F467273

General Info

Members Datasets Scaffolds Average Seq Length
593 343 552 248

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0027993|Ga0496121_0027993_739_1623
Length 294
Sequence MAVIFQVCDVLCSDAPYAGVKGTPIGYHTRLIRESIMQNPSSVPPGDTSSPGTTHFGFKTVQETEKAGKVAEVFHSVASRYDVMNDLMSGGMHRIWKAFTIGRAAVRPGMKVLDIAGGTGDLARAFARRAGPDGQVWLTDINDSMLRVGRDRLADNGLLLPLAVCDAERLPFPSGYFDRVSVAFGLRNMTHKDRALAEMTRVLKPGGKLLVLEFSRVAKPLAPVYDWYSFNVLPWLGRKVAKDEASYRYLAESIRMHPDQETLAGMLRDAGLERVQYFNLSAGVVALHEGVRLT

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
3 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
4 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
5 2643221569 Achromobacter sp. Root565 Isolate Unclassified
6 2643221594 Achromobacter sp. Root170 Isolate Unclassified
7 2643221621 Achromobacter sp. Root83 Isolate Unclassified
8 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
9 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
10 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
11 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
12 2734482258 Glomeribacter sp. phylotype 3 Isolate Unclassified
13 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
14 2751185917 Enterobacter sp. HK169 Isolate Unclassified
15 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
16 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
17 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
18 2821118458 Enterobacter asburiae 609 Isolate Unclassified
19 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
20 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
21 2855730933 Achromobacter sp. HZ28 Isolate Nodule
22 2855767633 Achromobacter sp. HZ34 Isolate Nodule
23 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
24 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
25 2858950400 Achromobacter sp. K91 Isolate Unclassified
26 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
27 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
28 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
29 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
30 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
31 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
32 2937539931 Pantoea sp. LS15 Isolate Unclassified
33 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
34 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
35 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
36 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
37 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
38 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
39 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
40 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
45 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
46 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
51 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
52 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
53 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
54 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
57 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
60 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
61 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
64 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
65 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
71 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
72 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
73 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
74 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
75 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
76 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
77 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
78 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
79 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
80 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
81 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
85 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
86 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
87 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
88 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
89 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
90 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
91 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
97 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
100 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
101 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
102 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
104 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
105 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
106 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
107 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
108 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
111 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
112 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
113 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
114 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
115 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
116 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
117 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
118 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
119 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
120 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
121 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
122 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
123 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
124 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
125 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
128 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
129 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
130 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
131 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
132 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
136 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
196 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
197 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
198 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
199 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
200 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
201 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
202 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
203 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
204 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
205 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
209 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
210 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
211 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
212 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
213 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
214 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
217 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
222 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
223 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
224 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
230 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
232 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
233 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
234 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
235 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
236 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
237 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
238 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
239 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
240 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
241 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
242 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
243 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
244 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
245 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
246 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
247 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
248 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
275 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
276 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
282 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
283 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
284 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
289 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
290 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
291 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
315 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
316 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
317 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
318 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
324 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
325 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
326 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
327 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
334 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
335 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
339 8002392321 Alcaligenes faecalis Mc250 Isolate Rhizosphere
340 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
341 8018221730 Enterobacter sp. CM29 Isolate Unclassified
342 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
343 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.09
Metatranscriptomes 0
Isolates 6.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0.34
Rhizoplane 3.04
Rhizosphere 84.82
Stem 0
Stem Tuber 0
Unclassified 9.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25151J46595_10000170 3300003187 Bacteria 84454
2 rootH2_10019123 3300003320 Bacteria 25137
3 Ga0055529_1001572 3300003763 Bacteria 6387
4 Ga0065704_10000585 3300005289 Bacteria 32775
5 Ga0065707_10165357 3300005295 Bacteria 1527
6 Ga0070658_10007033 3300005327 Bacteria 9081
7 Ga0070658_10038614 3300005327 Bacteria 3849
8 Ga0070676_10140338 3300005328 Bacteria 1537
9 Ga0070676_10354499 3300005328 Bacteria 1009
10 Ga0070683_100250872 3300005329 Bacteria 1683
11 Ga0070683_100283544 3300005329 Bacteria 1576
12 Ga0068869_100043956 3300005334 Bacteria 3211
13 Ga0068869_100165829 3300005334 Bacteria 1723
14 Ga0070666_10019243 3300005335 Bacteria 4404
15 Ga0070666_10022564 3300005335 Bacteria 4088
16 Ga0070680_100138758 3300005336 Bacteria 2038
17 Ga0070682_100018065 3300005337 Bacteria 4116
18 Ga0068868_100022580 3300005338 Bacteria 4751
19 Ga0070660_100159519 3300005339 Bacteria 1817
20 Ga0070689_100010523 3300005340 Bacteria 6592
21 Ga0070689_100070088 3300005340 Bacteria 2736
22 Ga0070689_100133744 3300005340 Bacteria 1990
23 Ga0070689_100446496 3300005340 Bacteria 1100
24 Ga0070691_10013529 3300005341 Bacteria 3738
25 Ga0070687_100053342 3300005343 Bacteria 2102
26 Ga0070661_100022098 3300005344 Bacteria 4550
27 Ga0070692_10004559 3300005345 Bacteria 5801
28 Ga0070692_10238697 3300005345 Bacteria 1082
29 Ga0070668_100019415 3300005347 Bacteria 5115
30 Ga0070668_100021699 3300005347 Bacteria 4851
31 Ga0070668_100213894 3300005347 Bacteria 1587
32 Ga0070668_100412177 3300005347 Bacteria 1155
33 Ga0070669_100084565 3300005353 Bacteria 2368
34 Ga0070669_100384937 3300005353 Bacteria 1144
35 Ga0070675_100011290 3300005354 Bacteria 6992
36 Ga0070675_100346649 3300005354 Bacteria 1316
37 Ga0070671_100025228 3300005355 Bacteria 4876
38 Ga0070674_100029049 3300005356 Bacteria 3637
39 Ga0070674_100036503 3300005356 Bacteria 3300
40 Ga0070674_100159431 3300005356 Bacteria 1710
41 Ga0070673_100003959 3300005364 Bacteria 9309
42 Ga0070673_100204382 3300005364 Bacteria 1702
43 Ga0070688_100415606 3300005365 Bacteria 999
44 Ga0070667_100029724 3300005367 Bacteria 4555
45 Ga0070713_100005849 3300005436 Bacteria 8456
46 Ga0070710_10514635 3300005437 Bacteria 821
47 Ga0070701_10008691 3300005438 Bacteria 4408
