0207668_10426679 | 3300025972 | Bacteria | 1126 |
| 276 | Ga0207677_10000694 | 3300026023 | Bacteria | 19962 |
| 277 | Ga0207677_10011458 | 3300026023 | Bacteria | 5060 |
| 278 | Ga0207677_10610415 | 3300026023 | Bacteria | 958 |
| 279 | Ga0207677_10726858 | 3300026023 | Bacteria | 883 |
| 280 | Ga0207703_10074426 | 3300026035 | Bacteria | 2812 |
| 281 | Ga0207703_10321418 | 3300026035 | Bacteria | 1417 |
| 282 | Ga0207639_10070782 | 3300026041 | Bacteria | 2726 |
| 283 | Ga0207678_10038123 | 3300026067 | Bacteria | 4178 |
| 284 | Ga0207678_10173688 | 3300026067 | Bacteria | 1840 |
| 285 | Ga0207708_10000190 | 3300026075 | Bacteria | 48551 |
| 286 | Ga0207708_10166700 | 3300026075 | Bacteria | 1742 |
| 287 | Ga0207708_10186867 | 3300026075 | Bacteria | 1647 |
| 288 | Ga0207641_10145750 | 3300026088 | Bacteria | 2141 |
| 289 | Ga0207648_10000148 | 3300026089 | Bacteria | 70334 |
| 290 | Ga0207648_10007583 | 3300026089 | Bacteria | 10641 |
| 291 | Ga0207648_10046103 | 3300026089 | Bacteria | 3822 |
| 292 | Ga0207648_10071405 | 3300026089 | Bacteria | 3026 |
| 293 | Ga0207648_10142275 | 3300026089 | Bacteria | 2114 |
| 294 | Ga0207648_10446362 | 3300026089 | Bacteria | 1177 |
| 295 | Ga0207676_10245884 | 3300026095 | Bacteria | 1607 |
| 296 | Ga0207674_10097928 | 3300026116 | Bacteria | 2917 |
| 297 | Ga0207674_10175895 | 3300026116 | Bacteria | 2093 |
| 298 | Ga0207675_100000331 | 3300026118 | Bacteria | 45219 |
| 299 | Ga0207675_100002211 | 3300026118 | Bacteria | 19327 |
| 300 | Ga0207675_100011155 | 3300026118 | Bacteria | 8418 |
| 301 | Ga0207675_100143243 | 3300026118 | Bacteria | 2271 |
| 302 | Ga0207675_100259752 | 3300026118 | Bacteria | 1683 |
| 303 | Ga0207683_10007220 | 3300026121 | Bacteria | 9526 |
| 304 | Ga0207683_10012470 | 3300026121 | Bacteria | 7253 |
| 305 | Ga0207683_10022020 | 3300026121 | Bacteria | 5468 |
| 306 | Ga0207698_10004162 | 3300026142 | Bacteria | 8796 |
| 307 | Ga0207698_10891577 | 3300026142 | Bacteria | 896 |
| 308 | Ga0209371_1006254 | 3300027312 | Bacteria | 4457 |
| 309 | Ga0209588_1054254 | 3300027671 | Bacteria | 1296 |
| 310 | Ga0207428_10004845 | 3300027907 | Bacteria | 12695 |
| 311 | Ga0207428_10055568 | 3300027907 | Bacteria | 3147 |
| 312 | Ga0268266_10074782 | 3300028379 | Bacteria | 2942 |
| 313 | Ga0268265_10287935 | 3300028380 | Bacteria | 1473 |
| 314 | Ga0268264_10028286 | 3300028381 | Bacteria | 4584 |
| 315 | Ga0265318_10001430 | 3300028577 | Bacteria | 14112 |
| 316 | Ga0268256_1006273 | 3300030500 | Bacteria | 4457 |
| 317 | Ga0265332_10018681 | 3300031238 | Bacteria | 3059 |
| 318 | Ga0265328_10002460 | 3300031239 | Bacteria | 8309 |
| 319 | Ga0265320_10142359 | 3300031240 | Bacteria | 1085 |
| 320 | Ga0265329_10013792 | 3300031242 | Bacteria | 2868 |
| 321 | Ga0265339_10122823 | 3300031249 | Bacteria | 1333 |
| 322 | Ga0265316_10014555 | 3300031344 | Bacteria | 6915 |
| 323 | Ga0265313_10112811 | 3300031595 | Bacteria | 1194 |
| 324 | Ga0265314_10012718 | 3300031711 | Bacteria | 6840 |
| 325 | Ga0265342_10004923 | 3300031712 | Bacteria | 10330 |
| 326 | Ga0316576_10158899 | 3300031727 | Bacteria | 1704 |
| 327 | Ga0307413_10029294 | 3300031824 | Bacteria | 3078 |
| 328 | Ga0307410_10388151 | 3300031852 | Bacteria | 1125 |
| 329 | Ga0307410_10391459 | 3300031852 | Bacteria | 1121 |
| 330 | Ga0307412_10000103 | 3300031911 | Bacteria | 69660 |
| 331 | Ga0307412_10465127 | 3300031911 | Bacteria | 1045 |
| 332 | Ga0307409_100190383 | 3300031995 | Bacteria | 1826 |
| 333 | Ga0307409_100781593 | 3300031995 | Bacteria | 961 |
| 334 | Ga0307416_100115291 | 3300032002 | Bacteria | 2379 |
| 335 | Ga0307416_100245045 | 3300032002 | Bacteria | 1740 |
| 336 | Ga0307416_100673711 | 3300032002 | Unclassified | 1121 |
| 337 | Ga0307411_10041286 | 3300032005 | Bacteria | 2934 |
| 338 | Ga0307411_10218274 | 3300032005 | Bacteria | 1478 |
| 339 | Ga0307411_10332570 | 3300032005 | Bacteria | 1231 |
| 340 | Ga0307415_100069001 | 3300032126 | Bacteria | 2477 |
| 341 | Ga0316583_10033196 | 3300032133 | Bacteria | 1834 |
| 342 | Ga0373930_0002275 | 3300034816 | Bacteria | 2962 |
| 343 | Ga0373934_0000134 | 3300035086 | Bacteria | 27424 |
| 344 | Ga0373936_0001857 | 3300035113 | Bacteria | 7791 |
| 345 | Ga0373939_0074227 | 3300035114 | Bacteria | 1115 |
| 346 | Ga0373953_0104292 | 3300035117 | Bacteria | 1195 |
| 347 | Ga0373954_0001992 | 3300035118 | Bacteria | 8475 |
| 348 | Ga0373954_0230579 | 3300035118 | Bacteria | 911 |
| 349 | Ga0373957_0057978 | 3300035120 | Bacteria | 1495 |
| 350 | Ga0373943_0038795 | 3300035170 | Bacteria | 2292 |
| 351 | Ga0373946_0191670 | 3300035171 | Bacteria | 975 |
| 352 | Ga0316574_0072706 | 3300035398 | Bacteria | 2174 |
| 353 | Ga0316574_0334024 | 3300035398 | Bacteria | 961 |
| 354 | Ga0373924_0002789 | 3300035410 | Bacteria | 5899 |
| 355 | Ga0373931_0051381 | 3300035691 | Bacteria | 2195 |
| 356 | Ga0373935_0002842 | 3300035692 | Bacteria | 9963 |
| 357 | Ga0373927_0004491 | 3300035695 | Bacteria | 9764 |
| 358 | Ga0373927_0364197 | 3300035695 | Bacteria | 953 |
| 359 | Ga0373933_0000564 | 3300035724 | Bacteria | 23136 |
| 360 | Ga0373937_0003219 | 3300036401 | Bacteria | 13673 |
| 361 | Ga0373937_0095014 | 3300036401 | Bacteria | 2764 |
| 362 | Ga0373937_0497750 | 3300036401 | Bacteria | 1158 |
| 363 | Ga0373925_0005318 | 3300037068 | Bacteria | 9608 |
| 364 | Ga0395899_0150468 | 3300037312 | Bacteria | 1650 |
| 365 | Ga0395900_0015015 | 3300037418 | Bacteria | 7895 |
| 366 | Ga0395900_0137624 | 3300037418 | Bacteria | 2502 |
| 367 | Ga0395900_0441732 | 3300037418 | Bacteria | 1258 |
| 368 | Ga0395898_0193597 | 3300037466 | Bacteria | 1943 |
| 369 | Ga0400484_09067 | 3300038725 | Bacteria | 19085 |
| 370 | Ga0400484_38990 | 3300038725 | Bacteria | 5367 |
| 371 | Ga0400490_45213 | 3300038726 | Bacteria | 1180 |
| 372 | Ga0400485_12422 | 3300038735 | Bacteria | 11435 |
| 373 | Ga0400488_34824 | 3300038741 | Bacteria | 2142 |
| 374 | Ga0400488_58574 | 3300038741 | Bacteria | 4343 |
| 375 | Ga0400486_10435 | 3300038742 | Bacteria | 11456 |
| 376 | Ga0400486_14629 | 3300038742 | Bacteria | 4667 |
| 377 | Ga0400486_16947 | 3300038742 | Bacteria | 3107 |
| 378 | Ga0400483_106185 | 3300039062 | Bacteria | 1548 |
| 379 | Ga0400483_241910 | 3300039062 | Bacteria | 3264 |
| 380 | Ga0400483_250707 | 3300039062 | Bacteria | 1652 |
| 381 | Ga0400483_252510 | 3300039062 | Bacteria | 2924 |
| 382 | Ga0400483_269845 | 3300039062 | Bacteria | 1321 |
| 383 | Ga0400489_59570 | 3300039093 | Bacteria | 26016 |
| 384 | Ga0400487_40481 | 3300039110 | Bacteria | 2729 |
| 385 | Ga0400487_49467 | 3300039110 | Bacteria | 4521 |
| 386 | Ga0439436_0043511 | 3300041404 | Bacteria | 1281 |
| 387 | Ga0439441_000687 | 3300042001 | Bacteria | 3905 |
| 388 | Ga0439441_025404 | 3300042001 | Bacteria | 1118 |
| 389 | Ga0451577_0001485 | 3300042876 | Bacteria | 31086 |
| 390 | Ga0451577_0019489 | 3300042876 | Bacteria | 6238 |
| 391 | Ga0451577_0055776 | 3300042876 | Bacteria | 3524 |
| 392 | Ga0453684_0001982 | 3300044712 | Bacteria | 52535 |
| 393 | Ga0466957_0026229 | 3300044842 | Bacteria | 3456 |
| 394 | Ga0451576_0001247 | 3300045051 | Bacteria | 44717 |
| 395 | Ga0451576_0176538 | 3300045051 | Bacteria | 2230 |
| 396 | Ga0451576_0371697 | 3300045051 | Bacteria | 1498 |
| 397 | Ga0451576_0646473 | 3300045051 | Bacteria | 1111 |
| 398 | Ga0495641_0002246 | 3300046461 | Bacteria | 15388 |
| 399 | Ga0495651_0000233 | 3300046462 | Bacteria | 42757 |
| 400 | Ga0495651_0000919 | 3300046462 | Bacteria | 22867 |
| 401 | Ga0495651_0212578 | 3300046462 | Bacteria | 1345 |
| 402 | Ga0495653_0006450 | 3300046463 | Bacteria | 9621 |