48 Ga0070701_10028989 3300005438 Bacteria 2725
49 Ga0070701_10043261 3300005438 Bacteria 2303
50 Ga0070705_100012308 3300005440 Bacteria 4346
51 Ga0070705_100366497 3300005440 Bacteria 1056
52 Ga0070700_100000758 3300005441 Bacteria 15945
53 Ga0070700_100022402 3300005441 Bacteria 3683
54 Ga0070700_100122762 3300005441 Bacteria 1743
55 Ga0070700_100212520 3300005441 Bacteria 1366
56 Ga0070694_100034598 3300005444 Bacteria 3333
57 Ga0070678_100003117 3300005456 Bacteria 9190
58 Ga0070678_100058374 3300005456 Bacteria 2832
59 Ga0070678_100072140 3300005456 Bacteria 2587
60 Ga0070681_10012999 3300005458 Bacteria 8267
61 Ga0068867_100006064 3300005459 Bacteria 8568
62 Ga0068867_100070528 3300005459 Bacteria 2613
63 Ga0068867_100085086 3300005459 Bacteria 2390
64 Ga0068867_100177470 3300005459 Bacteria 1691
65 Ga0070685_10115923 3300005466 Bacteria 1657
66 Ga0070706_100203339 3300005467 Bacteria 1850
67 Ga0070707_100044433 3300005468 Bacteria 4253
68 Ga0070699_100140535 3300005518 Bacteria 2132
69 Ga0070697_100147720 3300005536 Bacteria 1980
70 Ga0070697_100226496 3300005536 Bacteria 1594
71 Ga0070697_100259956 3300005536 Bacteria 1486
72 Ga0068853_100015312 3300005539 Bacteria 6302
73 Ga0070672_100011362 3300005543 Bacteria 6209
74 Ga0070672_100542727 3300005543 Bacteria 1009
75 Ga0070686_100016080 3300005544 Bacteria 4347
76 Ga0070686_100024252 3300005544 Bacteria 3634
77 Ga0070696_100038676 3300005546 Bacteria 3293
78 Ga0070704_100003984 3300005549 Bacteria 8516
79 Ga0070704_100029000 3300005549 Bacteria 3689
80 Ga0070704_100040506 3300005549 Bacteria 3207
81 Ga0070704_100091644 3300005549 Bacteria 2267
82 Ga0068855_100029680 3300005563 Bacteria 6537
83 Ga0068857_100076682 3300005577 Bacteria 2981
84 Ga0068857_101041002 3300005577 Bacteria 789
85 Ga0070702_100066675 3300005615 Bacteria 2112
86 Ga0068852_100004709 3300005616 Bacteria 9677
87 Ga0068852_100068965 3300005616 Bacteria 3097
88 Ga0068859_100006763 3300005617 Bacteria 11645
89 Ga0068859_100011579 3300005617 Bacteria 8871
90 Ga0068859_100162687 3300005617 Bacteria 2311
91 Ga0068859_100854986 3300005617 Bacteria 996
92 Ga0068864_100246641 3300005618 Bacteria 1656
93 Ga0068866_10000263 3300005718 Bacteria 24809
94 Ga0068866_10070956 3300005718 Bacteria 1840
95 Ga0068861_100001018 3300005719 Bacteria 17136
96 Ga0068861_100034016 3300005719 Bacteria 3765
97 Ga0068861_100041979 3300005719 Bacteria 3428
98 Ga0068861_100071772 3300005719 Bacteria 2684
99 Ga0068861_100199586 3300005719 Bacteria 1678
100 Ga0068851_10002142 3300005834 Bacteria 8674
101 Ga0068870_10003609 3300005840 Bacteria 6567
102 Ga0068870_10126032 3300005840 Bacteria 1481
103 Ga0068863_100111412 3300005841 Bacteria 2607
104 Ga0068858_100002092 3300005842 Bacteria 20289
105 Ga0068860_100016816 3300005843 Bacteria 7132
106 Ga0068862_100000835 3300005844 Bacteria 30463
107 Ga0068862_100047704 3300005844 Bacteria 3656
108 Ga0068862_100637354 3300005844 Bacteria 1027
109 Ga0081538_10004229 3300005981 Bacteria 13316
110 Ga0081539_10105142 3300005985 Bacteria 1431
111 Ga0075364_10006847 3300006051 Bacteria 6727
112 Ga0075364_10015869 3300006051 Bacteria 4675
113 Ga0075364_10228407 3300006051 Bacteria 1264
114 Ga0070715_10118218 3300006163 Bacteria 1260
115 Ga0070716_100064441 3300006173 Bacteria 2131
116 Ga0070712_100409810 3300006175 Bacteria 1121
117 Ga0097621_100002988 3300006237 Bacteria 11616
118 Ga0097621_100028370 3300006237 Bacteria 4411
119 Ga0097621_100084532 3300006237 Bacteria 2646
120 Ga0097621_100150406 3300006237 Bacteria 1996
121 Ga0097621_100538199 3300006237 Bacteria 1062
122 Ga0068871_100002180 3300006358 Bacteria 13302
123 Ga0068871_100024831 3300006358 Bacteria 4653
124 Ga0068871_100060002 3300006358 Bacteria 3101
125 Ga0068871_100116835 3300006358 Bacteria 2249
126 Ga0075428_100002299 3300006844 Bacteria 20682
127 Ga0075428_100005442 3300006844 Bacteria 14150
128 Ga0075428_100026865 3300006844 Bacteria 6374
129 Ga0075428_100243273 3300006844 Bacteria 1941
130 Ga0075431_100037313 3300006847 Bacteria 5007
131 Ga0075433_10115381 3300006852 Bacteria 2383
132 Ga0075433_10242990 3300006852 Bacteria 1598
133 Ga0075433_10329291 3300006852 Bacteria 1351
134 Ga0075434_100000011 3300006871 Bacteria 86261
135 Ga0075429_100056565 3300006880 Bacteria 3414
136 Ga0075429_100114050 3300006880 Bacteria 2362
137 Ga0075429_100150302 3300006880 Bacteria 2039
138 Ga0075429_100222786 3300006880 Bacteria 1652
139 Ga0068865_100000539 3300006881 Bacteria 21055
140 Ga0068865_100032279 3300006881 Bacteria 3497
141 Ga0075436_100058806 3300006914 Bacteria 2655
142 Ga0075436_100405512 3300006914 Bacteria 988
143 Ga0097620_100006762 3300006931 Bacteria 11645
144 Ga0097620_100011579 3300006931 Bacteria 8871
145 Ga0097620_100162693 3300006931 Bacteria 2311
146 Ga0097620_100855022 3300006931 Bacteria 996
147 Ga0075435_100003109 3300007076 Bacteria 11216
148 Ga0075435_100371975 3300007076 Bacteria 1227
149 Ga0099794_10001720 3300007265 Bacteria 7761
150 Ga0105240_10173408 3300009093 Bacteria 2552
151 Ga0105240_10203168 3300009093 Bacteria 2321
152 Ga0105240_10912210 3300009093 Bacteria 944
153 Ga0111539_10000625 3300009094 Bacteria 45822
154 Ga0111539_10006426 3300009094 Bacteria 15157
155 Ga0111539_10413049 3300009094 Bacteria 1572
156 Ga0105245_10002726 3300009098 Bacteria 15903
157 Ga0114129_10377692 3300009147 Bacteria 1872
158 Ga0105243_10001210 3300009148 Bacteria 23241
159 Ga0105243_10013102 3300009148 Bacteria 6266
160 Ga0105241_10557618 3300009174 Bacteria 1030
161 Ga0105242_10000462 3300009176 Bacteria 32275
162 Ga0105242_10018901 3300009176 Bacteria 5395
163 Ga0105248_10083321 3300009177 Bacteria 3597
164 Ga0105248_10114240 3300009177 Bacteria 3045
165 Ga0105248_10153955 3300009177 Bacteria 2594
166 Ga0105248_10257199 3300009177 Bacteria 1966
167 Ga0105248_10531122 3300009177 Bacteria 1327
168 Ga0105237_10033220 3300009545 Bacteria 5226
169 Ga0105238_10070931 3300009551 Bacteria 3482
170 Ga0105238_10232752 3300009551 Bacteria 1819
171 Ga0105238_10369651 3300009551 Bacteria 1424
172 Ga0105238_10610802 3300009551 Bacteria 1099
173 Ga0105249_10023789 3300009553 Bacteria 5502
174 Ga0105249_10136404 3300009553 Bacteria 2348
175 Ga0105249_10170647 3300009553 Bacteria 2109
176 Ga0105249_10262863 3300009553 Bacteria 1716
177 Ga0157370_10008938 3300013104 Bacteria 10762
178 Ga0157374_10252172 3300013296 Bacteria 1737
179 Ga0157378_10011077 3300013297 Bacteria 7892
180 Ga0157378_10029096 3300013297 Bacteria 4877
181 Ga0157378_10531455 3300013297 Bacteria 1179
182 Ga0163162_10105460 3300013306 Bacteria 2913
183 Ga0163162_10174291 3300013306 Bacteria 2276
184 Ga0163162_10698221 3300013306 Bacteria 1136
185 Ga0157372_10434269 3300013307 Bacteria 1530
186 Ga0157375_10005831 3300013308 Bacteria 10718
187 Ga0157375_10241644 3300013308 Bacteria 1965
188 Ga0157375_10383433 3300013308 Bacteria 1572
189 Ga0157375_10415529 3300013308 Bacteria 1511
190 Ga0163163_10799810 3300014325 Bacteria 1006
191 Ga0157380_10002619 3300014326 Bacteria 12174
192 Ga0157380_10009614 3300014326 Bacteria 6935
193 Ga0157380_10028796 3300014326 Bacteria 4240
194 Ga0157380_10034923 3300014326 Bacteria 3880
195 Ga0157380_10046728 3300014326 Bacteria 3402
196 Ga0157380_10120187 3300014326 Bacteria 2224
197 Ga0157380_10330570 3300014326 Bacteria 1417
198 Ga0157380_10614064 3300014326 Bacteria 1078
199 Ga0157379_10013625 3300014968 Bacteria 7124
200 Ga0157379_10019956 3300014968 Bacteria 5922
201 Ga0157379_10567252 3300014968 Bacteria 1057
202 Ga0157376_10510232 3300014969 Bacteria 1183
203 Ga0163161_10187541 3300017792 Bacteria 1588
204 Ga0209258_102671 3300025242 Bacteria 4395
205 Ga0209455_1000477 3300025272 Bacteria 29930
206 Ga0209676_1002511 3300025292 Bacteria 12842
207 Ga0209025_1000071 3300025294 Bacteria 287297
208 Ga0209050_1002083 3300025298 Bacteria 18319
209 Ga0207697_10003881 3300025315 Bacteria 7291
210 Ga0207656_10045210 3300025321 Bacteria 1884
211 Ga0207682_10002916 3300025893 Bacteria 7543
212 Ga0207682_10021226 3300025893 Bacteria 2554
213 Ga0207642_10014964 3300025899 Bacteria 2878
214 Ga0207642_10020911 3300025899 Bacteria 2565
215 Ga0207680_10013971 3300025903 Bacteria 4140
216 Ga0207680_10021017 3300025903 Bacteria 3525
217 Ga0207699_10172275 3300025906 Bacteria 1449
218 Ga0207643_10011438 3300025908 Bacteria 4793
219 Ga0207705_10023581 3300025909 Bacteria 4389
220 Ga0207705_10099620 3300025909 Bacteria 2137
221 Ga0207707_10008055 3300025912 Bacteria 9152
222 Ga0207707_10515518 3300025912 Bacteria 1019
223 Ga0207695_10327053 3300025913 Bacteria 1422
224 Ga0207693_10440218 3300025915 Bacteria 1019
225 Ga0207660_10111741 3300025917 Bacteria 2057
226 Ga0207660_10141848 3300025917 Bacteria 1837
227 Ga0207662_10022779 3300025918 Bacteria 3595
228 Ga0207662_10099739 3300025918 Bacteria 1798
229 Ga0207646_10536002 3300025922 Bacteria 1053
230 Ga0207681_10145648 3300025923 Bacteria 1769
231 Ga0207694_10220169 3300025924 Bacteria 1548
232 Ga0207694_10547245 3300025924 Bacteria 971
233 Ga0207650_10004155 3300025925 Bacteria 9894
234 Ga0207659_10046152 3300025926 Bacteria 3075
235 Ga0207687_10000891 3300025927 Bacteria 20278
236 Ga0207644_10012447 3300025931 Bacteria 5650
237 Ga0207644_10136868 3300025931 Bacteria 1882
238 Ga0207706_10011972 3300025933 Bacteria 7900
239 Ga0207706_10092058 3300025933 Bacteria 2666
240 Ga0207686_10010153 3300025934 Bacteria 5120
241 Ga0207686_10194618 3300025934 Bacteria 1448
242 Ga0207686_10359371 3300025934 Bacteria 1099
243 Ga0207709_10008636 3300025935 Bacteria 5627
244 Ga0207709_10046690 3300025935 Bacteria 2629
245 Ga0207709_10062289 3300025935 Bacteria 2334
246 Ga0207709_10434759 3300025935 Bacteria 1011
247 Ga0207670_10014439 3300025936 Bacteria 4688
248 Ga0207670_10015164 3300025936 Bacteria 4596
249 Ga0207670_10040230 3300025936 Bacteria 3068
250 Ga0207670_10079021 3300025936 Bacteria 2296
251 Ga0207669_10021005 3300025937 Bacteria 3437
252 Ga0207669_10035156 3300025937 Bacteria 2848
253 Ga0207669_10039461 3300025937 Bacteria 2729
254 Ga0207669_10081821 3300025937 Bacteria 2070
255 Ga0207669_10562475 3300025937 Bacteria 922
256 Ga0207704_10001006 3300025938 Bacteria 12508
257 Ga0207704_10125263 3300025938 Bacteria 1767
258 Ga0207704_10263683 3300025938 Bacteria 1300
259 Ga0207691_10001377 3300025940 Bacteria 24280
260 Ga0207691_10168399 3300025940 Bacteria 1919
261 Ga0207691_10218365 3300025940 Bacteria 1654
262 Ga0207711_10482779 3300025941 Bacteria 1154
263 Ga0207689_10000044 3300025942 Bacteria 92835
264 Ga0207689_10229037 3300025942 Bacteria 1536
265 Ga0207661_10067119 3300025944 Bacteria 2916
266 Ga0207679_10010038 3300025945 Bacteria 6085
267 Ga0207667_10032498 3300025949 Bacteria 5622
268 Ga0207667_10216674 3300025949 Bacteria 1962
269 Ga0207651_10121516 3300025960 Bacteria 1981
270 Ga0207651_10218018 3300025960 Bacteria 1541
271 Ga0207651_10495392 3300025960 Bacteria 1055
272 Ga0207712_10014466 3300025961 Bacteria 5078
273 Ga0207712_10070305 3300025961 Bacteria 2514
274 Ga0207712_10280777 3300025961 Bacteria 1359
275 Ga0207668_10426679 3300025972 Bacteria 1126
276 Ga0207677_10000694 3300026023 Bacteria 19962
277 Ga0207677_10011458 3300026023 Bacteria 5060
278 Ga0207677_10610415 3300026023 Bacteria 958
279 Ga0207677_10726858 3300026023 Bacteria 883
280 Ga0207703_10074426 3300026035 Bacteria 2812
281 Ga0207703_10321418 3300026035 Bacteria 1417
282 Ga0207639_10070782 3300026041 Bacteria 2726
283 Ga0207678_10038123 3300026067 Bacteria 4178
284 Ga0207678_10173688 3300026067 Bacteria 1840
285 Ga0207708_10000190 3300026075 Bacteria 48551
286 Ga0207708_10166700 3300026075 Bacteria 1742
287 Ga0207708_10186867 3300026075 Bacteria 1647
288 Ga0207641_10145750 3300026088 Bacteria 2141
289 Ga0207648_10000148 3300026089 Bacteria 70334
290 Ga0207648_10007583 3300026089 Bacteria 10641
291 Ga0207648_10046103 3300026089 Bacteria 3822
292 Ga0207648_10071405 3300026089 Bacteria 3026
293 Ga0207648_10142275 3300026089 Bacteria 2114
294 Ga0207648_10446362 3300026089 Bacteria 1177
295 Ga0207676_10245884 3300026095 Bacteria 1607
296 Ga0207674_10097928 3300026116 Bacteria 2917
297 Ga0207674_10175895 3300026116 Bacteria 2093
298 Ga0207675_100000331 3300026118 Bacteria 45219
299 Ga0207675_100002211 3300026118 Bacteria 19327
300 Ga0207675_100011155 3300026118 Bacteria 8418
301 Ga0207675_100143243 3300026118 Bacteria 2271
302 Ga0207675_100259752 3300026118 Bacteria 1683
303 Ga0207683_10007220 3300026121 Bacteria 9526
304 Ga0207683_10012470 3300026121 Bacteria 7253
305 Ga0207683_10022020 3300026121 Bacteria 5468
306 Ga0207698_10004162 3300026142 Bacteria 8796
307 Ga0207698_10891577 3300026142 Bacteria 896
308 Ga0209371_1006254 3300027312 Bacteria 4457
309 Ga0209588_1054254 3300027671 Bacteria 1296
310 Ga0207428_10004845 3300027907 Bacteria 12695
311 Ga0207428_10055568 3300027907 Bacteria 3147
312 Ga0268266_10074782 3300028379 Bacteria 2942
313 Ga0268265_10287935 3300028380 Bacteria 1473
314 Ga0268264_10028286 3300028381 Bacteria 4584
315 Ga0265318_10001430 3300028577 Bacteria 14112
316 Ga0268256_1006273 3300030500 Bacteria 4457
317 Ga0265332_10018681 3300031238 Bacteria 3059
318 Ga0265328_10002460 3300031239 Bacteria 8309
319 Ga0265320_10142359 3300031240 Bacteria 1085
320 Ga0265329_10013792 3300031242 Bacteria 2868
321 Ga0265339_10122823 3300031249 Bacteria 1333
322 Ga0265316_10014555 3300031344 Bacteria 6915
323 Ga0265313_10112811 3300031595 Bacteria 1194
324 Ga0265314_10012718 3300031711 Bacteria 6840
325 Ga0265342_10004923 3300031712 Bacteria 10330
326 Ga0316576_10158899 3300031727 Bacteria 1704
327 Ga0307413_10029294 3300031824 Bacteria 3078
328 Ga0307410_10388151 3300031852 Bacteria 1125
329 Ga0307410_10391459 3300031852 Bacteria 1121
330 Ga0307412_10000103 3300031911 Bacteria 69660
331 Ga0307412_10465127 3300031911 Bacteria 1045
332 Ga0307409_100190383 3300031995 Bacteria 1826
333 Ga0307409_100781593 3300031995 Bacteria 961
334 Ga0307416_100115291 3300032002 Bacteria 2379
335 Ga0307416_100245045 3300032002 Bacteria 1740
336 Ga0307416_100673711 3300032002 Unclassified 1121
337 Ga0307411_10041286 3300032005 Bacteria 2934
338 Ga0307411_10218274 3300032005 Bacteria 1478
339 Ga0307411_10332570 3300032005 Bacteria 1231
340 Ga0307415_100069001 3300032126 Bacteria 2477
341 Ga0316583_10033196 3300032133 Bacteria 1834
342 Ga0373930_0002275 3300034816 Bacteria 2962
343 Ga0373934_0000134 3300035086 Bacteria 27424
344 Ga0373936_0001857 3300035113 Bacteria 7791
345 Ga0373939_0074227 3300035114 Bacteria 1115
346 Ga0373953_0104292 3300035117 Bacteria 1195
347 Ga0373954_0001992 3300035118 Bacteria 8475
348 Ga0373954_0230579 3300035118 Bacteria 911
349 Ga0373957_0057978 3300035120 Bacteria 1495
350 Ga0373943_0038795 3300035170 Bacteria 2292
351 Ga0373946_0191670 3300035171 Bacteria 975
352 Ga0316574_0072706 3300035398 Bacteria 2174
353 Ga0316574_0334024 3300035398 Bacteria 961
354 Ga0373924_0002789 3300035410 Bacteria 5899
355 Ga0373931_0051381 3300035691 Bacteria 2195
356 Ga0373935_0002842 3300035692 Bacteria 9963
357 Ga0373927_0004491 3300035695 Bacteria 9764
358 Ga0373927_0364197 3300035695 Bacteria 953
359 Ga0373933_0000564 3300035724 Bacteria 23136
360 Ga0373937_0003219 3300036401 Bacteria 13673
361 Ga0373937_0095014 3300036401 Bacteria 2764
362 Ga0373937_0497750 3300036401 Bacteria 1158
363 Ga0373925_0005318 3300037068 Bacteria 9608
364 Ga0395899_0150468 3300037312 Bacteria 1650
365 Ga0395900_0015015 3300037418 Bacteria 7895
366 Ga0395900_0137624 3300037418 Bacteria 2502
367 Ga0395900_0441732 3300037418 Bacteria 1258
368 Ga0395898_0193597 3300037466 Bacteria 1943
369 Ga0400484_09067 3300038725 Bacteria 19085
370 Ga0400484_38990 3300038725 Bacteria 5367
371 Ga0400490_45213 3300038726 Bacteria 1180
372 Ga0400485_12422 3300038735 Bacteria 11435
373 Ga0400488_34824 3300038741 Bacteria 2142
374 Ga0400488_58574 3300038741 Bacteria 4343
375 Ga0400486_10435 3300038742 Bacteria 11456
376 Ga0400486_14629 3300038742 Bacteria 4667
377 Ga0400486_16947 3300038742 Bacteria 3107
378 Ga0400483_106185 3300039062 Bacteria 1548
379 Ga0400483_241910 3300039062 Bacteria 3264
380 Ga0400483_250707 3300039062 Bacteria 1652
381 Ga0400483_252510 3300039062 Bacteria 2924
382 Ga0400483_269845 3300039062 Bacteria 1321
383 Ga0400489_59570 3300039093 Bacteria 26016
384 Ga0400487_40481 3300039110 Bacteria 2729
385 Ga0400487_49467 3300039110 Bacteria 4521
386 Ga0439436_0043511 3300041404 Bacteria 1281
387 Ga0439441_000687 3300042001 Bacteria 3905
388 Ga0439441_025404 3300042001 Bacteria 1118
389 Ga0451577_0001485 3300042876 Bacteria 31086
390 Ga0451577_0019489 3300042876 Bacteria 6238
391 Ga0451577_0055776 3300042876 Bacteria 3524
392 Ga0453684_0001982 3300044712 Bacteria 52535
393 Ga0466957_0026229 3300044842 Bacteria 3456
394 Ga0451576_0001247 3300045051 Bacteria 44717
395 Ga0451576_0176538 3300045051 Bacteria 2230
396 Ga0451576_0371697 3300045051 Bacteria 1498
397 Ga0451576_0646473 3300045051 Bacteria 1111
398 Ga0495641_0002246 3300046461 Bacteria 15388
399 Ga0495651_0000233 3300046462 Bacteria 42757
400 Ga0495651_0000919 3300046462 Bacteria 22867
401 Ga0495651_0212578 3300046462 Bacteria 1345
402 Ga0495653_0006450 3300046463 Bacteria 9621
403 Ga0495605_0112896 3300046474 Bacteria 1238
404 Ga0495662_0008084 3300046476 Bacteria 5184
405 Ga0495664_0253359 3300046477 Bacteria 1064
406 Ga0495607_0000004 3300046501 Bacteria 317271
407 Ga0495628_0000564 3300046516 Bacteria 34030
408 Ga0495628_0006359 3300046516 Bacteria 10325
409 Ga0495630_0003084 3300046517 Bacteria 11557
410 Ga0495666_0009639 3300046526 Bacteria 4828
411 Ga0495652_0157753 3300046529 Bacteria 1765
412 Ga0495665_0012330 3300046531 Bacteria 4625
413 Ga0495586_0004382 3300046535 Bacteria 7545
414 Ga0495587_0141653 3300046536 Bacteria 1372
415 Ga0495621_0068732 3300046539 Bacteria 1300
416 Ga0495645_0038517 3300046543 Bacteria 3486
417 Ga0495645_0129376 3300046543 Bacteria 1771
418 Ga0495667_0002319 3300046559 Bacteria 12751
419 Ga0495634_0022866 3300046642 Bacteria 4401
420 Ga0495635_0020689 3300046663 Bacteria 4583
421 Ga0495657_0007179 3300046675 Bacteria 8641
422 Ga0495657_0061847 3300046675 Bacteria 2476
423 Ga0495657_0126628 3300046675 Bacteria 1604
424 Ga0495599_0009285 3300046678 Bacteria 6006
425 Ga0495599_0048185 3300046678 Bacteria 2671
426 Ga0495599_0114958 3300046678 Bacteria 1674
427 Ga0495647_0004630 3300046681 Bacteria 4482
428 Ga0495658_0248352 3300046683 Bacteria 1118
429 Ga0495613_0006284 3300046689 Bacteria 8885
430 Ga0495600_0012655 3300046809 Bacteria 5281
431 Ga0495604_0088875 3300047317 Bacteria 2297
432 Ga0495636_0002736 3300047318 Bacteria 6793
433 Ga0495674_0003032 3300047319 Bacteria 16351
434 Ga0495675_0001126 3300047444 Bacteria 16251
435 Ga0495626_0066627 3300048091 Bacteria 1628
436 Ga0496104_0005857 3300048907 Bacteria 10768
437 Ga0496105_0249243 3300048908 Bacteria 1439
438 Ga0496105_0519138 3300048908 Bacteria 933
439 Ga0496105_0551363 3300048908 Bacteria 900
440 Ga0496107_0630689 3300048910 Bacteria 791
441 Ga0496110_0001107 3300048913 Bacteria 19019
442 Ga0496110_0101430 3300048913 Bacteria 2580
443 Ga0496111_0109792 3300048914 Bacteria 2031
444 Ga0496111_0255539 3300048914 Bacteria 1300
445 Ga0496113_0571001 3300048916 Bacteria 907
446 Ga0496114_0341553 3300048917 Bacteria 1324
447 Ga0496116_0025792 3300048919 Bacteria 4312
448 Ga0496116_0047715 3300048919 Bacteria 2880
449 Ga0496117_0030785 3300048920 Bacteria 4109
450 Ga0496117_0036371 3300048920 Bacteria 3685
451 Ga0496118_0003850 3300048921 Bacteria 18443
452 Ga0496118_0023620 3300048921 Bacteria 5334
453 Ga0496120_0007149 3300048923 Bacteria 8368
454 Ga0496121_0000628 3300048924 Bacteria 65856
455 Ga0496121_0027993 3300048924 Bacteria 5259
456 Ga0496122_0000497 3300048925 Bacteria 81763
457 Ga0496122_0152060 3300048925 Bacteria 1427
458 Ga0496123_0000345 3300048926 Bacteria 87307
459 Ga0496124_0159205 3300048927 Bacteria 1762
460 Ga0496124_0258063 3300048927 Bacteria 1284
461 Ga0496125_0000166 3300048928 Bacteria 147432
462 Ga0496125_0008814 3300048928 Bacteria 10490
463 Ga0496125_0025846 3300048928 Bacteria 5366
464 Ga0496126_0024834 3300048929 Bacteria 5779
465 Ga0501031_0037750 3300049568 Bacteria 3153
466 Ga0501031_0046401 3300049568 Bacteria 2833
467 Ga0501031_0055589 3300049568 Bacteria 2579
468 Ga0501031_0062748 3300049568 Bacteria 2421
469 Ga0501032_0198254 3300049569 Bacteria 1311
470 Ga0501033_0002713 3300049570 Bacteria 14848
471 Ga0501033_0020221 3300049570 Bacteria 5032
472 Ga0501033_0372356 3300049570 Bacteria 998
473 Ga0501034_0004039 3300049571 Bacteria 16467
474 Ga0501034_0066184 3300049571 Bacteria 3626
475 Ga0501034_0088738 3300049571 Bacteria 3090
476 Ga0501034_0350073 3300049571 Bacteria 1406
477 Ga0501036_0000051 3300049572 Bacteria 75057
478 Ga0501036_0014674 3300049572 Bacteria 6530
479 Ga0501037_0001916 3300049573 Bacteria 15094
480 Ga0501038_0001036 3300049574 Bacteria 25087
481 Ga0501038_0036633 3300049574 Bacteria 4304
482 Ga0501038_0088337 3300049574 Bacteria 2602
483 Ga0501039_0202412 3300049575 Bacteria 1561
484 Ga0501040_0044772 3300049576 Bacteria 3018
485 Ga0501041_0219550 3300049577 Bacteria 1193
486 Ga0501042_0046528 3300049578 Bacteria 3093
487 Ga0501043_0002694 3300049579 Bacteria 14897
488 Ga0501043_0059752 3300049579 Bacteria 2992
489 Ga0501043_0072110 3300049579 Bacteria 2713
490 Ga0501046_0000415 3300049580 Bacteria 42538
491 Ga0501046_0083560 3300049580 Bacteria 2464
492 Ga0501047_0001463 3300049581 Bacteria 23046
493 Ga0501047_0001927 3300049581 Bacteria 19951
494 Ga0501048_0404226 3300049582 Bacteria 976
495 Ga0501071_0010741 3300049587 Bacteria 6141
496 Ga0501071_0028160 3300049587 Bacteria 3958
497 Ga0501071_0249015 3300049587 Bacteria 1341
498 Ga0501071_0350876 3300049587 Bacteria 1123
499 Ga0501074_0165411 3300049590 Bacteria 1579
500 Ga0501075_0016758 3300049591 Bacteria 5284
501 Ga0501075_0332932 3300049591 Bacteria 1157
502 Ga0501075_0394431 3300049591 Bacteria 1055
503 Ga0501076_0015876 3300049592 Bacteria 5698
504 Ga0501076_0067647 3300049592 Bacteria 2853
505 Ga0501076_0156725 3300049592 Bacteria 1854
506 Ga0501076_0380299 3300049592 Bacteria 1160
507 Ga0501077_0017381 3300049593 Bacteria 4539
508 Ga0501209_001220 3300049656 Bacteria 3547
509 Ga0501079_0106891 3300049741 Bacteria 2172
510 Ga0501079_0270375 3300049741 Bacteria 1329
511 Ga0501080_0095841 3300049742 Bacteria 2755
512 Ga0501080_0511933 3300049742 Bacteria 1072
513 Ga0501080_0586354 3300049742 Bacteria 991
514 Ga0501035_0001342 3300049822 Bacteria 25362
515 Ga0501035_0025887 3300049822 Bacteria 5376
516 Ga0501035_0058236 3300049822 Bacteria 3444
517 Ga0501035_0078604 3300049822 Bacteria 2914
518 Ga0501035_0577385 3300049822 Bacteria 918
519 Ga0501044_0002429 3300049823 Bacteria 21255
520 Ga0501044_0016400 3300049823 Bacteria 7954
521 Ga0501045_0004002 3300049824 Bacteria 10148
522 nmdc:mga00v17_117887_c1 3300050491 Bacteria 1689
523 nmdc:mga00v17_200704_c1 3300050491 Bacteria 1289
524 nmdc:mga00v17_54228_c1 3300050491 Bacteria 2445
525 nmdc:mga0k408_25491_c1 3300050493 Bacteria 2561
526 nmdc:mga05p37_12648_c1 3300050507 Bacteria 10081
527 nmdc:mga09592_313162_c1 3300050508 Bacteria 1360
528 nmdc:mga09592_33913_c1 3300050508 Bacteria 4265
529 nmdc:mga09592_72957_c1 3300050508 Bacteria 2916
530 nmdc:mga0qj67_18270_c1 3300050509 Bacteria 5343
531 nmdc:mga06r32_304961_c1 3300050510 Bacteria 1578
532 nmdc:mga08y16_109961_c1 3300050511 Bacteria 2870
533 nmdc:mga08y16_4855_c1 3300050511 Bacteria 14036
534 nmdc:mga0n895_1336_c1 3300050512 Bacteria 18273
535 nmdc:mga0n895_177484_c1 3300050512 Bacteria 2161
536 nmdc:mga0rr50_1767_c1 3300050513 Bacteria 11933
537 nmdc:mga0rr50_423900_c1 3300050513 Bacteria 1126
538 nmdc:mga08x19_11854_c1 3300050514 Bacteria 5242
539 nmdc:mga0a205_152119_c1 3300050515 Bacteria 2213
540 nmdc:mga0a205_586678_c1 3300050515 Bacteria 968
541 nmdc:mga0a205_649118_c1 3300050515 Bacteria 907
542 Ga0495601_0029875 3300053077 Bacteria 3383
543 Ga0495595_0000317 3300053084 Bacteria 18797
544 Ga0495619_0001741 3300053085 Bacteria 14446
545 Ga0500566_0247958 3300053094 Bacteria 868
546 Ga0501084_0013768 3300054114 Bacteria 6694
547 Ga0501082_0020828 3300060353 Bacteria 5655
548 Ga0501082_0028434 3300060353 Bacteria 4816
549 Ga0501082_0263932 3300060353 Bacteria 1498
550 Ga0501082_0288962 3300060353 Bacteria 1428
551 Ga0501082_0656135 3300060353 Bacteria 918
552 Ga0530510_0005135 3300061734 Bacteria 9032