| 403 | Ga0495605_0112896 | 3300046474 | Bacteria | 1238 |
| 404 | Ga0495662_0008084 | 3300046476 | Bacteria | 5184 |
| 405 | Ga0495664_0253359 | 3300046477 | Bacteria | 1064 |
| 406 | Ga0495607_0000004 | 3300046501 | Bacteria | 317271 |
| 407 | Ga0495628_0000564 | 3300046516 | Bacteria | 34030 |
| 408 | Ga0495628_0006359 | 3300046516 | Bacteria | 10325 |
| 409 | Ga0495630_0003084 | 3300046517 | Bacteria | 11557 |
| 410 | Ga0495666_0009639 | 3300046526 | Bacteria | 4828 |
| 411 | Ga0495652_0157753 | 3300046529 | Bacteria | 1765 |
| 412 | Ga0495665_0012330 | 3300046531 | Bacteria | 4625 |
| 413 | Ga0495586_0004382 | 3300046535 | Bacteria | 7545 |
| 414 | Ga0495587_0141653 | 3300046536 | Bacteria | 1372 |
| 415 | Ga0495621_0068732 | 3300046539 | Bacteria | 1300 |
| 416 | Ga0495645_0038517 | 3300046543 | Bacteria | 3486 |
| 417 | Ga0495645_0129376 | 3300046543 | Bacteria | 1771 |
| 418 | Ga0495667_0002319 | 3300046559 | Bacteria | 12751 |
| 419 | Ga0495634_0022866 | 3300046642 | Bacteria | 4401 |
| 420 | Ga0495635_0020689 | 3300046663 | Bacteria | 4583 |
| 421 | Ga0495657_0007179 | 3300046675 | Bacteria | 8641 |
| 422 | Ga0495657_0061847 | 3300046675 | Bacteria | 2476 |
| 423 | Ga0495657_0126628 | 3300046675 | Bacteria | 1604 |
| 424 | Ga0495599_0009285 | 3300046678 | Bacteria | 6006 |
| 425 | Ga0495599_0048185 | 3300046678 | Bacteria | 2671 |
| 426 | Ga0495599_0114958 | 3300046678 | Bacteria | 1674 |
| 427 | Ga0495647_0004630 | 3300046681 | Bacteria | 4482 |
| 428 | Ga0495658_0248352 | 3300046683 | Bacteria | 1118 |
| 429 | Ga0495613_0006284 | 3300046689 | Bacteria | 8885 |
| 430 | Ga0495600_0012655 | 3300046809 | Bacteria | 5281 |
| 431 | Ga0495604_0088875 | 3300047317 | Bacteria | 2297 |
| 432 | Ga0495636_0002736 | 3300047318 | Bacteria | 6793 |
| 433 | Ga0495674_0003032 | 3300047319 | Bacteria | 16351 |
| 434 | Ga0495675_0001126 | 3300047444 | Bacteria | 16251 |
| 435 | Ga0495626_0066627 | 3300048091 | Bacteria | 1628 |
| 436 | Ga0496104_0005857 | 3300048907 | Bacteria | 10768 |
| 437 | Ga0496105_0249243 | 3300048908 | Bacteria | 1439 |
| 438 | Ga0496105_0519138 | 3300048908 | Bacteria | 933 |
| 439 | Ga0496105_0551363 | 3300048908 | Bacteria | 900 |
| 440 | Ga0496107_0630689 | 3300048910 | Bacteria | 791 |
| 441 | Ga0496110_0001107 | 3300048913 | Bacteria | 19019 |
| 442 | Ga0496110_0101430 | 3300048913 | Bacteria | 2580 |
| 443 | Ga0496111_0109792 | 3300048914 | Bacteria | 2031 |
| 444 | Ga0496111_0255539 | 3300048914 | Bacteria | 1300 |
| 445 | Ga0496113_0571001 | 3300048916 | Bacteria | 907 |
| 446 | Ga0496114_0341553 | 3300048917 | Bacteria | 1324 |
| 447 | Ga0496116_0025792 | 3300048919 | Bacteria | 4312 |
| 448 | Ga0496116_0047715 | 3300048919 | Bacteria | 2880 |
| 449 | Ga0496117_0030785 | 3300048920 | Bacteria | 4109 |
| 450 | Ga0496117_0036371 | 3300048920 | Bacteria | 3685 |
| 451 | Ga0496118_0003850 | 3300048921 | Bacteria | 18443 |
| 452 | Ga0496118_0023620 | 3300048921 | Bacteria | 5334 |
| 453 | Ga0496120_0007149 | 3300048923 | Bacteria | 8368 |
| 454 | Ga0496121_0000628 | 3300048924 | Bacteria | 65856 |
| 455 | Ga0496121_0027993 | 3300048924 | Bacteria | 5259 |
| 456 | Ga0496122_0000497 | 3300048925 | Bacteria | 81763 |
| 457 | Ga0496122_0152060 | 3300048925 | Bacteria | 1427 |
| 458 | Ga0496123_0000345 | 3300048926 | Bacteria | 87307 |
| 459 | Ga0496124_0159205 | 3300048927 | Bacteria | 1762 |
| 460 | Ga0496124_0258063 | 3300048927 | Bacteria | 1284 |
| 461 | Ga0496125_0000166 | 3300048928 | Bacteria | 147432 |
| 462 | Ga0496125_0008814 | 3300048928 | Bacteria | 10490 |
| 463 | Ga0496125_0025846 | 3300048928 | Bacteria | 5366 |
| 464 | Ga0496126_0024834 | 3300048929 | Bacteria | 5779 |
| 465 | Ga0501031_0037750 | 3300049568 | Bacteria | 3153 |
| 466 | Ga0501031_0046401 | 3300049568 | Bacteria | 2833 |
| 467 | Ga0501031_0055589 | 3300049568 | Bacteria | 2579 |
| 468 | Ga0501031_0062748 | 3300049568 | Bacteria | 2421 |
| 469 | Ga0501032_0198254 | 3300049569 | Bacteria | 1311 |
| 470 | Ga0501033_0002713 | 3300049570 | Bacteria | 14848 |
| 471 | Ga0501033_0020221 | 3300049570 | Bacteria | 5032 |
| 472 | Ga0501033_0372356 | 3300049570 | Bacteria | 998 |
| 473 | Ga0501034_0004039 | 3300049571 | Bacteria | 16467 |
| 474 | Ga0501034_0066184 | 3300049571 | Bacteria | 3626 |
| 475 | Ga0501034_0088738 | 3300049571 | Bacteria | 3090 |
| 476 | Ga0501034_0350073 | 3300049571 | Bacteria | 1406 |
| 477 | Ga0501036_0000051 | 3300049572 | Bacteria | 75057 |
| 478 | Ga0501036_0014674 | 3300049572 | Bacteria | 6530 |
| 479 | Ga0501037_0001916 | 3300049573 | Bacteria | 15094 |
| 480 | Ga0501038_0001036 | 3300049574 | Bacteria | 25087 |
| 481 | Ga0501038_0036633 | 3300049574 | Bacteria | 4304 |
| 482 | Ga0501038_0088337 | 3300049574 | Bacteria | 2602 |
| 483 | Ga0501039_0202412 | 3300049575 | Bacteria | 1561 |
| 484 | Ga0501040_0044772 | 3300049576 | Bacteria | 3018 |
| 485 | Ga0501041_0219550 | 3300049577 | Bacteria | 1193 |
| 486 | Ga0501042_0046528 | 3300049578 | Bacteria | 3093 |
| 487 | Ga0501043_0002694 | 3300049579 | Bacteria | 14897 |
| 488 | Ga0501043_0059752 | 3300049579 | Bacteria | 2992 |
| 489 | Ga0501043_0072110 | 3300049579 | Bacteria | 2713 |
| 490 | Ga0501046_0000415 | 3300049580 | Bacteria | 42538 |
| 491 | Ga0501046_0083560 | 3300049580 | Bacteria | 2464 |
| 492 | Ga0501047_0001463 | 3300049581 | Bacteria | 23046 |
| 493 | Ga0501047_0001927 | 3300049581 | Bacteria | 19951 |
| 494 | Ga0501048_0404226 | 3300049582 | Bacteria | 976 |
| 495 | Ga0501071_0010741 | 3300049587 | Bacteria | 6141 |
| 496 | Ga0501071_0028160 | 3300049587 | Bacteria | 3958 |
| 497 | Ga0501071_0249015 | 3300049587 | Bacteria | 1341 |
| 498 | Ga0501071_0350876 | 3300049587 | Bacteria | 1123 |
| 499 | Ga0501074_0165411 | 3300049590 | Bacteria | 1579 |
| 500 | Ga0501075_0016758 | 3300049591 | Bacteria | 5284 |
| 501 | Ga0501075_0332932 | 3300049591 | Bacteria | 1157 |
| 502 | Ga0501075_0394431 | 3300049591 | Bacteria | 1055 |
| 503 | Ga0501076_0015876 | 3300049592 | Bacteria | 5698 |
| 504 | Ga0501076_0067647 | 3300049592 | Bacteria | 2853 |
| 505 | Ga0501076_0156725 | 3300049592 | Bacteria | 1854 |
| 506 | Ga0501076_0380299 | 3300049592 | Bacteria | 1160 |
| 507 | Ga0501077_0017381 | 3300049593 | Bacteria | 4539 |
| 508 | Ga0501209_001220 | 3300049656 | Bacteria | 3547 |
| 509 | Ga0501079_0106891 | 3300049741 | Bacteria | 2172 |
| 510 | Ga0501079_0270375 | 3300049741 | Bacteria | 1329 |
| 511 | Ga0501080_0095841 | 3300049742 | Bacteria | 2755 |
| 512 | Ga0501080_0511933 | 3300049742 | Bacteria | 1072 |
| 513 | Ga0501080_0586354 | 3300049742 | Bacteria | 991 |
| 514 | Ga0501035_0001342 | 3300049822 | Bacteria | 25362 |
| 515 | Ga0501035_0025887 | 3300049822 | Bacteria | 5376 |
| 516 | Ga0501035_0058236 | 3300049822 | Bacteria | 3444 |
| 517 | Ga0501035_0078604 | 3300049822 | Bacteria | 2914 |
| 518 | Ga0501035_0577385 | 3300049822 | Bacteria | 918 |
| 519 | Ga0501044_0002429 | 3300049823 | Bacteria | 21255 |
| 520 | Ga0501044_0016400 | 3300049823 | Bacteria | 7954 |
| 521 | Ga0501045_0004002 | 3300049824 | Bacteria | 10148 |
| 522 | nmdc:mga00v17_117887_c1 | 3300050491 | Bacteria | 1689 |
| 523 | nmdc:mga00v17_200704_c1 | 3300050491 | Bacteria | 1289 |
| 524 | nmdc:mga00v17_54228_c1 | 3300050491 | Bacteria | 2445 |
| 525 | nmdc:mga0k408_25491_c1 | 3300050493 | Bacteria | 2561 |
| 526 | nmdc:mga05p37_12648_c1 | 3300050507 | Bacteria | 10081 |
| 527 | nmdc:mga09592_313162_c1 | 3300050508 | Bacteria | 1360 |
| 528 | nmdc:mga09592_33913_c1 | 3300050508 | Bacteria | 4265 |
| 529 | nmdc:mga09592_72957_c1 | 3300050508 | Bacteria | 2916 |
| 530 | nmdc:mga0qj67_18270_c1 | 3300050509 | Bacteria | 5343 |
| 531 | nmdc:mga06r32_304961_c1 | 3300050510 | Bacteria | 1578 |
| 532 | nmdc:mga08y16_109961_c1 | 3300050511 | Bacteria | 2870 |
| 533 | nmdc:mga08y16_4855_c1 | 3300050511 | Bacteria | 14036 |
| 534 | nmdc:mga0n895_1336_c1 | 3300050512 | Bacteria | 18273 |
| 535 | nmdc:mga0n895_177484_c1 | 3300050512 | Bacteria | 2161 |
| 536 | nmdc:mga0rr50_1767_c1 | 3300050513 | Bacteria | 11933 |
| 537 | nmdc:mga0rr50_423900_c1 | 3300050513 | Bacteria | 1126 |
| 538 | nmdc:mga08x19_11854_c1 | 3300050514 | Bacteria | 5242 |
| 539 | nmdc:mga0a205_152119_c1 | 3300050515 | Bacteria | 2213 |
| 540 | nmdc:mga0a205_586678_c1 | 3300050515 | Bacteria | 968 |
| 541 | nmdc:mga0a205_649118_c1 | 3300050515 | Bacteria | 907 |
| 542 | Ga0495601_0029875 | 3300053077 | Bacteria | 3383 |
| 543 | Ga0495595_0000317 | 3300053084 | Bacteria | 18797 |
| 544 | Ga0495619_0001741 | 3300053085 | Bacteria | 14446 |
| 545 | Ga0500566_0247958 | 3300053094 | Bacteria | 868 |
| 546 | Ga0501084_0013768 | 3300054114 | Bacteria | 6694 |
| 547 | Ga0501082_0020828 | 3300060353 | Bacteria | 5655 |
| 548 | Ga0501082_0028434 | 3300060353 | Bacteria | 4816 |
| 549 | Ga0501082_0263932 | 3300060353 | Bacteria | 1498 |
| 550 | Ga0501082_0288962 | 3300060353 | Bacteria | 1428 |
| 551 | Ga0501082_0656135 | 3300060353 | Bacteria | 918 |
| 552 | Ga0530510_0005135 | 3300061734 | Bacteria | 9032 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042001 | Ga0439441_025404 | Ga0439441_025404_11_625 | 204 |
| 2 | 3300049591 | Ga0501075_0332932 | Ga0501075_0332932_11_652 | 210 |
| 3 | 3300060353 | Ga0501082_0288962 | Ga0501082_0288962_29_670 | 210 |
| 4 | iso_pu_bacteria | 2734482258 | 2735816396 | 239 |
| 5 | 3300014326 | Ga0157380_10002619 | Ga0157380_100026195 | 240 |
| 6 | 3300005295 | Ga0065707_10165357 | Ga0065707_101653571 | 241 |
| 7 | 3300005340 | Ga0070689_100133744 | Ga0070689_1001337442 | 241 |
| 8 | 3300005345 | Ga0070692_10238697 | Ga0070692_102386972 | 241 |
| 9 | 3300005440 | Ga0070705_100012308 | Ga0070705_1000123084 | 241 |
| 10 | 3300005518 | Ga0070699_100140535 | Ga0070699_1001405352 | 241 |
| 11 | 3300005549 | Ga0070704_100003984 | Ga0070704_1000039847 | 241 |
| 12 | 3300005549 | Ga0070704_100029000 | Ga0070704_1000290004 | 241 |
| 13 | 3300005577 | Ga0068857_101041002 | Ga0068857_1010410021 | 241 |
| 14 | 3300005617 | Ga0068859_100011579 | Ga0068859_1000115793 | 241 |
| 15 | 3300005840 | Ga0068870_10126032 | Ga0068870_101260322 | 241 |
| 16 | 3300005844 | Ga0068862_100637354 | Ga0068862_1006373542 | 241 |
| 17 | 3300006844 | Ga0075428_100026865 | Ga0075428_1000268651 | 241 |
| 18 | 3300006847 | Ga0075431_100037313 | Ga0075431_1000373136 | 241 |
| 19 | 3300006852 | Ga0075433_10329291 | Ga0075433_103292912 | 241 |
| 20 | 3300006880 | Ga0075429_100114050 | Ga0075429_1001140503 | 241 |
| 21 | 3300006880 | Ga0075429_100150302 | Ga0075429_1001503022 | 241 |
| 22 | 3300006931 | Ga0097620_100011579 | Ga0097620_1000115793 | 241 |
| 23 | 3300007076 | Ga0075435_100371975 | Ga0075435_1003719752 | 241 |
| 24 | 3300009094 | Ga0111539_10413049 | Ga0111539_104130492 | 241 |
| 25 | 3300009147 | Ga0114129_10377692 | Ga0114129_103776922 | 241 |
| 26 | 3300009553 | Ga0105249_10262863 | Ga0105249_102628631 | 241 |
| 27 | 3300025936 | Ga0207670_10079021 | Ga0207670_100790212 | 241 |
| 28 | 3300025961 | Ga0207712_10280777 | Ga0207712_102807772 | 241 |
| 29 | 3300026116 | Ga0207674_10097928 | Ga0207674_100979281 | 241 |
| 30 | 3300045051 | Ga0451576_0371697 | Ga0451576_0371697_663_1388 | 241 |
| 31 | 3300050507 | nmdc:mga05p37_12648_c1 | nmdc:mga05p37_12648_c1_464_1189 | 241 |
| 32 | 3300050508 | nmdc:mga09592_72957_c1 | nmdc:mga09592_72957_c1_1355_2080 | 241 |
| 33 | 3300050510 | nmdc:mga06r32_304961_c1 | nmdc:mga06r32_304961_c1_771_1496 | 241 |
| 34 | 3300050513 | nmdc:mga0rr50_423900_c1 | nmdc:mga0rr50_423900_c1_270_995 | 241 |
| 35 | iso_pu_bacteria | 8055225921 | 8055226245 | 242 |
| 36 | 3300005347 | Ga0070668_100021699 | Ga0070668_1000216993 | 243 |
| 37 | 3300005459 | Ga0068867_100070528 | Ga0068867_1000705282 | 243 |
| 38 | 3300005536 | Ga0070697_100147720 | Ga0070697_1001477201 | 243 |
| 39 | 3300005536 | Ga0070697_100259956 | Ga0070697_1002599561 | 243 |
| 40 | 3300006163 | Ga0070715_10118218 | Ga0070715_101182182 | 243 |
| 41 | 3300006914 | Ga0075436_100058806 | Ga0075436_1000588064 | 243 |
| 42 | 3300006914 | Ga0075436_100405512 | Ga0075436_1004055122 | 243 |
| 43 | 3300007265 | Ga0099794_10001720 | Ga0099794_100017204 | 243 |
| 44 | 3300013308 | Ga0157375_10415529 | Ga0157375_104155293 | 243 |
| 45 | 3300014326 | Ga0157380_10028796 | Ga0157380_100287962 | 243 |
| 46 | 3300025906 | Ga0207699_10172275 | Ga0207699_101722752 | 243 |
| 47 | 3300025917 | Ga0207660_10111741 | Ga0207660_101117412 | 243 |
| 48 | 3300025937 | Ga0207669_10035156 | Ga0207669_100351563 | 243 |
| 49 | 3300025940 | Ga0207691_10218365 | Ga0207691_102183652 | 243 |
| 50 | 3300025972 | Ga0207668_10426679 | Ga0207668_104266792 | 243 |
| 51 | 3300026089 | Ga0207648_10142275 | Ga0207648_101422752 | 243 |
| 52 | 3300032005 | Ga0307411_10218274 | Ga0307411_102182742 | 243 |
| 53 | 3300035086 | Ga0373934_0000134 | Ga0373934_0000134_10212_10943 | 243 |
| 54 | 3300035113 | Ga0373936_0001857 | Ga0373936_0001857_2533_3264 | 243 |
| 55 | 3300035117 | Ga0373953_0104292 | Ga0373953_0104292_251_982 | 243 |
| 56 | 3300035118 | Ga0373954_0001992 | Ga0373954_0001992_3363_4094 | 243 |
| 57 | 3300035118 | Ga0373954_0230579 | Ga0373954_0230579_146_877 | 243 |
| 58 | 3300035120 | Ga0373957_0057978 | Ga0373957_0057978_489_1220 | 243 |
| 59 | 3300035170 | Ga0373943_0038795 | Ga0373943_0038795_626_1357 | 243 |
| 60 | 3300035410 | Ga0373924_0002789 | Ga0373924_0002789_2647_3378 | 243 |
| 61 | 3300035692 | Ga0373935_0002842 | Ga0373935_0002842_4545_5276 | 243 |
| 62 | 3300035695 | Ga0373927_0004491 | Ga0373927_0004491_320_1051 | 243 |
| 63 | 3300035724 | Ga0373933_0000564 | Ga0373933_0000564_19207_19938 | 243 |
| 64 | 3300036401 | Ga0373937_0003219 | Ga0373937_0003219_11684_12415 | 243 |
| 65 | 3300046461 | Ga0495641_0002246 | Ga0495641_0002246_14078_14809 | 243 |
| 66 | 3300046462 | Ga0495651_0000233 | Ga0495651_0000233_24798_25529 | 243 |
| 67 | 3300046462 | Ga0495651_0000919 | Ga0495651_0000919_16143_16874 | 243 |
| 68 | 3300046463 | Ga0495653_0006450 | Ga0495653_0006450_161_892 | 243 |
| 69 | 3300046476 | Ga0495662_0008084 | Ga0495662_0008084_1183_1914 | 243 |
| 70 | 3300046477 | Ga0495664_0253359 | Ga0495664_0253359_33_764 | 243 |
| 71 | 3300046516 | Ga0495628_0006359 | Ga0495628_0006359_2647_3378 | 243 |
| 72 | 3300046517 | Ga0495630_0003084 | Ga0495630_0003084_5108_5839 | 243 |
| 73 | 3300046526 | Ga0495666_0009639 | Ga0495666_0009639_4050_4781 | 243 |
| 74 | 3300046531 | Ga0495665_0012330 | Ga0495665_0012330_3839_4570 | 243 |
| 75 | 3300046535 | Ga0495586_0004382 | Ga0495586_0004382_284_1015 | 243 |
| 76 | 3300046642 | Ga0495634_0022866 | Ga0495634_0022866_284_1015 | 243 |
| 77 | 3300046663 | Ga0495635_0020689 | Ga0495635_0020689_1329_2060 | 243 |
| 78 | 3300046675 | Ga0495657_0007179 | Ga0495657_0007179_41_772 | 243 |
| 79 | 3300046675 | Ga0495657_0061847 | Ga0495657_0061847_1386_2117 | 243 |
| 80 | 3300046678 | Ga0495599_0009285 | Ga0495599_0009285_877_1608 | 243 |
| 81 | 3300046678 | Ga0495599_0048185 | Ga0495599_0048185_237_968 | 243 |
| 82 | 3300046681 | Ga0495647_0004630 | Ga0495647_0004630_3590_4321 | 243 |
| 83 | 3300046683 | Ga0495658_0248352 | Ga0495658_0248352_284_1015 | 243 |
| 84 | 3300046689 | Ga0495613_0006284 | Ga0495613_0006284_220_951 | 243 |
| 85 | 3300046809 | Ga0495600_0012655 | Ga0495600_0012655_3787_4518 | 243 |
| 86 | 3300047317 | Ga0495604_0088875 | Ga0495604_0088875_623_1354 | 243 |