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042001 Ga0439441_025404 Ga0439441_025404_11_625 204
2 3300049591 Ga0501075_0332932 Ga0501075_0332932_11_652 210
3 3300060353 Ga0501082_0288962 Ga0501082_0288962_29_670 210
4 iso_pu_bacteria 2734482258 2735816396 239
5 3300014326 Ga0157380_10002619 Ga0157380_100026195 240
6 3300005295 Ga0065707_10165357 Ga0065707_101653571 241
7 3300005340 Ga0070689_100133744 Ga0070689_1001337442 241
8 3300005345 Ga0070692_10238697 Ga0070692_102386972 241
9 3300005440 Ga0070705_100012308 Ga0070705_1000123084 241
10 3300005518 Ga0070699_100140535 Ga0070699_1001405352 241
11 3300005549 Ga0070704_100003984 Ga0070704_1000039847 241
12 3300005549 Ga0070704_100029000 Ga0070704_1000290004 241
13 3300005577 Ga0068857_101041002 Ga0068857_1010410021 241
14 3300005617 Ga0068859_100011579 Ga0068859_1000115793 241
15 3300005840 Ga0068870_10126032 Ga0068870_101260322 241
16 3300005844 Ga0068862_100637354 Ga0068862_1006373542 241
17 3300006844 Ga0075428_100026865 Ga0075428_1000268651 241
18 3300006847 Ga0075431_100037313 Ga0075431_1000373136 241
19 3300006852 Ga0075433_10329291 Ga0075433_103292912 241
20 3300006880 Ga0075429_100114050 Ga0075429_1001140503 241
21 3300006880 Ga0075429_100150302 Ga0075429_1001503022 241
22 3300006931 Ga0097620_100011579 Ga0097620_1000115793 241
23 3300007076 Ga0075435_100371975 Ga0075435_1003719752 241
24 3300009094 Ga0111539_10413049 Ga0111539_104130492 241
25 3300009147 Ga0114129_10377692 Ga0114129_103776922 241
26 3300009553 Ga0105249_10262863 Ga0105249_102628631 241
27 3300025936 Ga0207670_10079021 Ga0207670_100790212 241
28 3300025961 Ga0207712_10280777 Ga0207712_102807772 241
29 3300026116 Ga0207674_10097928 Ga0207674_100979281 241
30 3300045051 Ga0451576_0371697 Ga0451576_0371697_663_1388 241
31 3300050507 nmdc:mga05p37_12648_c1 nmdc:mga05p37_12648_c1_464_1189 241
32 3300050508 nmdc:mga09592_72957_c1 nmdc:mga09592_72957_c1_1355_2080 241
33 3300050510 nmdc:mga06r32_304961_c1 nmdc:mga06r32_304961_c1_771_1496 241
34 3300050513 nmdc:mga0rr50_423900_c1 nmdc:mga0rr50_423900_c1_270_995 241
35 iso_pu_bacteria 8055225921 8055226245 242
36 3300005347 Ga0070668_100021699 Ga0070668_1000216993 243
37 3300005459 Ga0068867_100070528 Ga0068867_1000705282 243
38 3300005536 Ga0070697_100147720 Ga0070697_1001477201 243
39 3300005536 Ga0070697_100259956 Ga0070697_1002599561 243
40 3300006163 Ga0070715_10118218 Ga0070715_101182182 243
41 3300006914 Ga0075436_100058806 Ga0075436_1000588064 243
42 3300006914 Ga0075436_100405512 Ga0075436_1004055122 243
43 3300007265 Ga0099794_10001720 Ga0099794_100017204 243
44 3300013308 Ga0157375_10415529 Ga0157375_104155293 243
45 3300014326 Ga0157380_10028796 Ga0157380_100287962 243
46 3300025906 Ga0207699_10172275 Ga0207699_101722752 243
47 3300025917 Ga0207660_10111741 Ga0207660_101117412 243
48 3300025937 Ga0207669_10035156 Ga0207669_100351563 243
49 3300025940 Ga0207691_10218365 Ga0207691_102183652 243
50 3300025972 Ga0207668_10426679 Ga0207668_104266792 243
51 3300026089 Ga0207648_10142275 Ga0207648_101422752 243
52 3300032005 Ga0307411_10218274 Ga0307411_102182742 243
53 3300035086 Ga0373934_0000134 Ga0373934_0000134_10212_10943 243
54 3300035113 Ga0373936_0001857 Ga0373936_0001857_2533_3264 243
55 3300035117 Ga0373953_0104292 Ga0373953_0104292_251_982 243
56 3300035118 Ga0373954_0001992 Ga0373954_0001992_3363_4094 243
57 3300035118 Ga0373954_0230579 Ga0373954_0230579_146_877 243
58 3300035120 Ga0373957_0057978 Ga0373957_0057978_489_1220 243
59 3300035170 Ga0373943_0038795 Ga0373943_0038795_626_1357 243
60 3300035410 Ga0373924_0002789 Ga0373924_0002789_2647_3378 243
61 3300035692 Ga0373935_0002842 Ga0373935_0002842_4545_5276 243
62 3300035695 Ga0373927_0004491 Ga0373927_0004491_320_1051 243
63 3300035724 Ga0373933_0000564 Ga0373933_0000564_19207_19938 243
64 3300036401 Ga0373937_0003219 Ga0373937_0003219_11684_12415 243
65 3300046461 Ga0495641_0002246 Ga0495641_0002246_14078_14809 243
66 3300046462 Ga0495651_0000233 Ga0495651_0000233_24798_25529 243
67 3300046462 Ga0495651_0000919 Ga0495651_0000919_16143_16874 243
68 3300046463 Ga0495653_0006450 Ga0495653_0006450_161_892 243
69 3300046476 Ga0495662_0008084 Ga0495662_0008084_1183_1914 243
70 3300046477 Ga0495664_0253359 Ga0495664_0253359_33_764 243
71 3300046516 Ga0495628_0006359 Ga0495628_0006359_2647_3378 243
72 3300046517 Ga0495630_0003084 Ga0495630_0003084_5108_5839 243
73 3300046526 Ga0495666_0009639 Ga0495666_0009639_4050_4781 243
74 3300046531 Ga0495665_0012330 Ga0495665_0012330_3839_4570 243
75 3300046535 Ga0495586_0004382 Ga0495586_0004382_284_1015 243
76 3300046642 Ga0495634_0022866 Ga0495634_0022866_284_1015 243
77 3300046663 Ga0495635_0020689 Ga0495635_0020689_1329_2060 243
78 3300046675 Ga0495657_0007179 Ga0495657_0007179_41_772 243
79 3300046675 Ga0495657_0061847 Ga0495657_0061847_1386_2117 243
80 3300046678 Ga0495599_0009285 Ga0495599_0009285_877_1608 243
81 3300046678 Ga0495599_0048185 Ga0495599_0048185_237_968 243
82 3300046681 Ga0495647_0004630 Ga0495647_0004630_3590_4321 243
83 3300046683 Ga0495658_0248352 Ga0495658_0248352_284_1015 243
84 3300046689 Ga0495613_0006284 Ga0495613_0006284_220_951 243
85 3300046809 Ga0495600_0012655 Ga0495600_0012655_3787_4518 243
86 3300047317 Ga0495604_0088875 Ga0495604_0088875_623_1354 243
87 3300047318 Ga0495636_0002736 Ga0495636_0002736_1496_2227 243
88 3300047319 Ga0495674_0003032 Ga0495674_0003032_8543_9274 243
89 3300047444 Ga0495675_0001126 Ga0495675_0001126_2342_3073 243
90 3300049656 Ga0501209_001220 Ga0501209_001220_556_1287 243
91 3300050493 nmdc:mga0k408_25491_c1 nmdc:mga0k408_25491_c1_1048_1779 243
92 3300050514 nmdc:mga08x19_11854_c1 nmdc:mga08x19_11854_c1_2171_2902 243
93 3300053084 Ga0495595_0000317 Ga0495595_0000317_4558_5289 243
94 3300053085 Ga0495619_0001741 Ga0495619_0001741_11121_11852 243
95 3300053094 Ga0500566_0247958 Ga0500566_0247958_14_745 243
96 3300005327 Ga0070658_10038614 Ga0070658_100386142 244
97 3300005328 Ga0070676_10140338 Ga0070676_101403382 244
98 3300005328 Ga0070676_10354499 Ga0070676_103544992 244
99 3300005329 Ga0070683_100250872 Ga0070683_1002508721 244
100 3300005329 Ga0070683_100283544 Ga0070683_1002835442 244
101 3300005334 Ga0068869_100043956 Ga0068869_1000439562 244
102 3300005334 Ga0068869_100165829 Ga0068869_1001658292 244
103 3300005335 Ga0070666_10019243 Ga0070666_100192435 244
104 3300005335 Ga0070666_10022564 Ga0070666_100225644 244
105 3300005339 Ga0070660_100159519 Ga0070660_1001595193 244
106 3300005340 Ga0070689_100070088 Ga0070689_1000700882 244
107 3300005344 Ga0070661_100022098 Ga0070661_1000220985 244
108 3300005347 Ga0070668_100213894 Ga0070668_1002138942 244
109 3300005347 Ga0070668_100412177 Ga0070668_1004121772 244
110 3300005353 Ga0070669_100384937 Ga0070669_1003849372 244
111 3300005354 Ga0070675_100011290 Ga0070675_1000112902 244
112 3300005354 Ga0070675_100346649 Ga0070675_1003466492 244
113 3300005355 Ga0070671_100025228 Ga0070671_1000252285 244
114 3300005356 Ga0070674_100029049 Ga0070674_1000290494 244
115 3300005364 Ga0070673_100003959 Ga0070673_1000039598 244
116 3300005364 Ga0070673_100204382 Ga0070673_1002043822 244
117 3300005365 Ga0070688_100415606 Ga0070688_1004156062 244
118 3300005367 Ga0070667_100029724 Ga0070667_1000297242 244
119 3300005438 Ga0070701_10043261 Ga0070701_100432613 244
120 3300005440 Ga0070705_100366497 Ga0070705_1003664972 244
121 3300005456 Ga0070678_100072140 Ga0070678_1000721402 244
122 3300005458 Ga0070681_10012999 Ga0070681_100129997 244
123 3300005459 Ga0068867_100085086 Ga0068867_1000850863 244
124 3300005467 Ga0070706_100203339 Ga0070706_1002033391 244
125 3300005468 Ga0070707_100044433 Ga0070707_1000444332 244
126 3300005543 Ga0070672_100011362 Ga0070672_1000113625 244
127 3300005543 Ga0070672_100542727 Ga0070672_1005427271 244
128 3300005544 Ga0070686_100024252 Ga0070686_1000242523 244
129 3300005577 Ga0068857_100076682 Ga0068857_1000766823 244
130 3300005616 Ga0068852_100068965 Ga0068852_1000689652 244
131 3300005617 Ga0068859_100162687 Ga0068859_1001626873 244
132 3300005618 Ga0068864_100246641 Ga0068864_1002466413 244
133 3300005718 Ga0068866_10070956 Ga0068866_100709561 244
134 3300005719 Ga0068861_100071772 Ga0068861_1000717721 244
135 3300005719 Ga0068861_100199586 Ga0068861_1001995862 244
136 3300005834 Ga0068851_10002142 Ga0068851_100021422 244
137 3300005841 Ga0068863_100111412 Ga0068863_1001114122 244
138 3300006237 Ga0097621_100150406 Ga0097621_1001504062 244
139 3300006237 Ga0097621_100538199 Ga0097621_1005381992 244
140 3300006358 Ga0068871_100060002 Ga0068871_1000600023 244
141 3300006844 Ga0075428_100005442 Ga0075428_10000544211 244
142 3300006852 Ga0075433_10115381 Ga0075433_101153813 244
143 3300006871 Ga0075434_100000011 Ga0075434_10000001155 244
144 3300006880 Ga0075429_100222786 Ga0075429_1002227863 244
145 3300006931 Ga0097620_100162693 Ga0097620_1001626933 244
146 3300007076 Ga0075435_100003109 Ga0075435_10000310910 244
147 3300009093 Ga0105240_10203168 Ga0105240_102031682 244
148 3300009093 Ga0105240_10912210 Ga0105240_109122102 244
149 3300009094 Ga0111539_10000625 Ga0111539_1000062523 244
150 3300009148 Ga0105243_10013102 Ga0105243_100131025 244
151 3300009174 Ga0105241_10557618 Ga0105241_105576182 244
152 3300009176 Ga0105242_10018901 Ga0105242_100189015 244
153 3300009177 Ga0105248_10083321 Ga0105248_100833213 244
154 3300009177 Ga0105248_10114240 Ga0105248_101142406 244
155 3300009177 Ga0105248_10531122 Ga0105248_105311222 244
156 3300009551 Ga0105238_10070931 Ga0105238_100709312 244
157 3300009551 Ga0105238_10369651 Ga0105238_103696512 244
158 3300009553 Ga0105249_10136404 Ga0105249_101364043 244
159 3300009553 Ga0105249_10170647 Ga0105249_101706473 244
160 3300013297 Ga0157378_10029096 Ga0157378_100290965 244
161 3300013297 Ga0157378_10531455 Ga0157378_105314552 244
162 3300013308 Ga0157375_10005831 Ga0157375_100058315 244
163 3300013308 Ga0157375_10241644 Ga0157375_102416443 244
164 3300014326 Ga0157380_10034923 Ga0157380_100349233 244
165 3300014326 Ga0157380_10120187 Ga0157380_101201872 244
166 3300014326 Ga0157380_10330570 Ga0157380_103305702 244
167 3300014326 Ga0157380_10614064 Ga0157380_106140642 244
168 3300014968 Ga0157379_10019956 Ga0157379_100199562 244
169 3300014968 Ga0157379_10567252 Ga0157379_105672522 244
170 3300014969 Ga0157376_10510232 Ga0157376_105102322 244
171 3300025315 Ga0207697_10003881 Ga0207697_100038815 244
172 3300025321 Ga0207656_10045210 Ga0207656_100452102 244
173 3300025893 Ga0207682_10002916 Ga0207682_100029168 244
174 3300025899 Ga0207642_10020911 Ga0207642_100209112 244
175 3300025903 Ga0207680_10013971 Ga0207680_100139713 244
176 3300025903 Ga0207680_10021017 Ga0207680_100210174 244
177 3300025909 Ga0207705_10099620 Ga0207705_100996202 244
178 3300025912 Ga0207707_10008055 Ga0207707_100080556 244
179 3300025913 Ga0207695_10327053 Ga0207695_103270532 244
180 3300025922 Ga0207646_10536002 Ga0207646_105360021 244
181 3300025923 Ga0207681_10145648 Ga0207681_101456482 244
182 3300025924 Ga0207694_10547245 Ga0207694_105472452 244
183 3300025925 Ga0207650_10004155 Ga0207650_100041557 244
184 3300025926 Ga0207659_10046152 Ga0207659_100461522 244
185 3300025931 Ga0207644_10012447 Ga0207644_100124474 244
186 3300025933 Ga0207706_10011972 Ga0207706_100119725 244
187 3300025935 Ga0207709_10062289 Ga0207709_100622891 244
188 3300025935 Ga0207709_10434759 Ga0207709_104347592 244
189 3300025936 Ga0207670_10014439 Ga0207670_100144394 244
190 3300025936 Ga0207670_10040230 Ga0207670_100402303 244
191 3300025937 Ga0207669_10081821 Ga0207669_100818212 244
192 3300025937 Ga0207669_10562475 Ga0207669_105624751 244
193 3300025938 Ga0207704_10263683 Ga0207704_102636832 244
194 3300025940 Ga0207691_10001377 Ga0207691_100013775 244
195 3300025940 Ga0207691_10168399 Ga0207691_101683993 244
196 3300025941 Ga0207711_10482779 Ga0207711_104827792 244
197 3300025942 Ga0207689_10229037 Ga0207689_102290373 244
198 3300025944 Ga0207661_10067119 Ga0207661_100671193 244
199 3300025945 Ga0207679_10010038 Ga0207679_100100382 244
200 3300025960 Ga0207651_10121516 Ga0207651_101215162 244
201 3300025960 Ga0207651_10218018 Ga0207651_102180182 244
202 3300025960 Ga0207651_10495392 Ga0207651_104953921 244
203 3300025961 Ga0207712_10070305 Ga0207712_100703053 244
204 3300026023 Ga0207677_10000694 Ga0207677_100006949 244
205 3300026023 Ga0207677_10610415 Ga0207677_106104152 244
206 3300026023 Ga0207677_10726858 Ga0207677_107268581 244
207 3300026035 Ga0207703_10321418 Ga0207703_103214182 244
208 3300026088 Ga0207641_10145750 Ga0207641_101457502 244
209 3300026089 Ga0207648_10007583 Ga0207648_100075833 244
210 3300026095 Ga0207676_10245884 Ga0207676_102458842 244
211 3300026118 Ga0207675_100011155 Ga0207675_1000111555 244
212 3300026118 Ga0207675_100259752 Ga0207675_1002597522 244
213 3300026121 Ga0207683_10022020 Ga0207683_100220203 244
214 3300026142 Ga0207698_10004162 Ga0207698_100041628 244
215 3300027907 Ga0207428_10004845 Ga0207428_100048457 244
216 3300028379 Ga0268266_10074782 Ga0268266_100747822 244
217 3300028577 Ga0265318_10001430 Ga0265318_100014308 244
218 3300031238 Ga0265332_10018681 Ga0265332_100186813 244
219 3300031239 Ga0265328_10002460 Ga0265328_100024608 244
220 3300031240 Ga0265320_10142359 Ga0265320_101423591 244
221 3300031242 Ga0265329_10013792 Ga0265329_100137922 244
222 3300031249 Ga0265339_10122823 Ga0265339_101228232 244
223 3300031344 Ga0265316_10014555 Ga0265316_100145554 244
224 3300031595 Ga0265313_10112811 Ga0265313_101128112 244
225 3300031711 Ga0265314_10012718 Ga0265314_100127185 244
226 3300031712 Ga0265342_10004923 Ga0265342_100049236 244
227 3300031852 Ga0307410_10391459 Ga0307410_103914592 244
228 3300031911 Ga0307412_10465127 Ga0307412_104651272 244
229 3300031995 Ga0307409_100781593 Ga0307409_1007815932 244
230 3300032002 Ga0307416_100115291 Ga0307416_1001152913 244
231 3300032005 Ga0307411_10332570 Ga0307411_103325701 244
232 3300032126 Ga0307415_100069001 Ga0307415_1000690014 244
233 3300034816 Ga0373930_0002275 Ga0373930_0002275_779_1513 244
234 3300035114 Ga0373939_0074227 Ga0373939_0074227_13_747 244
235 3300035171 Ga0373946_0191670 Ga0373946_0191670_208_942 244
236 3300035691 Ga0373931_0051381 Ga0373931_0051381_413_1147 244
237 3300036401 Ga0373937_0497750 Ga0373937_0497750_94_828 244
238 3300037068 Ga0373925_0005318 Ga0373925_0005318_8507_9241 244
239 3300042001 Ga0439441_000687 Ga0439441_000687_1018_1752 244
240 3300046462 Ga0495651_0212578 Ga0495651_0212578_225_959 244
241 3300046474 Ga0495605_0112896 Ga0495605_0112896_163_897 244
242 3300046516 Ga0495628_0000564 Ga0495628_0000564_980_1720 244
243 3300046529 Ga0495652_0157753 Ga0495652_0157753_743_1477 244
244 3300046539 Ga0495621_0068732 Ga0495621_0068732_270_1004 244
245 3300046543 Ga0495645_0038517 Ga0495645_0038517_2161_2901 244
246 3300046543 Ga0495645_0129376 Ga0495645_0129376_966_1700 244
247 3300046678 Ga0495599_0114958 Ga0495599_0114958_565_1305 244
248 3300048908 Ga0496105_0519138 Ga0496105_0519138_169_903 244
249 3300048910 Ga0496107_0630689 Ga0496107_0630689_23_757 244
250 3300048913 Ga0496110_0001107 Ga0496110_0001107_10634_11368 244
251 3300048914 Ga0496111_0109792 Ga0496111_0109792_194_928 244
252 3300048916 Ga0496113_0571001 Ga0496113_0571001_80_814 244
253 3300048917 Ga0496114_0341553 Ga0496114_0341553_362_1096 244
254 3300049568 Ga0501031_0037750 Ga0501031_0037750_2394_3128 244
255 3300049568 Ga0501031_0055589 Ga0501031_0055589_1440_2174 244
256 3300049574 Ga0501038_0088337 Ga0501038_0088337_278_1012 244
257 3300049577 Ga0501041_0219550 Ga0501041_0219550_41_775 244
258 3300049592 Ga0501076_0380299 Ga0501076_0380299_412_1146 244
259 3300049822 Ga0501035_0058236 Ga0501035_0058236_1645_2379 244
260 3300050508 nmdc:mga09592_313162_c1 nmdc:mga09592_313162_c1_535_1269 244
261 3300050511 nmdc:mga08y16_4855_c1 nmdc:mga08y16_4855_c1_9385_10119 244
262 3300050512 nmdc:mga0n895_1336_c1 nmdc:mga0n895_1336_c1_2831_3565 244
263 3300050513 nmdc:mga0rr50_1767_c1 nmdc:mga0rr50_1767_c1_7369_8103 244
264 3300050515 nmdc:mga0a205_152119_c1 nmdc:mga0a205_152119_c1_1290_2024 244
265 3300053077 Ga0495601_0029875 Ga0495601_0029875_370_1110 244
266 3300060353 Ga0501082_0020828 Ga0501082_0020828_68_802 244
267 iso_pu_bacteria 2602042047 2603641776 244
268 iso_pu_bacteria 2602042066 2603701434 244
269 iso_pu_bacteria 2602042067 2603706820 244
270 iso_pu_bacteria 2667528172 2671105810 244
271 iso_pu_bacteria 2681812866 2681995183 244
272 iso_pu_bacteria 2681812869 2682009987 244
273 iso_pu_bacteria 2711768156 2712471578 244
274 iso_pu_bacteria 2751185917 2753858040 244
275 iso_pu_bacteria 2765235842 2765591206 244
276 iso_pu_bacteria 2775506706 2775538407 244
277 iso_pu_bacteria 2821118458 2821122982 244
278 iso_pu_bacteria 2823373977 2823378529 244
279 iso_pu_bacteria 2844425489 2844429548 244
280 iso_pu_bacteria 2923634449 2923637058 244
281 iso_pu_bacteria 2927833300 2927836491 244
282 iso_pu_bacteria 2937539931 2937540969 244
283 iso_pu_bacteria 2939568625 2939572905 244
284 iso_pu_bacteria 2939642701 2939646881 244
285 iso_pu_bacteria 2974310843 2974314561 244
286 iso_pu_bacteria 8002745576 8002746956 244
287 iso_pu_bacteria 8018221730 8018224832 244
288 iso_pu_bacteria 8018405270 8018405476 244
289 3300005327 Ga0070658_10007033 Ga0070658_100070338 245
290 3300005338 Ga0068868_100022580 Ga0068868_1000225804 245
291 3300005353 Ga0070669_100084565 Ga0070669_1000845653 245
292 3300005356 Ga0070674_100159431 Ga0070674_1001594312 245
293 3300005436 Ga0070713_100005849 Ga0070713_1000058497 245
294 3300005441 Ga0070700_100122762 Ga0070700_1001227623 245
295 3300005456 Ga0070678_100058374 Ga0070678_1000583742 245
296 3300005459 Ga0068867_100177470 Ga0068867_1001774702 245
297 3300005536 Ga0070697_100226496 Ga0070697_1002264962 245
298 3300005563 Ga0068855_100029680 Ga0068855_1000296804 245
299 3300005616 Ga0068852_100004709 Ga0068852_1000047096 245
300 3300005617 Ga0068859_100854986 Ga0068859_1008549862 245