| 87 | 3300047318 | Ga0495636_0002736 | Ga0495636_0002736_1496_2227 | 243 |
| 88 | 3300047319 | Ga0495674_0003032 | Ga0495674_0003032_8543_9274 | 243 |
| 89 | 3300047444 | Ga0495675_0001126 | Ga0495675_0001126_2342_3073 | 243 |
| 90 | 3300049656 | Ga0501209_001220 | Ga0501209_001220_556_1287 | 243 |
| 91 | 3300050493 | nmdc:mga0k408_25491_c1 | nmdc:mga0k408_25491_c1_1048_1779 | 243 |
| 92 | 3300050514 | nmdc:mga08x19_11854_c1 | nmdc:mga08x19_11854_c1_2171_2902 | 243 |
| 93 | 3300053084 | Ga0495595_0000317 | Ga0495595_0000317_4558_5289 | 243 |
| 94 | 3300053085 | Ga0495619_0001741 | Ga0495619_0001741_11121_11852 | 243 |
| 95 | 3300053094 | Ga0500566_0247958 | Ga0500566_0247958_14_745 | 243 |
| 96 | 3300005327 | Ga0070658_10038614 | Ga0070658_100386142 | 244 |
| 97 | 3300005328 | Ga0070676_10140338 | Ga0070676_101403382 | 244 |
| 98 | 3300005328 | Ga0070676_10354499 | Ga0070676_103544992 | 244 |
| 99 | 3300005329 | Ga0070683_100250872 | Ga0070683_1002508721 | 244 |
| 100 | 3300005329 | Ga0070683_100283544 | Ga0070683_1002835442 | 244 |
| 101 | 3300005334 | Ga0068869_100043956 | Ga0068869_1000439562 | 244 |
| 102 | 3300005334 | Ga0068869_100165829 | Ga0068869_1001658292 | 244 |
| 103 | 3300005335 | Ga0070666_10019243 | Ga0070666_100192435 | 244 |
| 104 | 3300005335 | Ga0070666_10022564 | Ga0070666_100225644 | 244 |
| 105 | 3300005339 | Ga0070660_100159519 | Ga0070660_1001595193 | 244 |
| 106 | 3300005340 | Ga0070689_100070088 | Ga0070689_1000700882 | 244 |
| 107 | 3300005344 | Ga0070661_100022098 | Ga0070661_1000220985 | 244 |
| 108 | 3300005347 | Ga0070668_100213894 | Ga0070668_1002138942 | 244 |
| 109 | 3300005347 | Ga0070668_100412177 | Ga0070668_1004121772 | 244 |
| 110 | 3300005353 | Ga0070669_100384937 | Ga0070669_1003849372 | 244 |
| 111 | 3300005354 | Ga0070675_100011290 | Ga0070675_1000112902 | 244 |
| 112 | 3300005354 | Ga0070675_100346649 | Ga0070675_1003466492 | 244 |
| 113 | 3300005355 | Ga0070671_100025228 | Ga0070671_1000252285 | 244 |
| 114 | 3300005356 | Ga0070674_100029049 | Ga0070674_1000290494 | 244 |
| 115 | 3300005364 | Ga0070673_100003959 | Ga0070673_1000039598 | 244 |
| 116 | 3300005364 | Ga0070673_100204382 | Ga0070673_1002043822 | 244 |
| 117 | 3300005365 | Ga0070688_100415606 | Ga0070688_1004156062 | 244 |
| 118 | 3300005367 | Ga0070667_100029724 | Ga0070667_1000297242 | 244 |
| 119 | 3300005438 | Ga0070701_10043261 | Ga0070701_100432613 | 244 |
| 120 | 3300005440 | Ga0070705_100366497 | Ga0070705_1003664972 | 244 |
| 121 | 3300005456 | Ga0070678_100072140 | Ga0070678_1000721402 | 244 |
| 122 | 3300005458 | Ga0070681_10012999 | Ga0070681_100129997 | 244 |
| 123 | 3300005459 | Ga0068867_100085086 | Ga0068867_1000850863 | 244 |
| 124 | 3300005467 | Ga0070706_100203339 | Ga0070706_1002033391 | 244 |
| 125 | 3300005468 | Ga0070707_100044433 | Ga0070707_1000444332 | 244 |
| 126 | 3300005543 | Ga0070672_100011362 | Ga0070672_1000113625 | 244 |
| 127 | 3300005543 | Ga0070672_100542727 | Ga0070672_1005427271 | 244 |
| 128 | 3300005544 | Ga0070686_100024252 | Ga0070686_1000242523 | 244 |
| 129 | 3300005577 | Ga0068857_100076682 | Ga0068857_1000766823 | 244 |
| 130 | 3300005616 | Ga0068852_100068965 | Ga0068852_1000689652 | 244 |
| 131 | 3300005617 | Ga0068859_100162687 | Ga0068859_1001626873 | 244 |
| 132 | 3300005618 | Ga0068864_100246641 | Ga0068864_1002466413 | 244 |
| 133 | 3300005718 | Ga0068866_10070956 | Ga0068866_100709561 | 244 |
| 134 | 3300005719 | Ga0068861_100071772 | Ga0068861_1000717721 | 244 |
| 135 | 3300005719 | Ga0068861_100199586 | Ga0068861_1001995862 | 244 |
| 136 | 3300005834 | Ga0068851_10002142 | Ga0068851_100021422 | 244 |
| 137 | 3300005841 | Ga0068863_100111412 | Ga0068863_1001114122 | 244 |
| 138 | 3300006237 | Ga0097621_100150406 | Ga0097621_1001504062 | 244 |
| 139 | 3300006237 | Ga0097621_100538199 | Ga0097621_1005381992 | 244 |
| 140 | 3300006358 | Ga0068871_100060002 | Ga0068871_1000600023 | 244 |
| 141 | 3300006844 | Ga0075428_100005442 | Ga0075428_10000544211 | 244 |
| 142 | 3300006852 | Ga0075433_10115381 | Ga0075433_101153813 | 244 |
| 143 | 3300006871 | Ga0075434_100000011 | Ga0075434_10000001155 | 244 |
| 144 | 3300006880 | Ga0075429_100222786 | Ga0075429_1002227863 | 244 |
| 145 | 3300006931 | Ga0097620_100162693 | Ga0097620_1001626933 | 244 |
| 146 | 3300007076 | Ga0075435_100003109 | Ga0075435_10000310910 | 244 |
| 147 | 3300009093 | Ga0105240_10203168 | Ga0105240_102031682 | 244 |
| 148 | 3300009093 | Ga0105240_10912210 | Ga0105240_109122102 | 244 |
| 149 | 3300009094 | Ga0111539_10000625 | Ga0111539_1000062523 | 244 |
| 150 | 3300009148 | Ga0105243_10013102 | Ga0105243_100131025 | 244 |
| 151 | 3300009174 | Ga0105241_10557618 | Ga0105241_105576182 | 244 |
| 152 | 3300009176 | Ga0105242_10018901 | Ga0105242_100189015 | 244 |
| 153 | 3300009177 | Ga0105248_10083321 | Ga0105248_100833213 | 244 |
| 154 | 3300009177 | Ga0105248_10114240 | Ga0105248_101142406 | 244 |
| 155 | 3300009177 | Ga0105248_10531122 | Ga0105248_105311222 | 244 |
| 156 | 3300009551 | Ga0105238_10070931 | Ga0105238_100709312 | 244 |
| 157 | 3300009551 | Ga0105238_10369651 | Ga0105238_103696512 | 244 |
| 158 | 3300009553 | Ga0105249_10136404 | Ga0105249_101364043 | 244 |
| 159 | 3300009553 | Ga0105249_10170647 | Ga0105249_101706473 | 244 |
| 160 | 3300013297 | Ga0157378_10029096 | Ga0157378_100290965 | 244 |
| 161 | 3300013297 | Ga0157378_10531455 | Ga0157378_105314552 | 244 |
| 162 | 3300013308 | Ga0157375_10005831 | Ga0157375_100058315 | 244 |
| 163 | 3300013308 | Ga0157375_10241644 | Ga0157375_102416443 | 244 |
| 164 | 3300014326 | Ga0157380_10034923 | Ga0157380_100349233 | 244 |
| 165 | 3300014326 | Ga0157380_10120187 | Ga0157380_101201872 | 244 |
| 166 | 3300014326 | Ga0157380_10330570 | Ga0157380_103305702 | 244 |
| 167 | 3300014326 | Ga0157380_10614064 | Ga0157380_106140642 | 244 |
| 168 | 3300014968 | Ga0157379_10019956 | Ga0157379_100199562 | 244 |
| 169 | 3300014968 | Ga0157379_10567252 | Ga0157379_105672522 | 244 |
| 170 | 3300014969 | Ga0157376_10510232 | Ga0157376_105102322 | 244 |
| 171 | 3300025315 | Ga0207697_10003881 | Ga0207697_100038815 | 244 |
| 172 | 3300025321 | Ga0207656_10045210 | Ga0207656_100452102 | 244 |
| 173 | 3300025893 | Ga0207682_10002916 | Ga0207682_100029168 | 244 |
| 174 | 3300025899 | Ga0207642_10020911 | Ga0207642_100209112 | 244 |
| 175 | 3300025903 | Ga0207680_10013971 | Ga0207680_100139713 | 244 |
| 176 | 3300025903 | Ga0207680_10021017 | Ga0207680_100210174 | 244 |
| 177 | 3300025909 | Ga0207705_10099620 | Ga0207705_100996202 | 244 |
| 178 | 3300025912 | Ga0207707_10008055 | Ga0207707_100080556 | 244 |
| 179 | 3300025913 | Ga0207695_10327053 | Ga0207695_103270532 | 244 |
| 180 | 3300025922 | Ga0207646_10536002 | Ga0207646_105360021 | 244 |
| 181 | 3300025923 | Ga0207681_10145648 | Ga0207681_101456482 | 244 |
| 182 | 3300025924 | Ga0207694_10547245 | Ga0207694_105472452 | 244 |
| 183 | 3300025925 | Ga0207650_10004155 | Ga0207650_100041557 | 244 |
| 184 | 3300025926 | Ga0207659_10046152 | Ga0207659_100461522 | 244 |
| 185 | 3300025931 | Ga0207644_10012447 | Ga0207644_100124474 | 244 |
| 186 | 3300025933 | Ga0207706_10011972 | Ga0207706_100119725 | 244 |
| 187 | 3300025935 | Ga0207709_10062289 | Ga0207709_100622891 | 244 |
| 188 | 3300025935 | Ga0207709_10434759 | Ga0207709_104347592 | 244 |
| 189 | 3300025936 | Ga0207670_10014439 | Ga0207670_100144394 | 244 |
| 190 | 3300025936 | Ga0207670_10040230 | Ga0207670_100402303 | 244 |
| 191 | 3300025937 | Ga0207669_10081821 | Ga0207669_100818212 | 244 |
| 192 | 3300025937 | Ga0207669_10562475 | Ga0207669_105624751 | 244 |
| 193 | 3300025938 | Ga0207704_10263683 | Ga0207704_102636832 | 244 |