301 3300005719 Ga0068861_100041979 Ga0068861_1000419794 245
302 3300006173 Ga0070716_100064441 Ga0070716_1000644412 245
303 3300006175 Ga0070712_100409810 Ga0070712_1004098102 245
304 3300006237 Ga0097621_100028370 Ga0097621_1000283704 245
305 3300006237 Ga0097621_100084532 Ga0097621_1000845323 245
306 3300006358 Ga0068871_100024831 Ga0068871_1000248314 245
307 3300006358 Ga0068871_100116835 Ga0068871_1001168353 245
308 3300006881 Ga0068865_100032279 Ga0068865_1000322792 245
309 3300006931 Ga0097620_100855022 Ga0097620_1008550222 245
310 3300009093 Ga0105240_10173408 Ga0105240_101734085 245
311 3300009177 Ga0105248_10153955 Ga0105248_101539553 245
312 3300009177 Ga0105248_10257199 Ga0105248_102571995 245
313 3300013104 Ga0157370_10008938 Ga0157370_100089387 245
314 3300013296 Ga0157374_10252172 Ga0157374_102521722 245
315 3300013306 Ga0163162_10105460 Ga0163162_101054605 245
316 3300013306 Ga0163162_10698221 Ga0163162_106982212 245
317 3300013307 Ga0157372_10434269 Ga0157372_104342692 245
318 3300013308 Ga0157375_10383433 Ga0157375_103834333 245
319 3300014325 Ga0163163_10799810 Ga0163163_107998102 245
320 3300017792 Ga0163161_10187541 Ga0163161_101875413 245
321 3300025893 Ga0207682_10021226 Ga0207682_100212262 245
322 3300025909 Ga0207705_10023581 Ga0207705_100235813 245
323 3300025915 Ga0207693_10440218 Ga0207693_104402182 245
324 3300025931 Ga0207644_10136868 Ga0207644_101368682 245
325 3300025933 Ga0207706_10092058 Ga0207706_100920582 245
326 3300025934 Ga0207686_10359371 Ga0207686_103593712 245
327 3300025935 Ga0207709_10046690 Ga0207709_100466903 245
328 3300025937 Ga0207669_10021005 Ga0207669_100210053 245
329 3300025938 Ga0207704_10125263 Ga0207704_101252633 245
330 3300025949 Ga0207667_10032498 Ga0207667_100324983 245
331 3300026023 Ga0207677_10011458 Ga0207677_100114585 245
332 3300026067 Ga0207678_10038123 Ga0207678_100381234 245
333 3300026075 Ga0207708_10166700 Ga0207708_101667003 245
334 3300026075 Ga0207708_10186867 Ga0207708_101868673 245
335 3300026089 Ga0207648_10046103 Ga0207648_100461034 245
336 3300026121 Ga0207683_10012470 Ga0207683_100124703 245
337 3300026142 Ga0207698_10891577 Ga0207698_108915771 245
338 3300027671 Ga0209588_1054254 Ga0209588_10542542 245
339 3300028380 Ga0268265_10287935 Ga0268265_102879353 245
340 3300032002 Ga0307416_100245045 Ga0307416_1002450452 245
341 3300032133 Ga0316583_10033196 Ga0316583_100331962 245
342 3300035695 Ga0373927_0364197 Ga0373927_0364197_66_803 245
343 3300044712 Ga0453684_0001982 Ga0453684_0001982_28017_28763 245
344 3300045051 Ga0451576_0176538 Ga0451576_0176538_1060_1797 245
345 3300045051 Ga0451576_0646473 Ga0451576_0646473_156_893 245
346 3300046675 Ga0495657_0126628 Ga0495657_0126628_465_1202 245
347 3300048907 Ga0496104_0005857 Ga0496104_0005857_7278_8015 245
348 3300048908 Ga0496105_0551363 Ga0496105_0551363_70_807 245
349 3300048913 Ga0496110_0101430 Ga0496110_0101430_1512_2249 245
350 3300048914 Ga0496111_0255539 Ga0496111_0255539_32_769 245
351 3300049742 Ga0501080_0095841 Ga0501080_0095841_502_1239 245
352 3300050512 nmdc:mga0n895_177484_c1 nmdc:mga0n895_177484_c1_827_1564 245
353 3300050515 nmdc:mga0a205_586678_c1 nmdc:mga0a205_586678_c1_72_809 245
354 3300005336 Ga0070680_100138758 Ga0070680_1001387582 246
355 3300005340 Ga0070689_100010523 Ga0070689_1000105234 246
356 3300005340 Ga0070689_100446496 Ga0070689_1004464962 246
357 3300005341 Ga0070691_10013529 Ga0070691_100135293 246
358 3300005343 Ga0070687_100053342 Ga0070687_1000533422 246
359 3300005345 Ga0070692_10004559 Ga0070692_100045594 246
360 3300005356 Ga0070674_100036503 Ga0070674_1000365033 246
361 3300005437 Ga0070710_10514635 Ga0070710_105146351 246
362 3300005438 Ga0070701_10008691 Ga0070701_100086913 246
363 3300005441 Ga0070700_100000758 Ga0070700_1000007583 246
364 3300005444 Ga0070694_100034598 Ga0070694_1000345984 246
365 3300005456 Ga0070678_100003117 Ga0070678_1000031172 246
366 3300005459 Ga0068867_100006064 Ga0068867_1000060645 246
367 3300005544 Ga0070686_100016080 Ga0070686_1000160804 246
368 3300005546 Ga0070696_100038676 Ga0070696_1000386762 246
369 3300005549 Ga0070704_100091644 Ga0070704_1000916443 246
370 3300005615 Ga0070702_100066675 Ga0070702_1000666753 246
371 3300005617 Ga0068859_100006763 Ga0068859_1000067634 246
372 3300005718 Ga0068866_10000263 Ga0068866_1000026323 246
373 3300005719 Ga0068861_100001018 Ga0068861_1000010185 246
374 3300005840 Ga0068870_10003609 Ga0068870_100036093 246
375 3300005842 Ga0068858_100002092 Ga0068858_1000020928 246
376 3300005843 Ga0068860_100016816 Ga0068860_1000168165 246
377 3300005844 Ga0068862_100000835 Ga0068862_10000083518 246
378 3300006237 Ga0097621_100002988 Ga0097621_10000298811 246
379 3300006358 Ga0068871_100002180 Ga0068871_1000021805 246
380 3300006881 Ga0068865_100000539 Ga0068865_10000053918 246
381 3300006931 Ga0097620_100006762 Ga0097620_1000067627 246
382 3300009098 Ga0105245_10002726 Ga0105245_1000272614 246
383 3300009148 Ga0105243_10001210 Ga0105243_100012109 246
384 3300009176 Ga0105242_10000462 Ga0105242_1000046210 246
385 3300009551 Ga0105238_10232752 Ga0105238_102327522 246
386 3300009553 Ga0105249_10023789 Ga0105249_100237893 246
387 3300013297 Ga0157378_10011077 Ga0157378_100110776 246
388 3300013306 Ga0163162_10174291 Ga0163162_101742912 246
389 3300014326 Ga0157380_10009614 Ga0157380_100096144 246
390 3300014968 Ga0157379_10013625 Ga0157379_100136254 246
391 3300025899 Ga0207642_10014964 Ga0207642_100149643 246
392 3300025908 Ga0207643_10011438 Ga0207643_100114383 246
393 3300025912 Ga0207707_10515518 Ga0207707_105155182 246
394 3300025918 Ga0207662_10022779 Ga0207662_100227793 246
395 3300025918 Ga0207662_10099739 Ga0207662_100997392 246
396 3300025927 Ga0207687_10000891 Ga0207687_100008917 246
397 3300025934 Ga0207686_10010153 Ga0207686_100101534 246
398 3300025934 Ga0207686_10194618 Ga0207686_101946183 246
399 3300025935 Ga0207709_10008636 Ga0207709_100086363 246
400 3300025936 Ga0207670_10015164 Ga0207670_100151642 246
401 3300025937 Ga0207669_10039461 Ga0207669_100394613 246
402 3300025938 Ga0207704_10001006 Ga0207704_100010068 246
403 3300025942 Ga0207689_10000044 Ga0207689_1000004450 246
404 3300025949 Ga0207667_10216674 Ga0207667_102166742 246
405 3300025961 Ga0207712_10014466 Ga0207712_100144663 246
406 3300026035 Ga0207703_10074426 Ga0207703_100744262 246
407 3300026075 Ga0207708_10000190 Ga0207708_1000019041 246
408 3300026089 Ga0207648_10000148 Ga0207648_1000014848 246
409 3300026118 Ga0207675_100000331 Ga0207675_10000033117 246
410 3300026121 Ga0207683_10007220 Ga0207683_100072202 246
411 3300028381 Ga0268264_10028286 Ga0268264_100282864 246
412 3300036401 Ga0373937_0095014 Ga0373937_0095014_1961_2701 246
413 3300037312 Ga0395899_0150468 Ga0395899_0150468_248_988 246
414 3300037418 Ga0395900_0137624 Ga0395900_0137624_1131_1871 246
415 3300038725 Ga0400484_09067 Ga0400484_09067_10272_11021 246
416 3300038725 Ga0400484_38990 Ga0400484_38990_1654_2403 246
417 3300038726 Ga0400490_45213 Ga0400490_45213_80_829 246
418 3300038735 Ga0400485_12422 Ga0400485_12422_7301_8050 246
419 3300038741 Ga0400488_34824 Ga0400488_34824_206_955 246
420 3300038741 Ga0400488_58574 Ga0400488_58574_2299_3048 246
421 3300038742 Ga0400486_10435 Ga0400486_10435_7323_8072 246
422 3300038742 Ga0400486_14629 Ga0400486_14629_762_1511 246
423 3300038742 Ga0400486_16947 Ga0400486_16947_1404_2153 246
424 3300039062 Ga0400483_106185 Ga0400483_106185_81_830 246
425 3300039062 Ga0400483_241910 Ga0400483_241910_2374_3123 246
426 3300039062 Ga0400483_250707 Ga0400483_250707_789_1538 246
427 3300039062 Ga0400483_252510 Ga0400483_252510_1703_2452 246
428 3300039062 Ga0400483_269845 Ga0400483_269845_265_1014 246
429 3300039093 Ga0400489_59570 Ga0400489_59570_25135_25884 246
430 3300039110 Ga0400487_40481 Ga0400487_40481_679_1428 246
431 3300039110 Ga0400487_49467 Ga0400487_49467_492_1241 246
432 3300042876 Ga0451577_0001485 Ga0451577_0001485_13359_14165 246
433 3300042876 Ga0451577_0019489 Ga0451577_0019489_5306_6091 246
434 3300042876 Ga0451577_0055776 Ga0451577_0055776_1080_1826 246
435 3300045051 Ga0451576_0001247 Ga0451576_0001247_17202_17987 246
436 3300046536 Ga0495587_0141653 Ga0495587_0141653_509_1249 246
437 3300046559 Ga0495667_0002319 Ga0495667_0002319_3999_4739 246
438 3300049592 Ga0501076_0067647 Ga0501076_0067647_1901_2644 246
439 3300044842 Ga0466957_0026229 Ga0466957_0026229_1621_2364 247
440 3300003320 rootH2_10019123 rootH2_1001912317 248
441 3300005289 Ga0065704_10000585 Ga0065704_1000058517 248
442 3300005981 Ga0081538_10004229 Ga0081538_100042295 248
443 3300026089 Ga0207648_10446362 Ga0207648_104463622 248
444 3300049568 Ga0501031_0046401 Ga0501031_0046401_139_921 248
445 3300049569 Ga0501032_0198254 Ga0501032_0198254_432_1214 248
446 3300049572 Ga0501036_0014674 Ga0501036_0014674_2482_3264 248
447 3300049574 Ga0501038_0036633 Ga0501038_0036633_1156_1938 248
448 3300049576 Ga0501040_0044772 Ga0501040_0044772_1315_2097 248