| 194 | 3300025940 | Ga0207691_10001377 | Ga0207691_100013775 | 244 |
| 195 | 3300025940 | Ga0207691_10168399 | Ga0207691_101683993 | 244 |
| 196 | 3300025941 | Ga0207711_10482779 | Ga0207711_104827792 | 244 |
| 197 | 3300025942 | Ga0207689_10229037 | Ga0207689_102290373 | 244 |
| 198 | 3300025944 | Ga0207661_10067119 | Ga0207661_100671193 | 244 |
| 199 | 3300025945 | Ga0207679_10010038 | Ga0207679_100100382 | 244 |
| 200 | 3300025960 | Ga0207651_10121516 | Ga0207651_101215162 | 244 |
| 201 | 3300025960 | Ga0207651_10218018 | Ga0207651_102180182 | 244 |
| 202 | 3300025960 | Ga0207651_10495392 | Ga0207651_104953921 | 244 |
| 203 | 3300025961 | Ga0207712_10070305 | Ga0207712_100703053 | 244 |
| 204 | 3300026023 | Ga0207677_10000694 | Ga0207677_100006949 | 244 |
| 205 | 3300026023 | Ga0207677_10610415 | Ga0207677_106104152 | 244 |
| 206 | 3300026023 | Ga0207677_10726858 | Ga0207677_107268581 | 244 |
| 207 | 3300026035 | Ga0207703_10321418 | Ga0207703_103214182 | 244 |
| 208 | 3300026088 | Ga0207641_10145750 | Ga0207641_101457502 | 244 |
| 209 | 3300026089 | Ga0207648_10007583 | Ga0207648_100075833 | 244 |
| 210 | 3300026095 | Ga0207676_10245884 | Ga0207676_102458842 | 244 |
| 211 | 3300026118 | Ga0207675_100011155 | Ga0207675_1000111555 | 244 |
| 212 | 3300026118 | Ga0207675_100259752 | Ga0207675_1002597522 | 244 |
| 213 | 3300026121 | Ga0207683_10022020 | Ga0207683_100220203 | 244 |
| 214 | 3300026142 | Ga0207698_10004162 | Ga0207698_100041628 | 244 |
| 215 | 3300027907 | Ga0207428_10004845 | Ga0207428_100048457 | 244 |
| 216 | 3300028379 | Ga0268266_10074782 | Ga0268266_100747822 | 244 |
| 217 | 3300028577 | Ga0265318_10001430 | Ga0265318_100014308 | 244 |
| 218 | 3300031238 | Ga0265332_10018681 | Ga0265332_100186813 | 244 |
| 219 | 3300031239 | Ga0265328_10002460 | Ga0265328_100024608 | 244 |
| 220 | 3300031240 | Ga0265320_10142359 | Ga0265320_101423591 | 244 |
| 221 | 3300031242 | Ga0265329_10013792 | Ga0265329_100137922 | 244 |
| 222 | 3300031249 | Ga0265339_10122823 | Ga0265339_101228232 | 244 |
| 223 | 3300031344 | Ga0265316_10014555 | Ga0265316_100145554 | 244 |
| 224 | 3300031595 | Ga0265313_10112811 | Ga0265313_101128112 | 244 |
| 225 | 3300031711 | Ga0265314_10012718 | Ga0265314_100127185 | 244 |
| 226 | 3300031712 | Ga0265342_10004923 | Ga0265342_100049236 | 244 |
| 227 | 3300031852 | Ga0307410_10391459 | Ga0307410_103914592 | 244 |
| 228 | 3300031911 | Ga0307412_10465127 | Ga0307412_104651272 | 244 |
| 229 | 3300031995 | Ga0307409_100781593 | Ga0307409_1007815932 | 244 |
| 230 | 3300032002 | Ga0307416_100115291 | Ga0307416_1001152913 | 244 |
| 231 | 3300032005 | Ga0307411_10332570 | Ga0307411_103325701 | 244 |
| 232 | 3300032126 | Ga0307415_100069001 | Ga0307415_1000690014 | 244 |
| 233 | 3300034816 | Ga0373930_0002275 | Ga0373930_0002275_779_1513 | 244 |
| 234 | 3300035114 | Ga0373939_0074227 | Ga0373939_0074227_13_747 | 244 |
| 235 | 3300035171 | Ga0373946_0191670 | Ga0373946_0191670_208_942 | 244 |
| 236 | 3300035691 | Ga0373931_0051381 | Ga0373931_0051381_413_1147 | 244 |
| 237 | 3300036401 | Ga0373937_0497750 | Ga0373937_0497750_94_828 | 244 |
| 238 | 3300037068 | Ga0373925_0005318 | Ga0373925_0005318_8507_9241 | 244 |
| 239 | 3300042001 | Ga0439441_000687 | Ga0439441_000687_1018_1752 | 244 |
| 240 | 3300046462 | Ga0495651_0212578 | Ga0495651_0212578_225_959 | 244 |
| 241 | 3300046474 | Ga0495605_0112896 | Ga0495605_0112896_163_897 | 244 |
| 242 | 3300046516 | Ga0495628_0000564 | Ga0495628_0000564_980_1720 | 244 |
| 243 | 3300046529 | Ga0495652_0157753 | Ga0495652_0157753_743_1477 | 244 |
| 244 | 3300046539 | Ga0495621_0068732 | Ga0495621_0068732_270_1004 | 244 |
| 245 | 3300046543 | Ga0495645_0038517 | Ga0495645_0038517_2161_2901 | 244 |
| 246 | 3300046543 | Ga0495645_0129376 | Ga0495645_0129376_966_1700 | 244 |
| 247 | 3300046678 | Ga0495599_0114958 | Ga0495599_0114958_565_1305 | 244 |
| 248 | 3300048908 | Ga0496105_0519138 | Ga0496105_0519138_169_903 | 244 |
| 249 | 3300048910 | Ga0496107_0630689 | Ga0496107_0630689_23_757 | 244 |
| 250 | 3300048913 | Ga0496110_0001107 | Ga0496110_0001107_10634_11368 | 244 |
| 251 | 3300048914 | Ga0496111_0109792 | Ga0496111_0109792_194_928 | 244 |
| 252 | 3300048916 | Ga0496113_0571001 | Ga0496113_0571001_80_814 | 244 |
| 253 | 3300048917 | Ga0496114_0341553 | Ga0496114_0341553_362_1096 | 244 |
| 254 | 3300049568 | Ga0501031_0037750 | Ga0501031_0037750_2394_3128 | 244 |
| 255 | 3300049568 | Ga0501031_0055589 | Ga0501031_0055589_1440_2174 | 244 |
| 256 | 3300049574 | Ga0501038_0088337 | Ga0501038_0088337_278_1012 | 244 |
| 257 | 3300049577 | Ga0501041_0219550 | Ga0501041_0219550_41_775 | 244 |
| 258 | 3300049592 | Ga0501076_0380299 | Ga0501076_0380299_412_1146 | 244 |
| 259 | 3300049822 | Ga0501035_0058236 | Ga0501035_0058236_1645_2379 | 244 |
| 260 | 3300050508 | nmdc:mga09592_313162_c1 | nmdc:mga09592_313162_c1_535_1269 | 244 |
| 261 | 3300050511 | nmdc:mga08y16_4855_c1 | nmdc:mga08y16_4855_c1_9385_10119 | 244 |
| 262 | 3300050512 | nmdc:mga0n895_1336_c1 | nmdc:mga0n895_1336_c1_2831_3565 | 244 |
| 263 | 3300050513 | nmdc:mga0rr50_1767_c1 | nmdc:mga0rr50_1767_c1_7369_8103 | 244 |
| 264 | 3300050515 | nmdc:mga0a205_152119_c1 | nmdc:mga0a205_152119_c1_1290_2024 | 244 |
| 265 | 3300053077 | Ga0495601_0029875 | Ga0495601_0029875_370_1110 | 244 |
| 266 | 3300060353 | Ga0501082_0020828 | Ga0501082_0020828_68_802 | 244 |
| 267 | iso_pu_bacteria | 2602042047 | 2603641776 | 244 |
| 268 | iso_pu_bacteria | 2602042066 | 2603701434 | 244 |
| 269 | iso_pu_bacteria | 2602042067 | 2603706820 | 244 |
| 270 | iso_pu_bacteria | 2667528172 | 2671105810 | 244 |
| 271 | iso_pu_bacteria | 2681812866 | 2681995183 | 244 |
| 272 | iso_pu_bacteria | 2681812869 | 2682009987 | 244 |
| 273 | iso_pu_bacteria | 2711768156 | 2712471578 | 244 |
| 274 | iso_pu_bacteria | 2751185917 | 2753858040 | 244 |
| 275 | iso_pu_bacteria | 2765235842 | 2765591206 | 244 |
| 276 | iso_pu_bacteria | 2775506706 | 2775538407 | 244 |
| 277 | iso_pu_bacteria | 2821118458 | 2821122982 | 244 |
| 278 | iso_pu_bacteria | 2823373977 | 2823378529 | 244 |
| 279 | iso_pu_bacteria | 2844425489 | 2844429548 | 244 |
| 280 | iso_pu_bacteria | 2923634449 | 2923637058 | 244 |
| 281 | iso_pu_bacteria | 2927833300 | 2927836491 | 244 |
| 282 | iso_pu_bacteria | 2937539931 | 2937540969 | 244 |
| 283 | iso_pu_bacteria | 2939568625 | 2939572905 | 244 |
| 284 | iso_pu_bacteria | 2939642701 | 2939646881 | 244 |
| 285 | iso_pu_bacteria | 2974310843 | 2974314561 | 244 |
| 286 | iso_pu_bacteria | 8002745576 | 8002746956 | 244 |
| 287 | iso_pu_bacteria | 8018221730 | 8018224832 | 244 |
| 288 | iso_pu_bacteria | 8018405270 | 8018405476 | 244 |
| 289 | 3300005327 | Ga0070658_10007033 | Ga0070658_100070338 | 245 |
| 290 | 3300005338 | Ga0068868_100022580 | Ga0068868_1000225804 | 245 |
| 291 | 3300005353 | Ga0070669_100084565 | Ga0070669_1000845653 | 245 |
| 292 | 3300005356 | Ga0070674_100159431 | Ga0070674_1001594312 | 245 |
| 293 | 3300005436 | Ga0070713_100005849 | Ga0070713_1000058497 | 245 |
| 294 | 3300005441 | Ga0070700_100122762 | Ga0070700_1001227623 | 245 |
| 295 | 3300005456 | Ga0070678_100058374 | Ga0070678_1000583742 | 245 |
| 296 | 3300005459 | Ga0068867_100177470 | Ga0068867_1001774702 | 245 |
| 297 | 3300005536 | Ga0070697_100226496 | Ga0070697_1002264962 | 245 |
| 298 | 3300005563 | Ga0068855_100029680 | Ga0068855_1000296804 | 245 |
| 299 | 3300005616 | Ga0068852_100004709 | Ga0068852_1000047096 | 245 |
| 300 | 3300005617 | Ga0068859_100854986 | Ga0068859_1008549862 | 245 |
| 301 | 3300005719 | Ga0068861_100041979 | Ga0068861_1000419794 | 245 |
| 302 | 3300006173 | Ga0070716_100064441 | Ga0070716_1000644412 | 245 |
| 303 | 3300006175 | Ga0070712_100409810 | Ga0070712_1004098102 | 245 |
| 304 | 3300006237 | Ga0097621_100028370 | Ga0097621_1000283704 | 245 |
| 305 | 3300006237 | Ga0097621_100084532 | Ga0097621_1000845323 | 245 |
| 306 | 3300006358 | Ga0068871_100024831 | Ga0068871_1000248314 | 245 |
| 307 | 3300006358 | Ga0068871_100116835 | Ga0068871_1001168353 | 245 |
| 308 | 3300006881 | Ga0068865_100032279 | Ga0068865_1000322792 | 245 |
| 309 | 3300006931 | Ga0097620_100855022 | Ga0097620_1008550222 | 245 |
| 310 | 3300009093 | Ga0105240_10173408 | Ga0105240_101734085 | 245 |
| 311 | 3300009177 | Ga0105248_10153955 | Ga0105248_101539553 | 245 |
| 312 | 3300009177 | Ga0105248_10257199 | Ga0105248_102571995 | 245 |
| 313 | 3300013104 | Ga0157370_10008938 | Ga0157370_100089387 | 245 |
| 314 | 3300013296 | Ga0157374_10252172 | Ga0157374_102521722 | 245 |
| 315 | 3300013306 | Ga0163162_10105460 | Ga0163162_101054605 | 245 |
| 316 | 3300013306 | Ga0163162_10698221 | Ga0163162_106982212 | 245 |
| 317 | 3300013307 | Ga0157372_10434269 | Ga0157372_104342692 | 245 |
| 318 | 3300013308 | Ga0157375_10383433 | Ga0157375_103834333 | 245 |
| 319 | 3300014325 | Ga0163163_10799810 | Ga0163163_107998102 | 245 |
| 320 | 3300017792 | Ga0163161_10187541 | Ga0163161_101875413 | 245 |
| 321 | 3300025893 | Ga0207682_10021226 | Ga0207682_100212262 | 245 |
| 322 | 3300025909 | Ga0207705_10023581 | Ga0207705_100235813 | 245 |
| 323 | 3300025915 | Ga0207693_10440218 | Ga0207693_104402182 | 245 |
| 324 | 3300025931 | Ga0207644_10136868 | Ga0207644_101368682 | 245 |
| 325 | 3300025933 | Ga0207706_10092058 | Ga0207706_100920582 | 245 |
| 326 | 3300025934 | Ga0207686_10359371 | Ga0207686_103593712 | 245 |
| 327 | 3300025935 | Ga0207709_10046690 | Ga0207709_100466903 | 245 |
| 328 | 3300025937 | Ga0207669_10021005 | Ga0207669_100210053 | 245 |
| 329 | 3300025938 | Ga0207704_10125263 | Ga0207704_101252633 | 245 |
| 330 | 3300025949 | Ga0207667_10032498 | Ga0207667_100324983 | 245 |
| 331 | 3300026023 | Ga0207677_10011458 | Ga0207677_100114585 | 245 |
| 332 | 3300026067 | Ga0207678_10038123 | Ga0207678_100381234 | 245 |
| 333 | 3300026075 | Ga0207708_10166700 | Ga0207708_101667003 | 245 |
| 334 | 3300026075 | Ga0207708_10186867 | Ga0207708_101868673 | 245 |
| 335 | 3300026089 | Ga0207648_10046103 | Ga0207648_100461034 | 245 |
| 336 | 3300026121 | Ga0207683_10012470 | Ga0207683_100124703 | 245 |
| 337 | 3300026142 | Ga0207698_10891577 | Ga0207698_108915771 | 245 |
| 338 | 3300027671 | Ga0209588_1054254 | Ga0209588_10542542 | 245 |
| 339 | 3300028380 | Ga0268265_10287935 | Ga0268265_102879353 | 245 |
| 340 | 3300032002 | Ga0307416_100245045 | Ga0307416_1002450452 | 245 |
| 341 | 3300032133 | Ga0316583_10033196 | Ga0316583_100331962 | 245 |
| 342 | 3300035695 | Ga0373927_0364197 | Ga0373927_0364197_66_803 | 245 |
| 343 | 3300044712 | Ga0453684_0001982 | Ga0453684_0001982_28017_28763 | 245 |
| 344 | 3300045051 | Ga0451576_0176538 | Ga0451576_0176538_1060_1797 | 245 |
| 345 | 3300045051 | Ga0451576_0646473 | Ga0451576_0646473_156_893 | 245 |
| 346 | 3300046675 | Ga0495657_0126628 | Ga0495657_0126628_465_1202 | 245 |
| 347 | 3300048907 | Ga0496104_0005857 | Ga0496104_0005857_7278_8015 | 245 |
| 348 | 3300048908 | Ga0496105_0551363 | Ga0496105_0551363_70_807 | 245 |
| 349 | 3300048913 | Ga0496110_0101430 | Ga0496110_0101430_1512_2249 | 245 |
| 350 | 3300048914 | Ga0496111_0255539 | Ga0496111_0255539_32_769 | 245 |
| 351 | 3300049742 | Ga0501080_0095841 | Ga0501080_0095841_502_1239 | 245 |
| 352 | 3300050512 | nmdc:mga0n895_177484_c1 | nmdc:mga0n895_177484_c1_827_1564 | 245 |
| 353 | 3300050515 | nmdc:mga0a205_586678_c1 | nmdc:mga0a205_586678_c1_72_809 | 245 |
| 354 | 3300005336 | Ga0070680_100138758 | Ga0070680_1001387582 | 246 |
| 355 | 3300005340 | Ga0070689_100010523 | Ga0070689_1000105234 | 246 |
| 356 | 3300005340 | Ga0070689_100446496 | Ga0070689_1004464962 | 246 |
| 357 | 3300005341 | Ga0070691_10013529 | Ga0070691_100135293 | 246 |
| 358 | 3300005343 | Ga0070687_100053342 | Ga0070687_1000533422 | 246 |
| 359 | 3300005345 | Ga0070692_10004559 | Ga0070692_100045594 | 246 |
| 360 | 3300005356 | Ga0070674_100036503 | Ga0070674_1000365033 | 246 |
| 361 | 3300005437 | Ga0070710_10514635 | Ga0070710_105146351 | 246 |
| 362 | 3300005438 | Ga0070701_10008691 | Ga0070701_100086913 | 246 |
| 363 | 3300005441 | Ga0070700_100000758 | Ga0070700_1000007583 | 246 |
| 364 | 3300005444 | Ga0070694_100034598 | Ga0070694_1000345984 | 246 |
| 365 | 3300005456 | Ga0070678_100003117 | Ga0070678_1000031172 | 246 |
| 366 | 3300005459 | Ga0068867_100006064 | Ga0068867_1000060645 | 246 |
| 367 | 3300005544 | Ga0070686_100016080 | Ga0070686_1000160804 | 246 |
| 368 | 3300005546 | Ga0070696_100038676 | Ga0070696_1000386762 | 246 |
| 369 | 3300005549 | Ga0070704_100091644 | Ga0070704_1000916443 | 246 |
| 370 | 3300005615 | Ga0070702_100066675 | Ga0070702_1000666753 | 246 |
| 371 | 3300005617 | Ga0068859_100006763 | Ga0068859_1000067634 | 246 |
| 372 | 3300005718 | Ga0068866_10000263 | Ga0068866_1000026323 | 246 |
| 373 | 3300005719 | Ga0068861_100001018 | Ga0068861_1000010185 | 246 |
| 374 | 3300005840 | Ga0068870_10003609 | Ga0068870_100036093 | 246 |
| 375 | 3300005842 | Ga0068858_100002092 | Ga0068858_1000020928 | 246 |
| 376 | 3300005843 | Ga0068860_100016816 | Ga0068860_1000168165 | 246 |
| 377 | 3300005844 | Ga0068862_100000835 | Ga0068862_10000083518 | 246 |
| 378 | 3300006237 | Ga0097621_100002988 | Ga0097621_10000298811 | 246 |
| 379 | 3300006358 | Ga0068871_100002180 | Ga0068871_1000021805 | 246 |
| 380 | 3300006881 | Ga0068865_100000539 | Ga0068865_10000053918 | 246 |
| 381 | 3300006931 | Ga0097620_100006762 | Ga0097620_1000067627 | 246 |
| 382 | 3300009098 | Ga0105245_10002726 | Ga0105245_1000272614 | 246 |
| 383 | 3300009148 | Ga0105243_10001210 | Ga0105243_100012109 | 246 |
| 384 | 3300009176 | Ga0105242_10000462 | Ga0105242_1000046210 | 246 |
| 385 | 3300009551 | Ga0105238_10232752 | Ga0105238_102327522 | 246 |
| 386 | 3300009553 | Ga0105249_10023789 | Ga0105249_100237893 | 246 |
| 387 | 3300013297 | Ga0157378_10011077 | Ga0157378_100110776 | 246 |
| 388 | 3300013306 | Ga0163162_10174291 | Ga0163162_101742912 | 246 |
| 389 | 3300014326 | Ga0157380_10009614 | Ga0157380_100096144 | 246 |
| 390 | 3300014968 | Ga0157379_10013625 | Ga0157379_100136254 | 246 |
| 391 | 3300025899 | Ga0207642_10014964 | Ga0207642_100149643 | 246 |
| 392 | 3300025908 | Ga0207643_10011438 | Ga0207643_100114383 | 246 |
| 393 | 3300025912 | Ga0207707_10515518 | Ga0207707_105155182 | 246 |
| 394 | 3300025918 | Ga0207662_10022779 | Ga0207662_100227793 | 246 |
| 395 | 3300025918 | Ga0207662_10099739 | Ga0207662_100997392 | 246 |
| 396 | 3300025927 | Ga0207687_10000891 | Ga0207687_100008917 | 246 |
| 397 | 3300025934 | Ga0207686_10010153 | Ga0207686_100101534 | 246 |
| 398 | 3300025934 | Ga0207686_10194618 | Ga0207686_101946183 | 246 |
| 399 | 3300025935 | Ga0207709_10008636 | Ga0207709_100086363 | 246 |
| 400 | 3300025936 | Ga0207670_10015164 | Ga0207670_100151642 | 246 |
| 401 | 3300025937 | Ga0207669_10039461 | Ga0207669_100394613 | 246 |
| 402 | 3300025938 | Ga0207704_10001006 | Ga0207704_100010068 | 246 |
| 403 | 3300025942 | Ga0207689_10000044 | Ga0207689_1000004450 | 246 |
| 404 | 3300025949 | Ga0207667_10216674 | Ga0207667_102166742 | 246 |
| 405 | 3300025961 | Ga0207712_10014466 | Ga0207712_100144663 | 246 |
| 406 | 3300026035 | Ga0207703_10074426 | Ga0207703_100744262 | 246 |
| 407 | 3300026075 | Ga0207708_10000190 | Ga0207708_1000019041 | 246 |
| 408 | 3300026089 | Ga0207648_10000148 | Ga0207648_1000014848 | 246 |