449 3300049578 Ga0501042_0046528 Ga0501042_0046528_61_843 248
450 3300049579 Ga0501043_0072110 Ga0501043_0072110_1725_2507 248
451 3300049580 Ga0501046_0083560 Ga0501046_0083560_1594_2376 248
452 3300049587 Ga0501071_0010741 Ga0501071_0010741_4229_5011 248
453 3300049587 Ga0501071_0249015 Ga0501071_0249015_487_1269 248
454 3300049590 Ga0501074_0165411 Ga0501074_0165411_567_1349 248
455 3300049591 Ga0501075_0016758 Ga0501075_0016758_3075_3857 248
456 3300049591 Ga0501075_0394431 Ga0501075_0394431_258_1040 248
457 3300049592 Ga0501076_0015876 Ga0501076_0015876_898_1680 248
458 3300049592 Ga0501076_0156725 Ga0501076_0156725_995_1777 248
459 3300049593 Ga0501077_0017381 Ga0501077_0017381_555_1337 248
460 3300049741 Ga0501079_0106891 Ga0501079_0106891_153_935 248
461 3300049822 Ga0501035_0078604 Ga0501035_0078604_1107_1889 248
462 3300049824 Ga0501045_0004002 Ga0501045_0004002_596_1378 248
463 3300054114 Ga0501084_0013768 Ga0501084_0013768_1915_2697 248
464 3300060353 Ga0501082_0028434 Ga0501082_0028434_2196_2978 248
465 3300060353 Ga0501082_0263932 Ga0501082_0263932_234_1016 248
466 3300060353 Ga0501082_0656135 Ga0501082_0656135_116_898 248
467 3300061734 Ga0530510_0005135 Ga0530510_0005135_5849_6631 248
468 3300009545 Ga0105237_10033220 Ga0105237_100332203 249
469 3300005466 Ga0070685_10115923 Ga0070685_101159232 250
470 iso_pu_bacteria 2887375801 2887376849 250
471 3300005337 Ga0070682_100018065 Ga0070682_1000180653 251
472 3300005985 Ga0081539_10105142 Ga0081539_101051422 251
473 3300031824 Ga0307413_10029294 Ga0307413_100292943 251
474 3300031852 Ga0307410_10388151 Ga0307410_103881512 251
475 3300031995 Ga0307409_100190383 Ga0307409_1001903833 251
476 3300032002 Ga0307416_100673711 Ga0307416_1006737112 251
477 3300032005 Ga0307411_10041286 Ga0307411_100412862 251
478 3300035398 Ga0316574_0334024 Ga0316574_0334024_183_947 251
479 iso_pu_bacteria 2855730933 2855735207 251
480 iso_pu_bacteria 2855767633 2855770991 251
481 iso_pu_bacteria 2881412998 2881418374 251
482 iso_pu_bacteria 2895511927 2895515820 251
483 3300006051 Ga0075364_10015869 Ga0075364_100158696 252
484 3300006844 Ga0075428_100243273 Ga0075428_1002432732 252
485 3300006852 Ga0075433_10242990 Ga0075433_102429902 252
486 3300031727 Ga0316576_10158899 Ga0316576_101588993 252
487 3300035398 Ga0316574_0072706 Ga0316574_0072706_258_1034 252
488 3300049587 Ga0501071_0350876 Ga0501071_0350876_327_1094 252
489 3300049742 Ga0501080_0511933 Ga0501080_0511933_114_881 252
490 3300050491 nmdc:mga00v17_200704_c1 nmdc:mga00v17_200704_c1_285_1052 252
491 3300050491 nmdc:mga00v17_54228_c1 nmdc:mga00v17_54228_c1_541_1308 252
492 3300050515 nmdc:mga0a205_649118_c1 nmdc:mga0a205_649118_c1_30_797 252
493 iso_pu_bacteria 2599185292 2599904743 252
494 iso_pu_bacteria 2643221569 2643861286 252
495 iso_pu_bacteria 2643221594 2643983069 252
496 iso_pu_bacteria 2643221621 2644120599 252
497 iso_pu_bacteria 2808606395 2809032838 252
498 iso_pu_bacteria 2857537821 2857540648 252
499 iso_pu_bacteria 2858950400 2858956333 252
500 iso_pu_bacteria 2941479691 2941482937 252
501 iso_pu_bacteria 8002392321 8002395670 252
502 3300005347 Ga0070668_100019415 Ga0070668_1000194153 253
503 3300005438 Ga0070701_10028989 Ga0070701_100289891 253
504 3300005441 Ga0070700_100022402 Ga0070700_1000224023 253
505 3300005441 Ga0070700_100212520 Ga0070700_1002125201 253
506 3300005549 Ga0070704_100040506 Ga0070704_1000405063 253
507 3300005719 Ga0068861_100034016 Ga0068861_1000340164 253
508 3300005844 Ga0068862_100047704 Ga0068862_1000477044 253
509 3300006844 Ga0075428_100002299 Ga0075428_10000229921 253
510 3300006880 Ga0075429_100056565 Ga0075429_1000565652 253
511 3300009094 Ga0111539_10006426 Ga0111539_1000642613 253
512 3300014326 Ga0157380_10046728 Ga0157380_100467283 253
513 3300025917 Ga0207660_10141848 Ga0207660_101418482 253
514 3300026089 Ga0207648_10071405 Ga0207648_100714053 253
515 3300026116 Ga0207674_10175895 Ga0207674_101758953 253
516 3300026118 Ga0207675_100002211 Ga0207675_10000221110 253
517 3300026118 Ga0207675_100143243 Ga0207675_1001432432 253
518 3300027907 Ga0207428_10055568 Ga0207428_100555683 253
519 3300049587 Ga0501071_0028160 Ga0501071_0028160_1765_2535 253
520 3300049741 Ga0501079_0270375 Ga0501079_0270375_139_909 253
521 3300049742 Ga0501080_0586354 Ga0501080_0586354_148_918 253
522 3300050508 nmdc:mga09592_33913_c1 nmdc:mga09592_33913_c1_1918_2688 253
523 3300050509 nmdc:mga0qj67_18270_c1 nmdc:mga0qj67_18270_c1_2181_2951 253
524 3300050511 nmdc:mga08y16_109961_c1 nmdc:mga08y16_109961_c1_1175_1945 253
525 3300005539 Ga0068853_100015312 Ga0068853_1000153123 254
526 3300026041 Ga0207639_10070782 Ga0207639_100707822 254
527 3300026067 Ga0207678_10173688 Ga0207678_101736884 254
528 3300037418 Ga0395900_0441732 Ga0395900_0441732_435_1220 254
529 3300037466 Ga0395898_0193597 Ga0395898_0193597_496_1281 254
530 3300046501 Ga0495607_0000004 Ga0495607_0000004_118968_119756 254
531 3300048091 Ga0495626_0066627 Ga0495626_0066627_597_1385 254
532 3300049568 Ga0501031_0062748 Ga0501031_0062748_789_1553 254
533 3300049570 Ga0501033_0002713 Ga0501033_0002713_9971_10765 254
534 3300049570 Ga0501033_0372356 Ga0501033_0372356_94_858 254
535 3300049571 Ga0501034_0004039 Ga0501034_0004039_12011_12805 254
536 3300049571 Ga0501034_0066184 Ga0501034_0066184_1766_2581 254
537 3300049571 Ga0501034_0350073 Ga0501034_0350073_274_1044 254
538 3300049572 Ga0501036_0000051 Ga0501036_0000051_59321_60115 254
539 3300049573 Ga0501037_0001916 Ga0501037_0001916_5872_6666 254
540 3300049574 Ga0501038_0001036 Ga0501038_0001036_17655_18449 254
541 3300049579 Ga0501043_0002694 Ga0501043_0002694_3248_4042 254
542 3300049580 Ga0501046_0000415 Ga0501046_0000415_9445_10239 254
543 3300049581 Ga0501047_0001927 Ga0501047_0001927_4203_4997 254
544 3300049582 Ga0501048_0404226 Ga0501048_0404226_147_941 254
545 3300049822 Ga0501035_0001342 Ga0501035_0001342_15291_16085 254
546 3300049822 Ga0501035_0577385 Ga0501035_0577385_42_827 254
547 3300049823 Ga0501044_0002429 Ga0501044_0002429_9834_10628 254
548 iso_pu_bacteria 2739367655 2739611474 254
549 iso_pu_bacteria 2857576091 2857578833 254
550 iso_pu_bacteria 2881927736 2881931399 254
551 3300003187 JGI25151J46595_10000170 JGI25151J46595_1000017029 255
552 3300003763 Ga0055529_1001572 Ga0055529_10015724 255
553 3300006051 Ga0075364_10006847 Ga0075364_100068477 255
554 3300006051 Ga0075364_10228407 Ga0075364_102284072 255
555 3300009551 Ga0105238_10610802 Ga0105238_106108021 255
556 3300025242 Ga0209258_102671 Ga0209258_1026713 255
557 3300025272 Ga0209455_1000477 Ga0209455_100047715 255
558 3300025292 Ga0209676_1002511 Ga0209676_10025112 255
559 3300025294 Ga0209025_1000071 Ga0209025_100007140 255
560 3300025298 Ga0209050_1002083 Ga0209050_100208312 255
561 3300025924 Ga0207694_10220169 Ga0207694_102201692 255
562 3300027312 Ga0209371_1006254 Ga0209371_10062542 255
563 3300030500 Ga0268256_1006273 Ga0268256_10062734 255
564 3300031911 Ga0307412_10000103 Ga0307412_1000010344 255
565 3300037418 Ga0395900_0015015 Ga0395900_0015015_6870_7640 255
566 3300041404 Ga0439436_0043511 Ga0439436_0043511_261_1037 255
567 3300048908 Ga0496105_0249243 Ga0496105_0249243_249_1025 255
568 3300048919 Ga0496116_0025792 Ga0496116_0025792_283_1059 255
569 3300048919 Ga0496116_0047715 Ga0496116_0047715_1855_2631 255
570 3300048920 Ga0496117_0030785 Ga0496117_0030785_952_1728 255
571 3300048920 Ga0496117_0036371 Ga0496117_0036371_2689_3465 255
572 3300048921 Ga0496118_0003850 Ga0496118_0003850_15280_16056 255
573 3300048921 Ga0496118_0023620 Ga0496118_0023620_2887_3663 255
574 3300048923 Ga0496120_0007149 Ga0496120_0007149_2118_2894 255
575 3300048924 Ga0496121_0000628 Ga0496121_0000628_37688_38464 255
576 3300048924 Ga0496121_0027993 Ga0496121_0027993_739_1623 255
577 3300048925 Ga0496122_0000497 Ga0496122_0000497_73612_74388 255
578 3300048925 Ga0496122_0152060 Ga0496122_0152060_319_1095 255
579 3300048926 Ga0496123_0000345 Ga0496123_0000345_15952_16728 255
580 3300048927 Ga0496124_0159205 Ga0496124_0159205_703_1479 255
581 3300048927 Ga0496124_0258063 Ga0496124_0258063_250_1026 255
582 3300048928 Ga0496125_0000166 Ga0496125_0000166_7680_8456 255
583 3300048928 Ga0496125_0008814 Ga0496125_0008814_6993_7769 255
584 3300048928 Ga0496125_0025846 Ga0496125_0025846_2967_3743 255
585 3300048929 Ga0496126_0024834 Ga0496126_0024834_3977_4753 255
586 3300049570 Ga0501033_0020221 Ga0501033_0020221_1433_2296 255
587 3300049571 Ga0501034_0088738 Ga0501034_0088738_1906_2769 255
588 3300049575 Ga0501039_0202412 Ga0501039_0202412_440_1303 255
589 3300049579 Ga0501043_0059752 Ga0501043_0059752_996_1859 255
590 3300049581 Ga0501047_0001463 Ga0501047_0001463_21123_21986 255
591 3300049822 Ga0501035_0025887 Ga0501035_0025887_934_1797 255
592 3300049823 Ga0501044_0016400 Ga0501044_0016400_3733_4596 255
593 3300050491 nmdc:mga00v17_117887_c1 nmdc:mga00v17_117887_c1_286_1053 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

113

211

0.97

PF13649

Methyltransf_25

Methyltransferase domain

112

207

0.97

PF01209

Ubie_methyltran

ubiE/COQ5 methyltransferase family

59

292

0.96

PF08242

Methyltransf_12

Methyltransferase domain

113

209

0.94

PF13489

Methyltransf_23

Methyltransferase domain

88

277

0.84

PF13847

Methyltransf_31

Methyltransferase domain

106

271

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.9445 38 253
4obx-assembly1.cif.gz_B crystal structure of yeast coq5 in the apo form 0.867 38 253
3dh0-assembly1.cif.gz_A crystal structure of a sam dependent methyltransferase from aquifex aeolicus 0.8517 58 253
3ege-assembly1.cif.gz_A crystal structure of putative methyltransferase from antibiotic biosynthesis pathway (yp_324569.1) from anabaena variabilis atcc 29413 at 2.40 a resolution 0.8167 58 241
1dus-assembly1.cif.gz_A mj0882-a hypothetical protein from m. jannaschii 0.8082 66 254
ID Description Score Start End Superfamily
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9863 38 253 3.40.50.150
af_Q9VYF8_68_301_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9672 38 254 3.40.50.150
af_Q4E3J0_145_404_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9656 70 131 3.40.50.150
af_P0A887_31_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9599 38 253 3.40.50.150
af_Q3ED65_41_261_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9533 38 253 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7V5PGH2-F1-model_v4 Class I SAM-dependent methyltransferase 0.9873 10 214 GO:0008425
GO:0009234
GO:0032259
AF-A0A6A5KTX5-F1-model_v4 deleted 0.9842 11 254
AF-A0A2E2SF17-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9815 11 253 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770
AF-A0A848S207-F1-model_v4 Demethylmenaquinone methyltransferase (EC 2.1.1.163) 0.9674 42 252 GO:0009234
GO:0032259
GO:0043770
AF-A0A2N3PMG6-F1-model_v4 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE (EC 2.1.1.163) (EC 2.1.1.201) (2-methoxy-6-polyprenyl-1,4-benzoquinol methylase) (Demethylmenaquinone methyltransferase) 0.9653 16 255 GO:0008425
GO:0009060
GO:0009234
GO:0032259
GO:0043770

Feature Viewer

pLDDT pTM Quality
86.49 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map