| 409 | 3300026118 | Ga0207675_100000331 | Ga0207675_10000033117 | 246 |
| 410 | 3300026121 | Ga0207683_10007220 | Ga0207683_100072202 | 246 |
| 411 | 3300028381 | Ga0268264_10028286 | Ga0268264_100282864 | 246 |
| 412 | 3300036401 | Ga0373937_0095014 | Ga0373937_0095014_1961_2701 | 246 |
| 413 | 3300037312 | Ga0395899_0150468 | Ga0395899_0150468_248_988 | 246 |
| 414 | 3300037418 | Ga0395900_0137624 | Ga0395900_0137624_1131_1871 | 246 |
| 415 | 3300038725 | Ga0400484_09067 | Ga0400484_09067_10272_11021 | 246 |
| 416 | 3300038725 | Ga0400484_38990 | Ga0400484_38990_1654_2403 | 246 |
| 417 | 3300038726 | Ga0400490_45213 | Ga0400490_45213_80_829 | 246 |
| 418 | 3300038735 | Ga0400485_12422 | Ga0400485_12422_7301_8050 | 246 |
| 419 | 3300038741 | Ga0400488_34824 | Ga0400488_34824_206_955 | 246 |
| 420 | 3300038741 | Ga0400488_58574 | Ga0400488_58574_2299_3048 | 246 |
| 421 | 3300038742 | Ga0400486_10435 | Ga0400486_10435_7323_8072 | 246 |
| 422 | 3300038742 | Ga0400486_14629 | Ga0400486_14629_762_1511 | 246 |
| 423 | 3300038742 | Ga0400486_16947 | Ga0400486_16947_1404_2153 | 246 |
| 424 | 3300039062 | Ga0400483_106185 | Ga0400483_106185_81_830 | 246 |
| 425 | 3300039062 | Ga0400483_241910 | Ga0400483_241910_2374_3123 | 246 |
| 426 | 3300039062 | Ga0400483_250707 | Ga0400483_250707_789_1538 | 246 |
| 427 | 3300039062 | Ga0400483_252510 | Ga0400483_252510_1703_2452 | 246 |
| 428 | 3300039062 | Ga0400483_269845 | Ga0400483_269845_265_1014 | 246 |
| 429 | 3300039093 | Ga0400489_59570 | Ga0400489_59570_25135_25884 | 246 |
| 430 | 3300039110 | Ga0400487_40481 | Ga0400487_40481_679_1428 | 246 |
| 431 | 3300039110 | Ga0400487_49467 | Ga0400487_49467_492_1241 | 246 |
| 432 | 3300042876 | Ga0451577_0001485 | Ga0451577_0001485_13359_14165 | 246 |
| 433 | 3300042876 | Ga0451577_0019489 | Ga0451577_0019489_5306_6091 | 246 |
| 434 | 3300042876 | Ga0451577_0055776 | Ga0451577_0055776_1080_1826 | 246 |
| 435 | 3300045051 | Ga0451576_0001247 | Ga0451576_0001247_17202_17987 | 246 |
| 436 | 3300046536 | Ga0495587_0141653 | Ga0495587_0141653_509_1249 | 246 |
| 437 | 3300046559 | Ga0495667_0002319 | Ga0495667_0002319_3999_4739 | 246 |
| 438 | 3300049592 | Ga0501076_0067647 | Ga0501076_0067647_1901_2644 | 246 |
| 439 | 3300044842 | Ga0466957_0026229 | Ga0466957_0026229_1621_2364 | 247 |
| 440 | 3300003320 | rootH2_10019123 | rootH2_1001912317 | 248 |
| 441 | 3300005289 | Ga0065704_10000585 | Ga0065704_1000058517 | 248 |
| 442 | 3300005981 | Ga0081538_10004229 | Ga0081538_100042295 | 248 |
| 443 | 3300026089 | Ga0207648_10446362 | Ga0207648_104463622 | 248 |
| 444 | 3300049568 | Ga0501031_0046401 | Ga0501031_0046401_139_921 | 248 |
| 445 | 3300049569 | Ga0501032_0198254 | Ga0501032_0198254_432_1214 | 248 |
| 446 | 3300049572 | Ga0501036_0014674 | Ga0501036_0014674_2482_3264 | 248 |
| 447 | 3300049574 | Ga0501038_0036633 | Ga0501038_0036633_1156_1938 | 248 |
| 448 | 3300049576 | Ga0501040_0044772 | Ga0501040_0044772_1315_2097 | 248 |
| 449 | 3300049578 | Ga0501042_0046528 | Ga0501042_0046528_61_843 | 248 |
| 450 | 3300049579 | Ga0501043_0072110 | Ga0501043_0072110_1725_2507 | 248 |
| 451 | 3300049580 | Ga0501046_0083560 | Ga0501046_0083560_1594_2376 | 248 |
| 452 | 3300049587 | Ga0501071_0010741 | Ga0501071_0010741_4229_5011 | 248 |
| 453 | 3300049587 | Ga0501071_0249015 | Ga0501071_0249015_487_1269 | 248 |
| 454 | 3300049590 | Ga0501074_0165411 | Ga0501074_0165411_567_1349 | 248 |
| 455 | 3300049591 | Ga0501075_0016758 | Ga0501075_0016758_3075_3857 | 248 |
| 456 | 3300049591 | Ga0501075_0394431 | Ga0501075_0394431_258_1040 | 248 |
| 457 | 3300049592 | Ga0501076_0015876 | Ga0501076_0015876_898_1680 | 248 |
| 458 | 3300049592 | Ga0501076_0156725 | Ga0501076_0156725_995_1777 | 248 |
| 459 | 3300049593 | Ga0501077_0017381 | Ga0501077_0017381_555_1337 | 248 |
| 460 | 3300049741 | Ga0501079_0106891 | Ga0501079_0106891_153_935 | 248 |
| 461 | 3300049822 | Ga0501035_0078604 | Ga0501035_0078604_1107_1889 | 248 |
| 462 | 3300049824 | Ga0501045_0004002 | Ga0501045_0004002_596_1378 | 248 |
| 463 | 3300054114 | Ga0501084_0013768 | Ga0501084_0013768_1915_2697 | 248 |
| 464 | 3300060353 | Ga0501082_0028434 | Ga0501082_0028434_2196_2978 | 248 |
| 465 | 3300060353 | Ga0501082_0263932 | Ga0501082_0263932_234_1016 | 248 |
| 466 | 3300060353 | Ga0501082_0656135 | Ga0501082_0656135_116_898 | 248 |
| 467 | 3300061734 | Ga0530510_0005135 | Ga0530510_0005135_5849_6631 | 248 |
| 468 | 3300009545 | Ga0105237_10033220 | Ga0105237_100332203 | 249 |
| 469 | 3300005466 | Ga0070685_10115923 | Ga0070685_101159232 | 250 |
| 470 | iso_pu_bacteria | 2887375801 | 2887376849 | 250 |
| 471 | 3300005337 | Ga0070682_100018065 | Ga0070682_1000180653 | 251 |
| 472 | 3300005985 | Ga0081539_10105142 | Ga0081539_101051422 | 251 |
| 473 | 3300031824 | Ga0307413_10029294 | Ga0307413_100292943 | 251 |
| 474 | 3300031852 | Ga0307410_10388151 | Ga0307410_103881512 | 251 |
| 475 | 3300031995 | Ga0307409_100190383 | Ga0307409_1001903833 | 251 |
| 476 | 3300032002 | Ga0307416_100673711 | Ga0307416_1006737112 | 251 |
| 477 | 3300032005 | Ga0307411_10041286 | Ga0307411_100412862 | 251 |
| 478 | 3300035398 | Ga0316574_0334024 | Ga0316574_0334024_183_947 | 251 |
| 479 | iso_pu_bacteria | 2855730933 | 2855735207 | 251 |
| 480 | iso_pu_bacteria | 2855767633 | 2855770991 | 251 |
| 481 | iso_pu_bacteria | 2881412998 | 2881418374 | 251 |
| 482 | iso_pu_bacteria | 2895511927 | 2895515820 | 251 |
| 483 | 3300006051 | Ga0075364_10015869 | Ga0075364_100158696 | 252 |
| 484 | 3300006844 | Ga0075428_100243273 | Ga0075428_1002432732 | 252 |
| 485 | 3300006852 | Ga0075433_10242990 | Ga0075433_102429902 | 252 |
| 486 | 3300031727 | Ga0316576_10158899 | Ga0316576_101588993 | 252 |
| 487 | 3300035398 | Ga0316574_0072706 | Ga0316574_0072706_258_1034 | 252 |
| 488 | 3300049587 | Ga0501071_0350876 | Ga0501071_0350876_327_1094 | 252 |
| 489 | 3300049742 | Ga0501080_0511933 | Ga0501080_0511933_114_881 | 252 |
| 490 | 3300050491 | nmdc:mga00v17_200704_c1 | nmdc:mga00v17_200704_c1_285_1052 | 252 |
| 491 | 3300050491 | nmdc:mga00v17_54228_c1 | nmdc:mga00v17_54228_c1_541_1308 | 252 |
| 492 | 3300050515 | nmdc:mga0a205_649118_c1 | nmdc:mga0a205_649118_c1_30_797 | 252 |
| 493 | iso_pu_bacteria | 2599185292 | 2599904743 | 252 |
| 494 | iso_pu_bacteria | 2643221569 | 2643861286 | 252 |
| 495 | iso_pu_bacteria | 2643221594 | 2643983069 | 252 |
| 496 | iso_pu_bacteria | 2643221621 | 2644120599 | 252 |
| 497 | iso_pu_bacteria | 2808606395 | 2809032838 | 252 |
| 498 | iso_pu_bacteria | 2857537821 | 2857540648 | 252 |
| 499 | iso_pu_bacteria | 2858950400 | 2858956333 | 252 |
| 500 | iso_pu_bacteria | 2941479691 | 2941482937 | 252 |
| 501 | iso_pu_bacteria | 8002392321 | 8002395670 | 252 |
| 502 | 3300005347 | Ga0070668_100019415 | Ga0070668_1000194153 | 253 |
| 503 | 3300005438 | Ga0070701_10028989 | Ga0070701_100289891 | 253 |
| 504 | 3300005441 | Ga0070700_100022402 | Ga0070700_1000224023 | 253 |
| 505 | 3300005441 | Ga0070700_100212520 | Ga0070700_1002125201 | 253 |
| 506 | 3300005549 | Ga0070704_100040506 | Ga0070704_1000405063 | 253 |
| 507 | 3300005719 | Ga0068861_100034016 | Ga0068861_1000340164 | 253 |
| 508 | 3300005844 | Ga0068862_100047704 | Ga0068862_1000477044 | 253 |
| 509 | 3300006844 | Ga0075428_100002299 | Ga0075428_10000229921 | 253 |
| 510 | 3300006880 | Ga0075429_100056565 | Ga0075429_1000565652 | 253 |
| 511 | 3300009094 | Ga0111539_10006426 | Ga0111539_1000642613 | 253 |
| 512 | 3300014326 | Ga0157380_10046728 | Ga0157380_100467283 | 253 |
| 513 | 3300025917 | Ga0207660_10141848 | Ga0207660_101418482 | 253 |
| 514 | 3300026089 | Ga0207648_10071405 | Ga0207648_100714053 | 253 |
| 515 | 3300026116 | Ga0207674_10175895 | Ga0207674_101758953 | 253 |
| 516 | 3300026118 | Ga0207675_100002211 | Ga0207675_10000221110 | 253 |
| 517 | 3300026118 | Ga0207675_100143243 | Ga0207675_1001432432 | 253 |
| 518 | 3300027907 | Ga0207428_10055568 | Ga0207428_100555683 | 253 |
| 519 | 3300049587 | Ga0501071_0028160 | Ga0501071_0028160_1765_2535 | 253 |
| 520 | 3300049741 | Ga0501079_0270375 | Ga0501079_0270375_139_909 | 253 |
| 521 | 3300049742 | Ga0501080_0586354 | Ga0501080_0586354_148_918 | 253 |
| 522 | 3300050508 | nmdc:mga09592_33913_c1 | nmdc:mga09592_33913_c1_1918_2688 | 253 |
| 523 | 3300050509 | nmdc:mga0qj67_18270_c1 | nmdc:mga0qj67_18270_c1_2181_2951 | 253 |
| 524 | 3300050511 | nmdc:mga08y16_109961_c1 | nmdc:mga08y16_109961_c1_1175_1945 | 253 |
| 525 | 3300005539 | Ga0068853_100015312 | Ga0068853_1000153123 | 254 |
| 526 | 3300026041 | Ga0207639_10070782 | Ga0207639_100707822 | 254 |
| 527 | 3300026067 | Ga0207678_10173688 | Ga0207678_101736884 | 254 |
| 528 | 3300037418 | Ga0395900_0441732 | Ga0395900_0441732_435_1220 | 254 |
| 529 | 3300037466 | Ga0395898_0193597 | Ga0395898_0193597_496_1281 | 254 |
| 530 | 3300046501 | Ga0495607_0000004 | Ga0495607_0000004_118968_119756 | 254 |
| 531 | 3300048091 | Ga0495626_0066627 | Ga0495626_0066627_597_1385 | 254 |
| 532 | 3300049568 | Ga0501031_0062748 | Ga0501031_0062748_789_1553 | 254 |
| 533 | 3300049570 | Ga0501033_0002713 | Ga0501033_0002713_9971_10765 | 254 |
| 534 | 3300049570 | Ga0501033_0372356 | Ga0501033_0372356_94_858 | 254 |
| 535 | 3300049571 | Ga0501034_0004039 | Ga0501034_0004039_12011_12805 | 254 |
| 536 | 3300049571 | Ga0501034_0066184 | Ga0501034_0066184_1766_2581 | 254 |
| 537 | 3300049571 | Ga0501034_0350073 | Ga0501034_0350073_274_1044 | 254 |
| 538 | 3300049572 | Ga0501036_0000051 | Ga0501036_0000051_59321_60115 | 254 |
| 539 | 3300049573 | Ga0501037_0001916 | Ga0501037_0001916_5872_6666 | 254 |
| 540 | 3300049574 | Ga0501038_0001036 | Ga0501038_0001036_17655_18449 | 254 |
| 541 | 3300049579 | Ga0501043_0002694 | Ga0501043_0002694_3248_4042 | 254 |
| 542 | 3300049580 | Ga0501046_0000415 | Ga0501046_0000415_9445_10239 | 254 |
| 543 | 3300049581 | Ga0501047_0001927 | Ga0501047_0001927_4203_4997 | 254 |
| 544 | 3300049582 | Ga0501048_0404226 | Ga0501048_0404226_147_941 | 254 |
| 545 | 3300049822 | Ga0501035_0001342 | Ga0501035_0001342_15291_16085 | 254 |
| 546 | 3300049822 | Ga0501035_0577385 | Ga0501035_0577385_42_827 | 254 |
| 547 | 3300049823 | Ga0501044_0002429 | Ga0501044_0002429_9834_10628 | 254 |
| 548 | iso_pu_bacteria | 2739367655 | 2739611474 | 254 |
| 549 | iso_pu_bacteria | 2857576091 | 2857578833 | 254 |
| 550 | iso_pu_bacteria | 2881927736 | 2881931399 | 254 |
| 551 | 3300003187 | JGI25151J46595_10000170 | JGI25151J46595_1000017029 | 255 |
| 552 | 3300003763 | Ga0055529_1001572 | Ga0055529_10015724 | 255 |
| 553 | 3300006051 | Ga0075364_10006847 | Ga0075364_100068477 | 255 |
| 554 | 3300006051 | Ga0075364_10228407 | Ga0075364_102284072 | 255 |
| 555 | 3300009551 | Ga0105238_10610802 | Ga0105238_106108021 | 255 |
| 556 | 3300025242 | Ga0209258_102671 | Ga0209258_1026713 | 255 |
| 557 | 3300025272 | Ga0209455_1000477 | Ga0209455_100047715 | 255 |
| 558 | 3300025292 | Ga0209676_1002511 | Ga0209676_10025112 | 255 |
| 559 | 3300025294 | Ga0209025_1000071 | Ga0209025_100007140 | 255 |
| 560 | 3300025298 | Ga0209050_1002083 | Ga0209050_100208312 | 255 |
| 561 | 3300025924 | Ga0207694_10220169 | Ga0207694_102201692 | 255 |
| 562 | 3300027312 | Ga0209371_1006254 | Ga0209371_10062542 | 255 |
| 563 | 3300030500 | Ga0268256_1006273 | Ga0268256_10062734 | 255 |
| 564 | 3300031911 | Ga0307412_10000103 | Ga0307412_1000010344 | 255 |
| 565 | 3300037418 | Ga0395900_0015015 | Ga0395900_0015015_6870_7640 | 255 |
| 566 | 3300041404 | Ga0439436_0043511 | Ga0439436_0043511_261_1037 | 255 |
| 567 | 3300048908 | Ga0496105_0249243 | Ga0496105_0249243_249_1025 | 255 |
| 568 | 3300048919 | Ga0496116_0025792 | Ga0496116_0025792_283_1059 | 255 |
| 569 | 3300048919 | Ga0496116_0047715 | Ga0496116_0047715_1855_2631 | 255 |
| 570 | 3300048920 | Ga0496117_0030785 | Ga0496117_0030785_952_1728 | 255 |
| 571 | 3300048920 | Ga0496117_0036371 | Ga0496117_0036371_2689_3465 | 255 |
| 572 | 3300048921 | Ga0496118_0003850 | Ga0496118_0003850_15280_16056 | 255 |
| 573 | 3300048921 | Ga0496118_0023620 | Ga0496118_0023620_2887_3663 | 255 |
| 574 | 3300048923 | Ga0496120_0007149 | Ga0496120_0007149_2118_2894 | 255 |
| 575 | 3300048924 | Ga0496121_0000628 | Ga0496121_0000628_37688_38464 | 255 |
| 576 | 3300048924 | Ga0496121_0027993 | Ga0496121_0027993_739_1623 | 255 |
| 577 | 3300048925 | Ga0496122_0000497 | Ga0496122_0000497_73612_74388 | 255 |
| 578 | 3300048925 | Ga0496122_0152060 | Ga0496122_0152060_319_1095 | 255 |
| 579 | 3300048926 | Ga0496123_0000345 | Ga0496123_0000345_15952_16728 | 255 |
| 580 | 3300048927 | Ga0496124_0159205 | Ga0496124_0159205_703_1479 | 255 |
| 581 | 3300048927 | Ga0496124_0258063 | Ga0496124_0258063_250_1026 | 255 |
| 582 | 3300048928 | Ga0496125_0000166 | Ga0496125_0000166_7680_8456 | 255 |
| 583 | 3300048928 | Ga0496125_0008814 | Ga0496125_0008814_6993_7769 | 255 |
| 584 | 3300048928 | Ga0496125_0025846 | Ga0496125_0025846_2967_3743 | 255 |
| 585 | 3300048929 | Ga0496126_0024834 | Ga0496126_0024834_3977_4753 | 255 |
| 586 | 3300049570 | Ga0501033_0020221 | Ga0501033_0020221_1433_2296 | 255 |
| 587 | 3300049571 | Ga0501034_0088738 | Ga0501034_0088738_1906_2769 | 255 |
| 588 | 3300049575 | Ga0501039_0202412 | Ga0501039_0202412_440_1303 | 255 |
| 589 | 3300049579 | Ga0501043_0059752 | Ga0501043_0059752_996_1859 | 255 |
| 590 | 3300049581 | Ga0501047_0001463 | Ga0501047_0001463_21123_21986 | 255 |
| 591 | 3300049822 | Ga0501035_0025887 | Ga0501035_0025887_934_1797 | 255 |
| 592 | 3300049823 | Ga0501044_0016400 | Ga0501044_0016400_3733_4596 | 255 |
| 593 | 3300050491 | nmdc:mga00v17_117887_c1 | nmdc:mga00v17_117887_c1_286_1053 | 255 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.9445 | 38 | 253 |
| 4obx-assembly1.cif.gz_B | crystal structure of yeast coq5 in the apo form | 0.867 | 38 | 253 |
| 3dh0-assembly1.cif.gz_A | crystal structure of a sam dependent methyltransferase from aquifex aeolicus | 0.8517 | 58 | 253 |
| 3ege-assembly1.cif.gz_A | crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution | 0.8167 | 58 | 241 |
| 1dus-assembly1.cif.gz_A | mj0882-a hypothetical protein from m. jannaschii | 0.8082 | 66 | 254 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9863 | 38 | 253 | 3.40.50.150 |
| af_Q9VYF8_68_301_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9672 | 38 | 254 | 3.40.50.150 |
| af_Q4E3J0_145_404_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9656 | 70 | 131 | 3.40.50.150 |
| af_P0A887_31_251_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9599 | 38 | 253 | 3.40.50.150 |
| af_Q3ED65_41_261_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9533 | 38 | 253 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V5PGH2-F1-model_v4 | Class I SAM-dependent methyltransferase | 0.9873 | 10 | 214 |
GO:0008425
GO:0009234 GO:0032259 |
| AF-A0A6A5KTX5-F1-model_v4 | deleted | 0.9842 | 11 | 254 |
|
| AF-A0A2E2SF17-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9815 | 11 | 253 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
| AF-A0A848S207-F1-model_v4 | Demethylmenaquinone methyltransferase (EC 2.1.1.163) | 0.9674 | 42 | 252 |
GO:0009234
GO:0032259 GO:0043770 |
| AF-A0A2N3PMG6-F1-model_v4 | Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) | 0.9653 | 16 | 255 |
GO:0008425
GO:0009060 GO:0009234 GO:0032259 GO:0043770 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar