F467256
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 254 | 593 | 356 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0139457|Ga0451577_0139457_966_2156 |
| Length | 396 |
| Sequence | MPLRRSAFRRSAVKPAIHASPVETAVQSRKIRRKIRAAMKITSIETCLLTVPTPRPMSTEWPHHKFVVADIATDEGVSGHGYSMVFGGGGAEAVLAYLDTRLKGLLIGEDPLQVERLWDKMYRGDRGVRRVGIAGMAISALDIALWDLAGKAAGLPLYKLWGGFTDRVSAYGSGGWGKYSEAELVAEAQRYAAAGCKYYKMKIHHPDPKVNRARVEAVRKAVGPGMRMMVDVNQKLDLEGNRRQAALLEDFDLVWYEEPVLSDDLAACEEVARAIRIPVATGENNYTRYEFRELIQRRAARYLMPDVCRANGYSETLKIGHLAAAHGIAVSPHVVHELSLQVCGALSNGFLVEYMDWAPKDLFEELPECKDGEFRIPAKPGHGIAMTKEALKKYRV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003347 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM | Metagenome | Rhizosphere |
| 2 | 3300003503 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 67 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 155 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 160 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 161 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 163 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 166 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 168 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 170 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 173 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 182 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 183 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 184 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 185 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 186 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 187 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 188 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 189 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 190 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 191 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 195 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 213 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 253 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.67 |
| Rhizosphere | 99.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI26128J50194_1000894 | 3300003347 | Bacteria | 1808 |
| 2 | JGI26141J51220_1000826 | 3300003503 | Bacteria | 1802 |
| 3 | Ga0065715_10114096 | 3300005293 | Bacteria | 2463 |
| 4 | Ga0070676_10001199 | 3300005328 | Bacteria | 12991 |
| 5 | Ga0070683_100063983 | 3300005329 | Bacteria | 3423 |
| 6 | Ga0070690_100004007 | 3300005330 | Bacteria | 8148 |
| 7 | Ga0070690_100015226 | 3300005330 | Bacteria | 4583 |
| 8 | Ga0068869_100003166 | 3300005334 | Bacteria | 10041 |
| 9 | Ga0068869_100003313 | 3300005334 | Bacteria | 9842 |
| 10 | Ga0070666_10091539 | 3300005335 | Bacteria | 2089 |
| 11 | Ga0070680_100000149 | 3300005336 | Bacteria | 43060 |
| 12 | Ga0070680_100010180 | 3300005336 | Bacteria | 7252 |
| 13 | Ga0070680_100065485 | 3300005336 | Bacteria | 2978 |
| 14 | Ga0070682_100003456 | 3300005337 | Bacteria | 8738 |
| 15 | Ga0070682_100004482 | 3300005337 | Bacteria | 7759 |
| 16 | Ga0068868_100000056 | 3300005338 | Bacteria | 63982 |
| 17 | Ga0070660_100001484 | 3300005339 | Bacteria | 16063 |
| 18 | Ga0070689_100000200 | 3300005340 | Bacteria | 35886 |
| 19 | Ga0070689_100054730 | 3300005340 | Bacteria | 3090 |
| 20 | Ga0070689_100295474 | 3300005340 | Bacteria | 1347 |
| 21 | Ga0070691_10002484 | 3300005341 | Bacteria | 8201 |
| 22 | Ga0070691_10003669 | 3300005341 | Bacteria | 6933 |
| 23 | Ga0070691_10008969 | 3300005341 | Bacteria | 4575 |
| 24 | Ga0070687_100000052 | 3300005343 | Bacteria | 37327 |
| 25 | Ga0070687_100040762 | 3300005343 | Bacteria | 2342 |
| 26 | Ga0070661_100001482 | 3300005344 | Bacteria | 16294 |
| 27 | Ga0070692_10000237 | 3300005345 | Bacteria | 15137 |
| 28 | Ga0070669_100157823 | 3300005353 | Bacteria | 1760 |
| 29 | Ga0070688_100033852 | 3300005365 | Bacteria | 3090 |
| 30 | Ga0070659_100001725 | 3300005366 | Bacteria | 15702 |
| 31 | Ga0070667_100054095 | 3300005367 | Bacteria | 3389 |
| 32 | Ga0070701_10003888 | 3300005438 | Bacteria | 5964 |
| 33 | Ga0070701_10098173 | 3300005438 | Bacteria | 1617 |
| 34 | Ga0070705_100000638 | 3300005440 | Bacteria | 20069 |
| 35 | Ga0070705_100008127 | 3300005440 | Bacteria | 5190 |
| 36 | Ga0070705_100009236 | 3300005440 | Bacteria | 4898 |
| 37 | Ga0070705_100093941 | 3300005440 | Bacteria | 1876 |
| 38 | Ga0070700_100000211 | 3300005441 | Bacteria | 32522 |
| 39 | Ga0070694_100012825 | 3300005444 | Bacteria | 5223 |
| 40 | Ga0070694_100014905 | 3300005444 | Bacteria | 4871 |
| 41 | Ga0070694_100019179 | 3300005444 | Bacteria | 4349 |
| 42 | Ga0070694_100202874 | 3300005444 | Bacteria | 1479 |
| 43 | Ga0070708_100197938 | 3300005445 | Bacteria | 1880 |
| 44 | Ga0070663_100067992 | 3300005455 | Bacteria | 2586 |
| 45 | Ga0070662_100001423 | 3300005457 | Bacteria | 14758 |
| 46 | Ga0070681_10000525 | 3300005458 | Bacteria | 31394 |
| 47 | Ga0070681_10040330 | 3300005458 | Bacteria | 4678 |
| 48 | Ga0068867_100006487 | 3300005459 | Bacteria | 8266 |
| 49 | Ga0068867_100012689 | 3300005459 | Bacteria | 5960 |
| 50 | Ga0068867_100014336 | 3300005459 | Bacteria | 5614 |
| 51 | Ga0068867_100236697 | 3300005459 | Bacteria | 1479 |
| 52 | Ga0070706_100149877 | 3300005467 | Bacteria | 2177 |
| 53 | Ga0070706_100166342 | 3300005467 | Unclassified | 2059 |
| 54 | Ga0070706_100246353 | 3300005467 | Bacteria | 1669 |
| 55 | Ga0070706_100364510 | 3300005467 | Bacteria | 1346 |
| 56 | Ga0070707_100027164 | 3300005468 | Bacteria | 5442 |
| 57 | Ga0070707_100034501 | 3300005468 | Bacteria | 4825 |
| 58 | Ga0070707_100182361 | 3300005468 | Unclassified | 2047 |
| 59 | Ga0070698_100002031 | 3300005471 | Bacteria | 22500 |
| 60 | Ga0070698_100018091 | 3300005471 | Bacteria | 7420 |
| 61 | Ga0070698_100042807 | 3300005471 | Bacteria | 4645 |
| 62 | Ga0070698_100165087 | 3300005471 | Bacteria | 2157 |
| 63 | Ga0070699_100005247 | 3300005518 | Bacteria | 11376 |
| 64 | Ga0070699_100008860 | 3300005518 | Bacteria | 8711 |
| 65 | Ga0070699_100013971 | 3300005518 | Bacteria | 6907 |
| 66 | Ga0070699_100031566 | 3300005518 | Bacteria | 4573 |
| 67 | Ga0070699_100063401 | 3300005518 | Bacteria | 3205 |
| 68 | Ga0070699_100070352 | 3300005518 | Bacteria | 3042 |
| 69 | Ga0070699_100196508 | 3300005518 | Unclassified | 1793 |
| 70 | Ga0070679_100022523 | 3300005530 | Bacteria | 6158 |
| 71 | Ga0070679_100027284 | 3300005530 | Bacteria | 5619 |
| 72 | Ga0070679_100095686 | 3300005530 | Bacteria | 2957 |
| 73 | Ga0070684_100008881 | 3300005535 | Bacteria | 7883 |
| 74 | Ga0070684_100070340 | 3300005535 | Bacteria | 3079 |
| 75 | Ga0070697_100029077 | 3300005536 | Bacteria | 4429 |
| 76 | Ga0070697_100215992 | 3300005536 | Bacteria | 1634 |
| 77 | Ga0068853_100001823 | 3300005539 | Bacteria | 15670 |
| 78 | Ga0070672_100246796 | 3300005543 | Bacteria | 1503 |
| 79 | Ga0070686_100000545 | 3300005544 | Bacteria | 22498 |
| 80 | Ga0070686_100010212 | 3300005544 | Bacteria | 5285 |
| 81 | Ga0070695_100001651 | 3300005545 | Bacteria | 12528 |
| 82 | Ga0070695_100004303 | 3300005545 | Bacteria | 8339 |
| 83 | Ga0070695_100012905 | 3300005545 | Bacteria | 5016 |
| 84 | Ga0070695_100037942 | 3300005545 | Bacteria | 3038 |
| 85 | Ga0070695_100049167 | 3300005545 | Bacteria | 2699 |
| 86 | Ga0070696_100000012 | 3300005546 | Bacteria | 79388 |
| 87 | Ga0070696_100002298 | 3300005546 | Bacteria | 12607 |
| 88 | Ga0070696_100033450 | 3300005546 | Bacteria | 3532 |
| 89 | Ga0070696_100046429 | 3300005546 | Bacteria | 3012 |
| 90 | Ga0070696_100096985 | 3300005546 | Bacteria | 2107 |
| 91 | Ga0070693_100000579 | 3300005547 | Bacteria | 16207 |
| 92 | Ga0070693_100003873 | 3300005547 | Bacteria | 7017 |
| 93 | Ga0070693_100146810 | 3300005547 | Bacteria | 1490 |
| 94 | Ga0070704_100001021 | 3300005549 | Bacteria | 14388 |
| 95 | Ga0070704_100003341 | 3300005549 | Bacteria | 9183 |
| 96 | Ga0070704_100090289 | 3300005549 | Bacteria | 2281 |
| 97 | Ga0068855_100005123 | 3300005563 | Bacteria | 15980 |
| 98 | Ga0068855_100045041 | 3300005563 | Bacteria | 5219 |
| 99 | Ga0070664_100019414 | 3300005564 | Bacteria | 5593 |
| 100 | Ga0068854_100075964 | 3300005578 | Bacteria | 2468 |
| 101 | Ga0068856_100046268 | 3300005614 | Bacteria | 4286 |
| 102 | Ga0068856_100106739 | 3300005614 | Bacteria | 2795 |
| 103 | Ga0070702_100000225 | 3300005615 | Bacteria | 19043 |
| 104 | Ga0070702_100013212 | 3300005615 | Bacteria | 4163 |
| 105 | Ga0070702_100110666 | 3300005615 | Bacteria | 1702 |
| 106 | Ga0068852_100038813 | 3300005616 | Bacteria | 4005 |
| 107 | Ga0068859_100015807 | 3300005617 | Bacteria | 7582 |
| 108 | Ga0068859_100059404 | 3300005617 | Bacteria | 3852 |
| 109 | Ga0068859_100074965 | 3300005617 | Bacteria | 3423 |
| 110 | Ga0068859_100547624 | 3300005617 | Unclassified | 1252 |
| 111 | Ga0068864_100048082 | 3300005618 | Bacteria | 3666 |
| 112 | Ga0068864_100128262 | 3300005618 | Bacteria | 2275 |
| 113 | Ga0068866_10000850 | 3300005718 | Bacteria | 13518 |
| 114 | Ga0068861_100000033 | 3300005719 | Bacteria | 64659 |
| 115 | Ga0068861_100131639 | 3300005719 | Bacteria | 2031 |
| 116 | Ga0068870_10000437 | 3300005840 | Bacteria | 15814 |
| 117 | Ga0068870_10047180 | 3300005840 | Unclassified | 2263 |
| 118 | Ga0068863_100230438 | 3300005841 | Bacteria | 1786 |
| 119 | Ga0068858_100001425 | 3300005842 | Bacteria | 24575 |
| 120 | Ga0068858_100012686 | 3300005842 | Bacteria | 7940 |
| 121 | Ga0068860_100007436 | 3300005843 | Bacteria | 10953 |
| 122 | Ga0068860_100057420 | 3300005843 | Bacteria | 3700 |
| 123 | Ga0068860_100139938 | 3300005843 | Bacteria | 2326 |
| 124 | Ga0068860_100370308 | 3300005843 | Bacteria | 1413 |
| 125 | Ga0068862_100000735 | 3300005844 | Bacteria | 32926 |
| 126 | Ga0068862_100002850 | 3300005844 | Bacteria | 15162 |
| 127 | Ga0068862_100015430 | 3300005844 | Bacteria | 6346 |
| 128 | Ga0068862_100481446 | 3300005844 | Unclassified | 1175 |
| 129 | Ga0081540_1061624 | 3300005983 | Bacteria | 1787 |
| 130 | Ga0081539_10000462 | 3300005985 | Bacteria | 86060 |
| 131 | Ga0070716_100021860 | 3300006173 | Bacteria | 3374 |
| 132 | Ga0097621_100000939 | 3300006237 | Bacteria | 20422 |
| 133 | Ga0068871_100001863 | 3300006358 | Bacteria | 14259 |
| 134 | Ga0068871_100003056 | 3300006358 | Bacteria | 11486 |
| 135 | Ga0075428_100009686 | 3300006844 | Bacteria | 10701 |
| 136 | Ga0075428_100010456 | 3300006844 | Bacteria | 10308 |
| 137 | Ga0075428_100024711 | 3300006844 | Bacteria | 6648 |
| 138 | Ga0075430_100000086 | 3300006846 | Bacteria | 52815 |
| 139 | Ga0075431_100016749 | 3300006847 | Bacteria | 7443 |
| 140 | Ga0075431_100020018 | 3300006847 | Bacteria | 6833 |
| 141 | Ga0075431_100191257 | 3300006847 | Bacteria | 2097 |
| 142 | Ga0075433_10000500 | 3300006852 | Bacteria | 25544 |
| 143 | Ga0075433_10001084 | 3300006852 | Bacteria | 19620 |
| 144 | Ga0075433_10004787 | 3300006852 | Bacteria | 10563 |
| 145 | Ga0075433_10051178 | 3300006852 | Bacteria | 3596 |
| 146 | Ga0075434_100003449 | 3300006871 | Bacteria | 14136 |
| 147 | Ga0075434_100022012 | 3300006871 | Bacteria | 6204 |
| 148 | Ga0075434_100068637 | 3300006871 | Bacteria | 3532 |
| 149 | Ga0075429_100000259 | 3300006880 | Bacteria | 36776 |
| 150 | Ga0075429_100003089 | 3300006880 | Bacteria | 14125 |
| 151 | Ga0075429_100077207 | 3300006880 | Bacteria | 2902 |
| 152 | Ga0075429_100164001 | 3300006880 | Bacteria | 1946 |
| 153 | Ga0075429_100273463 | 3300006880 | Unclassified | 1479 |
| 154 | Ga0068865_100000844 | 3300006881 | Bacteria | 17310 |
| 155 | Ga0068865_100142418 | 3300006881 | Bacteria | 1809 |
| 156 | Ga0075436_100000428 | 3300006914 | Bacteria | 26958 |
| 157 | Ga0075436_100000874 | 3300006914 | Bacteria | 20002 |
| 158 | Ga0075436_100002996 | 3300006914 | Bacteria | 11564 |
| 159 | Ga0075436_100007399 | 3300006914 | Bacteria | 7512 |
| 160 | Ga0075436_100038875 | 3300006914 | Bacteria | 3283 |
| 161 | Ga0097620_100015807 | 3300006931 | Bacteria | 7582 |
| 162 | Ga0097620_100059402 | 3300006931 | Bacteria | 3852 |
| 163 | Ga0097620_100074965 | 3300006931 | Bacteria | 3423 |
| 164 | Ga0097620_100547630 | 3300006931 | Unclassified | 1252 |
| 165 | Ga0075435_100000047 | 3300007076 | Bacteria | 60782 |
| 166 | Ga0075435_100005084 | 3300007076 | Bacteria | 9141 |
| 167 | Ga0075435_100016888 | 3300007076 | Bacteria | 5510 |
| 168 | Ga0075435_100019309 | 3300007076 | Bacteria | 5203 |
| 169 | Ga0075435_100032594 | 3300007076 | Bacteria | 4115 |
| 170 | Ga0075435_100071354 | 3300007076 | Bacteria | 2836 |
| 171 | Ga0099794_10002556 | 3300007265 | Bacteria | 6741 |
| 172 | Ga0099794_10089567 | 3300007265 | Bacteria | 1526 |
| 173 | Ga0111539_10001693 | 3300009094 | Bacteria | 29397 |
| 174 | Ga0111539_10006843 | 3300009094 | Bacteria | 14647 |
| 175 | Ga0111539_10009904 | 3300009094 | Bacteria | 12026 |
| 176 | Ga0111539_10017117 | 3300009094 | Bacteria | 8973 |
| 177 | Ga0111539_10030292 | 3300009094 | Bacteria | 6578 |
| 178 | Ga0111539_10117642 | 3300009094 | Bacteria | 3115 |
| 179 | Ga0105245_10027918 | 3300009098 | Bacteria | 4974 |
| 180 | Ga0105245_10050484 | 3300009098 | Bacteria | 3728 |
| 181 | Ga0114129_10000430 | 3300009147 | Bacteria | 49930 |
| 182 | Ga0114129_10002283 | 3300009147 | Bacteria | 26550 |
| 183 | Ga0114129_10003662 | 3300009147 | Bacteria | 21610 |
| 184 | Ga0114129_10004826 | 3300009147 | Bacteria | 19052 |
| 185 | Ga0114129_10039602 | 3300009147 | Bacteria | 6645 |
| 186 | Ga0114129_10055532 | 3300009147 | Bacteria | 5549 |
| 187 | Ga0114129_10088122 | 3300009147 | Bacteria | 4304 |
| 188 | Ga0114129_10292403 | 3300009147 | Unclassified | 2174 |
| 189 | Ga0105243_10000374 | 3300009148 | Bacteria | 48005 |
| 190 | Ga0105241_10000133 | 3300009174 | Bacteria | 53690 |
| 191 | Ga0105241_10101271 | 3300009174 | Bacteria | 2290 |
| 192 | Ga0105242_10000192 | 3300009176 | Bacteria | 47321 |
| 193 | Ga0105242_10067713 | 3300009176 | Bacteria | 2952 |
| 194 | Ga0105242_10388307 | 3300009176 | Bacteria | 1299 |
| 195 | Ga0105248_10238643 | 3300009177 | Bacteria | 2046 |
| 196 | Ga0105248_10356588 | 3300009177 | Bacteria | 1647 |
| 197 | Ga0105237_10207698 | 3300009545 | Bacteria | 1958 |
| 198 | Ga0105249_10122917 | 3300009553 | Bacteria | 2469 |
| 199 | Ga0105249_10242318 | 3300009553 | Bacteria | 1783 |
| 200 | Ga0105239_10051262 | 3300010375 | Bacteria | 4525 |
| 201 | Ga0105246_10297936 | 3300011119 | Bacteria | 1301 |
| 202 | Ga0157373_10013951 | 3300013100 | Bacteria | 5893 |
| 203 | Ga0157371_10085185 | 3300013102 | Bacteria | 2239 |
| 204 | Ga0157369_10062664 | 3300013105 | Bacteria | 4007 |
| 205 | Ga0157378_10004115 | 3300013297 | Bacteria | 12844 |
| 206 | Ga0157378_10448598 | 3300013297 | Unclassified | 1280 |
| 207 | Ga0157372_10006881 | 3300013307 | Bacteria | 12099 |
| 208 | Ga0157372_10037276 | 3300013307 | Bacteria | 5361 |
| 209 | Ga0157375_10139004 | 3300013308 | Bacteria | 2554 |
| 210 | Ga0157379_10470163 | 3300014968 | Bacteria | 1163 |
| 211 | Ga0157376_10033953 | 3300014969 | Bacteria | 4114 |
| 212 | Ga0207653_10007379 | 3300025885 | Bacteria | 3427 |
| 213 | Ga0207642_10000362 | 3300025899 | Bacteria | 13648 |
| 214 | Ga0207688_10008520 | 3300025901 | Bacteria | 5583 |
| 215 | Ga0207647_10146962 | 3300025904 | Unclassified | 1379 |
| 216 | Ga0207699_10127321 | 3300025906 | Bacteria | 1656 |
| 217 | Ga0207645_10002226 | 3300025907 | Bacteria | 15461 |
| 218 | Ga0207643_10001163 | 3300025908 | Bacteria | 15640 |
| 219 | Ga0207684_10001116 | 3300025910 | Bacteria | 29985 |
| 220 | Ga0207684_10040381 | 3300025910 | Bacteria | 3955 |
| 221 | Ga0207684_10044522 | 3300025910 | Bacteria | 3764 |
| 222 | Ga0207684_10069708 | 3300025910 | Unclassified | 2988 |
| 223 | Ga0207654_10089814 | 3300025911 | Bacteria | 1870 |
| 224 | Ga0207707_10000556 | 3300025912 | Bacteria | 37797 |
| 225 | Ga0207707_10161410 | 3300025912 | Bacteria | 1959 |
| 226 | Ga0207707_10263395 | 3300025912 | Bacteria | 1495 |
| 227 | Ga0207671_10115518 | 3300025914 | Bacteria | 2046 |
| 228 | Ga0207660_10002844 | 3300025917 | Bacteria | 11320 |
| 229 | Ga0207660_10231122 | 3300025917 | Bacteria | 1454 |
| 230 | Ga0207662_10000126 | 3300025918 | Bacteria | 36663 |
| 231 | Ga0207662_10060764 | 3300025918 | Bacteria | 2267 |
| 232 | Ga0207657_10003869 | 3300025919 | Bacteria | 15892 |
| 233 | Ga0207649_10005083 | 3300025920 | Bacteria | 7111 |
| 234 | Ga0207652_10016524 | 3300025921 | Bacteria | 6027 |
| 235 | Ga0207652_10024890 | 3300025921 | Bacteria | 4969 |
| 236 | Ga0207652_10110452 | 3300025921 | Bacteria | 2438 |
| 237 | Ga0207646_10015141 | 3300025922 | Bacteria | 7295 |
| 238 | Ga0207646_10075464 | 3300025922 | Bacteria | 3012 |
| 239 | Ga0207646_10089324 | 3300025922 | Bacteria | 2758 |
| 240 | Ga0207646_10113168 | 3300025922 | Unclassified | 2436 |
| 241 | Ga0207659_10146765 | 3300025926 | Bacteria | 1838 |
| 242 | Ga0207687_10000739 | 3300025927 | Bacteria | 22162 |
| 243 | Ga0207690_10025096 | 3300025932 | Bacteria | 3738 |
| 244 | Ga0207706_10045328 | 3300025933 | Bacteria | 3897 |
| 245 | Ga0207706_10120940 | 3300025933 | Bacteria | 2302 |
| 246 | Ga0207686_10000564 | 3300025934 | Bacteria | 23601 |
| 247 | Ga0207709_10000444 | 3300025935 | Bacteria | 38874 |
| 248 | Ga0207709_10032445 | 3300025935 | Bacteria | 3058 |
| 249 | Ga0207670_10004733 | 3300025936 | Bacteria | 7380 |
| 250 | Ga0207670_10050653 | 3300025936 | Bacteria | 2784 |
| 251 | Ga0207704_10018655 | 3300025938 | Bacteria | 3627 |
| 252 | Ga0207711_10320237 | 3300025941 | Bacteria | 1433 |
| 253 | Ga0207689_10000240 | 3300025942 | Bacteria | 48953 |
| 254 | Ga0207689_10001708 | 3300025942 | Bacteria | 20783 |
| 255 | Ga0207689_10067886 | 3300025942 | Bacteria | 2930 |
| 256 | Ga0207689_10377772 | 3300025942 | Bacteria | 1180 |
| 257 | Ga0207661_10083813 | 3300025944 | Bacteria | 2639 |
| 258 | Ga0207679_10050632 | 3300025945 | Bacteria | 3036 |
| 259 | Ga0207667_10005121 | 3300025949 | Bacteria | 16007 |
| 260 | Ga0207667_10289484 | 3300025949 | Bacteria | 1674 |
| 261 | Ga0207651_10103011 | 3300025960 | Bacteria | 2123 |
| 262 | Ga0207712_10023431 | 3300025961 | Bacteria | 4073 |
| 263 | Ga0207712_10289797 | 3300025961 | Bacteria | 1339 |
| 264 | Ga0207640_10284003 | 3300025981 | Bacteria | 1301 |
| 265 | Ga0207658_10179278 | 3300025986 | Bacteria | 1752 |
| 266 | Ga0207677_10000680 | 3300026023 | Bacteria | 20127 |
| 267 | Ga0207703_10011438 | 3300026035 | Bacteria | 6901 |
| 268 | Ga0207703_10012196 | 3300026035 | Bacteria | 6701 |
| 269 | Ga0207639_10006287 | 3300026041 | Bacteria | 8066 |
| 270 | Ga0207639_10042416 | 3300026041 | Bacteria | 3410 |
| 271 | Ga0207678_10021293 | 3300026067 | Bacteria | 5684 |
| 272 | Ga0207708_10000153 | 3300026075 | Bacteria | 54987 |
| 273 | Ga0207708_10235093 | 3300026075 | Bacteria | 1472 |
| 274 | Ga0207702_10037222 | 3300026078 | Bacteria | 4072 |
| 275 | Ga0207702_10173553 | 3300026078 | Bacteria | 1979 |
| 276 | Ga0207641_10204174 | 3300026088 | Bacteria | 1824 |
| 277 | Ga0207648_10000130 | 3300026089 | Bacteria | 74342 |
| 278 | Ga0207648_10064265 | 3300026089 | Bacteria | 3199 |
| 279 | Ga0207648_10064672 | 3300026089 | Bacteria | 3188 |
| 280 | Ga0207648_10066485 | 3300026089 | Bacteria | 3144 |
| 281 | Ga0207676_10156850 | 3300026095 | Bacteria | 1967 |
| 282 | Ga0207674_10005434 | 3300026116 | Bacteria | 15131 |
| 283 | Ga0207674_10008790 | 3300026116 | Bacteria | 11628 |
| 284 | Ga0207674_10239562 | 3300026116 | Unclassified | 1761 |
| 285 | Ga0207675_100000253 | 3300026118 | Bacteria | 51284 |
| 286 | Ga0207675_100018522 | 3300026118 | Bacteria | 6494 |
| 287 | Ga0207683_10178537 | 3300026121 | Bacteria | 1925 |
| 288 | Ga0207698_10236381 | 3300026142 | Bacteria | 1662 |
| 289 | Ga0207698_10264687 | 3300026142 | Bacteria | 1581 |
| 290 | Ga0209967_1000731 | 3300027364 | Bacteria | 4223 |
| 291 | Ga0209981_1001009 | 3300027378 | Bacteria | 3550 |
| 292 | Ga0209984_1000948 | 3300027424 | Bacteria | 3099 |
| 293 | Ga0209995_1002532 | 3300027471 | Bacteria | 2894 |
| 294 | Ga0209968_1001882 | 3300027526 | Bacteria | 3183 |
| 295 | Ga0209999_1000956 | 3300027543 | Bacteria | 4865 |
| 296 | Ga0209983_1000928 | 3300027665 | Bacteria | 6438 |
| 297 | Ga0209588_1044431 | 3300027671 | Bacteria | 1437 |
| 298 | Ga0209971_1004436 | 3300027682 | Bacteria | 3332 |
| 299 | Ga0209966_1000256 | 3300027695 | Bacteria | 19430 |
| 300 | Ga0209998_10000070 | 3300027717 | Bacteria | 40919 |
| 301 | Ga0209974_10000099 | 3300027876 | Bacteria | 24483 |
| 302 | Ga0207428_10000721 | 3300027907 | Bacteria | 38142 |
| 303 | Ga0207428_10000794 | 3300027907 | Bacteria | 35722 |
| 304 | Ga0207428_10006425 | 3300027907 | Bacteria | 10856 |
| 305 | Ga0268265_10028859 | 3300028380 | Bacteria | 3976 |
| 306 | Ga0268265_10038678 | 3300028380 | Bacteria | 3510 |
| 307 | Ga0268264_10037504 | 3300028381 | Bacteria | 3996 |
| 308 | Ga0268264_10042535 | 3300028381 | Bacteria | 3761 |
| 309 | Ga0268264_10143371 | 3300028381 | Bacteria | 2133 |
| 310 | Ga0268264_10149836 | 3300028381 | Bacteria | 2090 |
| 311 | Ga0307408_100004301 | 3300031548 | Bacteria | 9666 |
| 312 | Ga0307408_100160785 | 3300031548 | Bacteria | 1784 |
| 313 | Ga0307405_10031779 | 3300031731 | Bacteria | 3112 |
| 314 | Ga0307405_10242940 | 3300031731 | Bacteria | 1335 |
| 315 | Ga0307412_10222407 | 3300031911 | Unclassified | 1448 |
| 316 | Ga0307416_100047136 | 3300032002 | Bacteria | 3408 |
| 317 | Ga0307416_100232448 | 3300032002 | Unclassified | 1779 |
| 318 | Ga0373948_0003581 | 3300034817 | Bacteria | 2398 |
| 319 | Ga0373940_0003844 | 3300035088 | Bacteria | 3114 |
| 320 | Ga0373944_0010354 | 3300035089 | Bacteria | 2540 |
| 321 | Ga0373936_0000959 | 3300035113 | Bacteria | 10286 |
| 322 | Ga0373939_0001857 | 3300035114 | Bacteria | 5063 |
| 323 | Ga0373941_0020213 | 3300035115 | Bacteria | 1864 |
| 324 | Ga0373941_0073687 | 3300035115 | Bacteria | 1139 |
| 325 | Ga0373945_0002992 | 3300035116 | Bacteria | 5312 |
| 326 | Ga0373946_0006410 | 3300035171 | Bacteria | 4265 |
| 327 | Ga0373955_0012841 | 3300035172 | Bacteria | 4037 |
| 328 | Ga0373942_0004845 | 3300035207 | Bacteria | 3125 |
| 329 | Ga0373942_0006378 | 3300035207 | Bacteria | 2723 |
| 330 | Ga0373961_0010146 | 3300035241 | Bacteria | 2318 |
| 331 | Ga0373961_0033438 | 3300035241 | Bacteria | 1448 |
| 332 | Ga0373962_0021994 | 3300035242 | Bacteria | 1687 |
| 333 | Ga0373924_0008820 | 3300035410 | Bacteria | 3678 |
| 334 | Ga0373931_0004555 | 3300035691 | Bacteria | 6342 |
| 335 | Ga0373931_0141349 | 3300035691 | Bacteria | 1394 |
| 336 | Ga0373935_0011964 | 3300035692 | Bacteria | 5212 |
| 337 | Ga0373927_0082726 | 3300035695 | Bacteria | 2081 |
| 338 | Ga0373933_0001569 | 3300035724 | Bacteria | 13375 |
| 339 | Ga0373947_0067326 | 3300035725 | Bacteria | 2187 |
| 340 | Ga0373937_0001440 | 3300036401 | Bacteria | 19895 |
| 341 | Ga0395900_0374052 | 3300037418 | Unclassified | 1394 |
| 342 | Ga0436360_1309494 | 3300039438 | Bacteria | 2197 |
| 343 | Ga0439461_0001446 | 3300041410 | Bacteria | 3670 |
| 344 | Ga0451839_0456736 | 3300041496 | Bacteria | 1689 |
| 345 | Ga0439441_002359 | 3300042001 | Bacteria | 2651 |
| 346 | Ga0439455_0000404 | 3300042012 | Bacteria | 5727 |
| 347 | Ga0439446_0005070 | 3300042156 | Bacteria | 3372 |
| 348 | Ga0439434_0007668 | 3300042435 | Bacteria | 3162 |
| 349 | Ga0439459_0001683 | 3300042438 | Bacteria | 3293 |
| 350 | Ga0439460_0000467 | 3300042461 | Bacteria | 8757 |
| 351 | Ga0451577_0030057 | 3300042876 | Bacteria | 4909 |
| 352 | Ga0451577_0064436 | 3300042876 | Bacteria | 3268 |
| 353 | Ga0451577_0139457 | 3300042876 | Bacteria | 2178 |
| 354 | Ga0453683_0038018 | 3300044673 | Unclassified | 3026 |
| 355 | Ga0453684_0053783 | 3300044712 | Bacteria | 5252 |
| 356 | Ga0453684_0187883 | 3300044712 | Bacteria | 2419 |
| 357 | Ga0453684_0377246 | 3300044712 | Bacteria | 1593 |
| 358 | Ga0451576_0003101 | 3300045051 | Bacteria | 23314 |
| 359 | Ga0451576_0014943 | 3300045051 | Bacteria | 8622 |
| 360 | Ga0451576_0024911 | 3300045051 | Bacteria | 6456 |
| 361 | Ga0451576_0073051 | 3300045051 | Bacteria | 3569 |
| 362 | Ga0451576_0098988 | 3300045051 | Bacteria | 3033 |
| 363 | Ga0451576_0101156 | 3300045051 | Bacteria | 2997 |
| 364 | Ga0451576_0252735 | 3300045051 | Bacteria | 1842 |
| 365 | Ga0451576_0400865 | 3300045051 | Bacteria | 1438 |
| 366 | Ga0451576_0510050 | 3300045051 | Bacteria | 1263 |
| 367 | Ga0466967_0010071 | 3300045976 | Bacteria | 7065 |
| 368 | Ga0495603_0044154 | 3300046455 | Bacteria | 2660 |
| 369 | Ga0495580_0000845 | 3300046472 | Bacteria | 26536 |
| 370 | Ga0495580_0004779 | 3300046472 | Bacteria | 11342 |
| 371 | Ga0495580_0031006 | 3300046472 | Bacteria | 3867 |
| 372 | Ga0495582_0046060 | 3300046473 | Bacteria | 2402 |
| 373 | Ga0495662_0016646 | 3300046476 | Bacteria | 3562 |
| 374 | Ga0495630_0046766 | 3300046517 | Bacteria | 3235 |
| 375 | Ga0495630_0130107 | 3300046517 | Bacteria | 1911 |
| 376 | Ga0495666_0008044 | 3300046526 | Bacteria | 5285 |
| 377 | Ga0495642_0015060 | 3300046528 | Bacteria | 3003 |
| 378 | Ga0495586_0007966 | 3300046535 | Bacteria | 5650 |
| 379 | Ga0495586_0077795 | 3300046535 | Bacteria | 1819 |
| 380 | Ga0495598_0004441 | 3300046537 | Bacteria | 3037 |
| 381 | Ga0495621_0060717 | 3300046539 | Bacteria | 1372 |
| 382 | Ga0495656_0016044 | 3300046615 | Bacteria | 2838 |
| 383 | Ga0495659_0006510 | 3300046664 | Bacteria | 3688 |
| 384 | Ga0495588_0046765 | 3300046674 | Bacteria | 2220 |
| 385 | Ga0495647_0001586 | 3300046681 | Bacteria | 7024 |
| 386 | Ga0495669_0045474 | 3300046684 | Bacteria | 1957 |
| 387 | Ga0495669_0074494 | 3300046684 | Bacteria | 1552 |
| 388 | Ga0495676_0060585 | 3300047321 | Bacteria | 2965 |
| 389 | Ga0496102_0049341 | 3300048905 | Bacteria | 3829 |
| 390 | Ga0496102_0084015 | 3300048905 | Bacteria | 2938 |
| 391 | Ga0496106_0029604 | 3300048909 | Bacteria | 4082 |
| 392 | Ga0496106_0164325 | 3300048909 | Bacteria | 1757 |
| 393 | Ga0501031_0042967 | 3300049568 | Bacteria | 2950 |
| 394 | Ga0501033_0215223 | 3300049570 | Unclassified | 1369 |
| 395 | Ga0501033_0292380 | 3300049570 | Bacteria | 1148 |
| 396 | Ga0501036_0000338 | 3300049572 | Bacteria | 32764 |
| 397 | Ga0501036_0061415 | 3300049572 | Bacteria | 3183 |
| 398 | Ga0501036_0120391 | 3300049572 | Bacteria | 2217 |
| 399 | Ga0501036_0211346 | 3300049572 | Bacteria | 1630 |
| 400 | Ga0501036_0291388 | 3300049572 | Bacteria | 1366 |
| 401 | Ga0501037_0019615 | 3300049573 | Bacteria | 4989 |
| 402 | Ga0501038_0000401 | 3300049574 | Bacteria | 37613 |
| 403 | Ga0501038_0029223 | 3300049574 | Bacteria | 4887 |
| 404 | Ga0501039_0001876 | 3300049575 | Bacteria | 15542 |
| 405 | Ga0501039_0016881 | 3300049575 | Bacteria | 5596 |
| 406 | Ga0501039_0152677 | 3300049575 | Bacteria | 1814 |
| 407 | Ga0501039_0240421 | 3300049575 | Bacteria | 1423 |
| 408 | Ga0501040_0000653 | 3300049576 | Bacteria | 21332 |
| 409 | Ga0501040_0018245 | 3300049576 | Bacteria | 4658 |
| 410 | Ga0501040_0039044 | 3300049576 | Bacteria | 3228 |
| 411 | Ga0501041_0029253 | 3300049577 | Bacteria | 3323 |
| 412 | Ga0501041_0029519 | 3300049577 | Bacteria | 3308 |
| 413 | Ga0501041_0040148 | 3300049577 | Bacteria | 2840 |
| 414 | Ga0501041_0058507 | 3300049577 | Bacteria | 2358 |
| 415 | Ga0501041_0166326 | 3300049577 | Bacteria | 1379 |
| 416 | Ga0501042_0000024 | 3300049578 | Bacteria | 49123 |
| 417 | Ga0501042_0008169 | 3300049578 | Bacteria | 6896 |
| 418 | Ga0501042_0008561 | 3300049578 | Bacteria | 6765 |
| 419 | Ga0501042_0022252 | 3300049578 | Bacteria | 4428 |
| 420 | Ga0501042_0038801 | 3300049578 | Bacteria | 3382 |
| 421 | Ga0501042_0100646 | 3300049578 | Bacteria | 2078 |
| 422 | Ga0501042_0127340 | 3300049578 | Bacteria | 1834 |
| 423 | Ga0501042_0157118 | 3300049578 | Bacteria | 1640 |
| 424 | Ga0501042_0315331 | 3300049578 | Bacteria | 1130 |
| 425 | Ga0501043_0180170 | 3300049579 | Bacteria | 1646 |
| 426 | Ga0501043_0218129 | 3300049579 | Bacteria | 1477 |
| 427 | Ga0501046_0019373 | 3300049580 | Bacteria | 5646 |
| 428 | Ga0501046_0026823 | 3300049580 | Bacteria | 4705 |
| 429 | Ga0501046_0079126 | 3300049580 | Bacteria | 2542 |
| 430 | Ga0501046_0092413 | 3300049580 | Bacteria | 2326 |
| 431 | Ga0501046_0102816 | 3300049580 | Bacteria | 2190 |
| 432 | Ga0501046_0112287 | 3300049580 | Bacteria | 2081 |
| 433 | Ga0501046_0181946 | 3300049580 | Unclassified | 1571 |
| 434 | Ga0501046_0281945 | 3300049580 | Bacteria | 1217 |
| 435 | Ga0501047_0065762 | 3300049581 | Bacteria | 3495 |
| 436 | Ga0501048_0074683 | 3300049582 | Bacteria | 2392 |
| 437 | Ga0501048_0083980 | 3300049582 | Bacteria | 2245 |
| 438 | Ga0501048_0199881 | 3300049582 | Bacteria | 1417 |
| 439 | Ga0501048_0235441 | 3300049582 | Bacteria | 1299 |
| 440 | Ga0501068_0004340 | 3300049584 | Bacteria | 7710 |
| 441 | Ga0501068_0008331 | 3300049584 | Bacteria | 5766 |
| 442 | Ga0501068_0062093 | 3300049584 | Bacteria | 2271 |
| 443 | Ga0501068_0154447 | 3300049584 | Bacteria | 1444 |
| 444 | Ga0501069_0046821 | 3300049585 | Bacteria | 2400 |
| 445 | Ga0501070_0018693 | 3300049586 | Bacteria | 5814 |
| 446 | Ga0501070_0250805 | 3300049586 | Bacteria | 1448 |
| 447 | Ga0501071_0000232 | 3300049587 | Bacteria | 25461 |
| 448 | Ga0501071_0024558 | 3300049587 | Bacteria | 4217 |
| 449 | Ga0501071_0028572 | 3300049587 | Bacteria | 3932 |
| 450 | Ga0501071_0071686 | 3300049587 | Bacteria | 2526 |
| 451 | Ga0501071_0086989 | 3300049587 | Bacteria | 2292 |
| 452 | Ga0501072_0000370 | 3300049588 | Bacteria | 32057 |
| 453 | Ga0501072_0004162 | 3300049588 | Bacteria | 10950 |
| 454 | Ga0501072_0015729 | 3300049588 | Bacteria | 5799 |
| 455 | Ga0501072_0030484 | 3300049588 | Bacteria | 4219 |
| 456 | Ga0501072_0031056 | 3300049588 | Bacteria | 4180 |
| 457 | Ga0501072_0053905 | 3300049588 | Bacteria | 3168 |
| 458 | Ga0501072_0053974 | 3300049588 | Bacteria | 3166 |
| 459 | Ga0501072_0065072 | 3300049588 | Bacteria | 2875 |
| 460 | Ga0501072_0099823 | 3300049588 | Bacteria | 2307 |
| 461 | Ga0501072_0405545 | 3300049588 | Bacteria | 1081 |
| 462 | Ga0501073_0258382 | 3300049589 | Unclassified | 1202 |
| 463 | Ga0501074_0000394 | 3300049590 | Bacteria | 25979 |
| 464 | Ga0501074_0032635 | 3300049590 | Bacteria | 3771 |
| 465 | Ga0501074_0066239 | 3300049590 | Bacteria | 2598 |
| 466 | Ga0501075_0000149 | 3300049591 | Bacteria | 34951 |
| 467 | Ga0501075_0004311 | 3300049591 | Bacteria | 9623 |
| 468 | Ga0501075_0007147 | 3300049591 | Bacteria | 7726 |
| 469 | Ga0501075_0028294 | 3300049591 | Bacteria | 4137 |
| 470 | Ga0501075_0202367 | 3300049591 | Bacteria | 1514 |
| 471 | Ga0501076_0000439 | 3300049592 | Bacteria | 26304 |
| 472 | Ga0501076_0011961 | 3300049592 | Bacteria | 6483 |
| 473 | Ga0501076_0041425 | 3300049592 | Bacteria | 3623 |
| 474 | Ga0501076_0049814 | 3300049592 | Bacteria | 3313 |
| 475 | Ga0501076_0076927 | 3300049592 | Bacteria | 2676 |
| 476 | Ga0501076_0094939 | 3300049592 | Bacteria | 2401 |
| 477 | Ga0501076_0104025 | 3300049592 | Bacteria | 2290 |
| 478 | Ga0501077_0000816 | 3300049593 | Bacteria | 18915 |
| 479 | Ga0501077_0002050 | 3300049593 | Bacteria | 12146 |
| 480 | Ga0501077_0007869 | 3300049593 | Bacteria | 6583 |
| 481 | Ga0501077_0036174 | 3300049593 | Bacteria | 3145 |
| 482 | Ga0501077_0057739 | 3300049593 | Bacteria | 2464 |
| 483 | Ga0501077_0117814 | 3300049593 | Bacteria | 1683 |
| 484 | Ga0501077_0155896 | 3300049593 | Bacteria | 1449 |
| 485 | Ga0501079_0000446 | 3300049741 | Bacteria | 26915 |
| 486 | Ga0501079_0001113 | 3300049741 | Bacteria | 18689 |
| 487 | Ga0501079_0012858 | 3300049741 | Bacteria | 6390 |
| 488 | Ga0501079_0022654 | 3300049741 | Bacteria | 4819 |
| 489 | Ga0501079_0028656 | 3300049741 | Bacteria | 4273 |
| 490 | Ga0501079_0046601 | 3300049741 | Bacteria | 3345 |
| 491 | Ga0501079_0046826 | 3300049741 | Bacteria | 3337 |
| 492 | Ga0501079_0132011 | 3300049741 | Bacteria | 1944 |
| 493 | Ga0501079_0169389 | 3300049741 | Bacteria | 1703 |
| 494 | Ga0501079_0180845 | 3300049741 | Bacteria | 1645 |
| 495 | Ga0501080_0001577 | 3300049742 | Bacteria | 19304 |
| 496 | Ga0501080_0075763 | 3300049742 | Bacteria | 3129 |
| 497 | Ga0501080_0087287 | 3300049742 | Bacteria | 2898 |
| 498 | Ga0501080_0088973 | 3300049742 | Bacteria | 2868 |
| 499 | Ga0501080_0242657 | 3300049742 | Bacteria | 1644 |
| 500 | Ga0501081_0000028 | 3300049743 | Bacteria | 52926 |
| 501 | Ga0501081_0000106 | 3300049743 | Bacteria | 35374 |
| 502 | Ga0501081_0005345 | 3300049743 | Bacteria | 8287 |
| 503 | Ga0501081_0007059 | 3300049743 | Bacteria | 7303 |
| 504 | Ga0501081_0013904 | 3300049743 | Bacteria | 5298 |
| 505 | Ga0501081_0031757 | 3300049743 | Bacteria | 3579 |
| 506 | Ga0501081_0034418 | 3300049743 | Bacteria | 3447 |
| 507 | Ga0501081_0038501 | 3300049743 | Bacteria | 3267 |
| 508 | Ga0501081_0084412 | 3300049743 | Bacteria | 2227 |
| 509 | Ga0501081_0145869 | 3300049743 | Bacteria | 1698 |
| 510 | Ga0501081_0164993 | 3300049743 | Bacteria | 1597 |
| 511 | Ga0501081_0268891 | 3300049743 | Bacteria | 1247 |
| 512 | Ga0501083_0181252 | 3300049744 | Bacteria | 1375 |
| 513 | Ga0501035_0027904 | 3300049822 | Bacteria | 5157 |
| 514 | Ga0501045_0000638 | 3300049824 | Bacteria | 22176 |
| 515 | Ga0501045_0005728 | 3300049824 | Bacteria | 8603 |
| 516 | Ga0501045_0019214 | 3300049824 | Bacteria | 4868 |
| 517 | Ga0501045_0019403 | 3300049824 | Bacteria | 4846 |
| 518 | Ga0501045_0070859 | 3300049824 | Bacteria | 2565 |
| 519 | Ga0501045_0087471 | 3300049824 | Unclassified | 2301 |
| 520 | nmdc:mga05p37_1829_c1 | 3300050507 | Bacteria | 24804 |
| 521 | nmdc:mga05p37_21830_c1 | 3300050507 | Bacteria | 7755 |
| 522 | nmdc:mga05p37_294_c1 | 3300050507 | Bacteria | 52291 |
| 523 | nmdc:mga05p37_3428_c1 | 3300050507 | Bacteria | 18492 |
| 524 | nmdc:mga05p37_473_c2 | 3300050507 | Bacteria | 29340 |
| 525 | nmdc:mga05p37_503_c1 | 3300050507 | Bacteria | 43030 |
| 526 | nmdc:mga05p37_53958_c1 | 3300050507 | Bacteria | 4945 |
| 527 | nmdc:mga05p37_585385_c1 | 3300050507 | Bacteria | 1263 |
| 528 | nmdc:mga05p37_76679_c1 | 3300050507 | Bacteria | 4115 |
| 529 | nmdc:mga09592_15367_c1 | 3300050508 | Bacteria | 6252 |
| 530 | nmdc:mga09592_169697_c1 | 3300050508 | Bacteria | 1886 |
| 531 | nmdc:mga09592_217838_c1 | 3300050508 | Bacteria | 1654 |
| 532 | nmdc:mga09592_241929_c1 | 3300050508 | Bacteria | 1564 |
| 533 | nmdc:mga09592_41545_c1 | 3300050508 | Bacteria | 3867 |
| 534 | nmdc:mga09592_5141_c1 | 3300050508 | Bacteria | 10626 |
| 535 | nmdc:mga09592_665_c1 | 3300050508 | Bacteria | 26260 |
| 536 | nmdc:mga09592_67117_c1 | 3300050508 | Bacteria | 3042 |
| 537 | nmdc:mga0qj67_11455_c1 | 3300050509 | Bacteria | 6645 |
| 538 | nmdc:mga0qj67_14675_c1 | 3300050509 | Bacteria | 5924 |
| 539 | nmdc:mga0qj67_341873_c1 | 3300050509 | Bacteria | 1210 |
| 540 | nmdc:mga06r32_11384_c1 | 3300050510 | Bacteria | 8012 |
| 541 | nmdc:mga06r32_22246_c1 | 3300050510 | Bacteria | 5859 |
| 542 | nmdc:mga06r32_280039_c1 | 3300050510 | Bacteria | 1655 |
| 543 | nmdc:mga06r32_35082_c1 | 3300050510 | Bacteria | 4732 |
| 544 | nmdc:mga06r32_73362_c1 | 3300050510 | Bacteria | 3315 |
| 545 | nmdc:mga06r32_89647_c1 | 3300050510 | Bacteria | 3003 |
| 546 | nmdc:mga08y16_14006_c1 | 3300050511 | Bacteria | 8441 |
| 547 | nmdc:mga08y16_185763_c1 | 3300050511 | Bacteria | 2157 |
| 548 | nmdc:mga08y16_19421_c1 | 3300050511 | Bacteria | 7165 |
| 549 | nmdc:mga08y16_21631_c1 | 3300050511 | Bacteria | 6791 |
| 550 | nmdc:mga08y16_217486_c1 | 3300050511 | Bacteria | 1978 |
| 551 | nmdc:mga08y16_3197_c1 | 3300050511 | Bacteria | 16953 |
| 552 | nmdc:mga08y16_8586_c1 | 3300050511 | Bacteria | 10705 |
| 553 | nmdc:mga0n895_14201_c1 | 3300050512 | Bacteria | 7223 |
| 554 | nmdc:mga0n895_1662_c1 | 3300050512 | Bacteria | 16791 |
| 555 | nmdc:mga0n895_197695_c1 | 3300050512 | Unclassified | 2042 |
| 556 | nmdc:mga0n895_212762_c1 | 3300050512 | Bacteria | 1963 |
| 557 | nmdc:mga0n895_216569_c1 | 3300050512 | Bacteria | 1944 |
| 558 | nmdc:mga0rr50_15230_c1 | 3300050513 | Bacteria | 5071 |
| 559 | nmdc:mga0rr50_359_c1 | 3300050513 | Bacteria | 24852 |
| 560 | nmdc:mga0rr50_38092_c1 | 3300050513 | Bacteria | 3476 |
| 561 | nmdc:mga0rr50_67721_c1 | 3300050513 | Bacteria | 2713 |
| 562 | nmdc:mga08x19_1000_c1 | 3300050514 | Bacteria | 17670 |
| 563 | nmdc:mga08x19_11181_c1 | 3300050514 | Bacteria | 5403 |
| 564 | nmdc:mga08x19_13829_c1 | 3300050514 | Bacteria | 4889 |
| 565 | nmdc:mga08x19_19389_c1 | 3300050514 | Bacteria | 4173 |
| 566 | nmdc:mga08x19_261_c1 | 3300050514 | Bacteria | 40081 |
| 567 | nmdc:mga08x19_9220_c1 | 3300050514 | Bacteria | 5895 |
| 568 | nmdc:mga0a205_16365_c1 | 3300050515 | Bacteria | 6948 |
| 569 | nmdc:mga0a205_26940_c1 | 3300050515 | Bacteria | 5487 |
| 570 | nmdc:mga0a205_337085_c1 | 3300050515 | Bacteria | 1377 |
| 571 | nmdc:mga0a205_5345_c1 | 3300050515 | Bacteria | 11575 |
| 572 | nmdc:mga0a205_75_c1 | 3300050515 | Bacteria | 54682 |
| 573 | Ga0501084_0000525 | 3300054114 | Bacteria | 29296 |
| 574 | Ga0501084_0008168 | 3300054114 | Bacteria | 8632 |
| 575 | Ga0501084_0067064 | 3300054114 | Bacteria | 3003 |
| 576 | Ga0501084_0107357 | 3300054114 | Bacteria | 2345 |
| 577 | Ga0501084_0208227 | 3300054114 | Bacteria | 1650 |
| 578 | Ga0590077_018466 | 3300059426 | Bacteria | 1472 |
| 579 | Ga0501082_0000626 | 3300060353 | Bacteria | 31129 |
| 580 | Ga0501082_0001643 | 3300060353 | Bacteria | 19706 |
| 581 | Ga0501082_0022459 | 3300060353 | Bacteria | 5434 |
| 582 | Ga0501082_0030033 | 3300060353 | Bacteria | 4683 |
| 583 | Ga0501082_0041252 | 3300060353 | Bacteria | 3979 |
| 584 | Ga0501082_0131080 | 3300060353 | Bacteria | 2175 |
| 585 | Ga0530510_0000071 | 3300061734 | Bacteria | 51658 |
| 586 | Ga0530510_0000932 | 3300061734 | Bacteria | 19326 |
| 587 | Ga0530510_0002497 | 3300061734 | Bacteria | 12634 |
| 588 | Ga0530510_0009032 | 3300061734 | Bacteria | 6985 |
| 589 | Ga0530510_0024049 | 3300061734 | Bacteria | 4345 |
| 590 | Ga0530510_0066451 | 3300061734 | Bacteria | 2614 |
| 591 | Ga0530510_0080163 | 3300061734 | Bacteria | 2375 |
| 592 | Ga0530510_0116679 | 3300061734 | Bacteria | 1957 |
| 593 | Ga0530510_0152760 | 3300061734 | Bacteria | 1705 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035241 | Ga0373961_0033438 | Ga0373961_0033438_435_1424 | 329 |
| 2 | 3300045051 | Ga0451576_0400865 | Ga0451576_0400865_50_1039 | 329 |
| 3 | 3300045051 | Ga0451576_0510050 | Ga0451576_0510050_11_1003 | 330 |
| 4 | 3300049578 | Ga0501042_0315331 | Ga0501042_0315331_21_1046 | 332 |
| 5 | 3300005330 | Ga0070690_100004007 | Ga0070690_1000040079 | 340 |
| 6 | 3300005334 | Ga0068869_100003313 | Ga0068869_1000033139 | 340 |
| 7 | 3300005335 | Ga0070666_10091539 | Ga0070666_100915392 | 340 |
| 8 | 3300005336 | Ga0070680_100000149 | Ga0070680_10000014928 | 340 |
| 9 | 3300005337 | Ga0070682_100004482 | Ga0070682_1000044824 | 340 |
| 10 | 3300005338 | Ga0068868_100000056 | Ga0068868_1000000569 | 340 |
| 11 | 3300005340 | Ga0070689_100000200 | Ga0070689_1000002004 | 340 |
| 12 | 3300005341 | Ga0070691_10002484 | Ga0070691_100024843 | 340 |
| 13 | 3300005343 | Ga0070687_100000052 | Ga0070687_10000005234 | 340 |
| 14 | 3300005365 | Ga0070688_100033852 | Ga0070688_1000338522 | 340 |
| 15 | 3300005438 | Ga0070701_10003888 | Ga0070701_100038884 | 340 |
| 16 | 3300005440 | Ga0070705_100000638 | Ga0070705_10000063821 | 340 |
| 17 | 3300005441 | Ga0070700_100000211 | Ga0070700_10000021121 | 340 |
| 18 | 3300005444 | Ga0070694_100012825 | Ga0070694_1000128256 | 340 |
| 19 | 3300005459 | Ga0068867_100006487 | Ga0068867_1000064879 | 340 |
| 20 | 3300005530 | Ga0070679_100027284 | Ga0070679_1000272845 | 340 |
| 21 | 3300005544 | Ga0070686_100000545 | Ga0070686_10000054515 | 340 |
| 22 | 3300005545 | Ga0070695_100037942 | Ga0070695_1000379421 | 340 |
| 23 | 3300005546 | Ga0070696_100000012 | Ga0070696_10000001264 | 340 |
| 24 | 3300005547 | Ga0070693_100000579 | Ga0070693_1000005793 | 340 |
| 25 | 3300005549 | Ga0070704_100001021 | Ga0070704_10000102117 | 340 |
| 26 | 3300005563 | Ga0068855_100045041 | Ga0068855_1000450413 | 340 |
| 27 | 3300005614 | Ga0068856_100046268 | Ga0068856_1000462684 | 340 |
| 28 | 3300005615 | Ga0070702_100000225 | Ga0070702_10000022519 | 340 |
| 29 | 3300005617 | Ga0068859_100074965 | Ga0068859_1000749654 | 340 |
| 30 | 3300005718 | Ga0068866_10000850 | Ga0068866_100008509 | 340 |
| 31 | 3300005719 | Ga0068861_100000033 | Ga0068861_10000003360 | 340 |
| 32 | 3300005841 | Ga0068863_100230438 | Ga0068863_1002304383 | 340 |
| 33 | 3300005842 | Ga0068858_100001425 | Ga0068858_10000142522 | 340 |
| 34 | 3300005843 | Ga0068860_100007436 | Ga0068860_1000074366 | 340 |
| 35 | 3300005844 | Ga0068862_100000735 | Ga0068862_10000073534 | 340 |
| 36 | 3300006237 | Ga0097621_100000939 | Ga0097621_10000093922 | 340 |
| 37 | 3300006358 | Ga0068871_100003056 | Ga0068871_1000030569 | 340 |
| 38 | 3300006881 | Ga0068865_100000844 | Ga0068865_1000008446 | 340 |
| 39 | 3300006931 | Ga0097620_100074965 | Ga0097620_1000749654 | 340 |
| 40 | 3300009174 | Ga0105241_10101271 | Ga0105241_101012712 | 340 |
| 41 | 3300009177 | Ga0105248_10238643 | Ga0105248_102386432 | 340 |
| 42 | 3300010375 | Ga0105239_10051262 | Ga0105239_100512623 | 340 |
| 43 | 3300013297 | Ga0157378_10004115 | Ga0157378_100041159 | 340 |
| 44 | 3300025899 | Ga0207642_10000362 | Ga0207642_100003629 | 340 |
| 45 | 3300025911 | Ga0207654_10089814 | Ga0207654_100898142 | 340 |
| 46 | 3300025918 | Ga0207662_10000126 | Ga0207662_1000012634 | 340 |
| 47 | 3300025921 | Ga0207652_10024890 | Ga0207652_100248903 | 340 |
| 48 | 3300025926 | Ga0207659_10146765 | Ga0207659_101467652 | 340 |
| 49 | 3300025927 | Ga0207687_10000739 | Ga0207687_1000073914 | 340 |
| 50 | 3300025934 | Ga0207686_10000564 | Ga0207686_1000056413 | 340 |
| 51 | 3300025935 | Ga0207709_10000444 | Ga0207709_1000044418 | 340 |
| 52 | 3300025936 | Ga0207670_10004733 | Ga0207670_100047333 | 340 |
| 53 | 3300025938 | Ga0207704_10018655 | Ga0207704_100186552 | 340 |
| 54 | 3300025941 | Ga0207711_10320237 | Ga0207711_103202371 | 340 |
| 55 | 3300025942 | Ga0207689_10000240 | Ga0207689_1000024019 | 340 |
| 56 | 3300025961 | Ga0207712_10023431 | Ga0207712_100234313 | 340 |
| 57 | 3300026023 | Ga0207677_10000680 | Ga0207677_1000068013 | 340 |
| 58 | 3300026035 | Ga0207703_10011438 | Ga0207703_100114385 | 340 |
| 59 | 3300026041 | Ga0207639_10042416 | Ga0207639_100424162 | 340 |
| 60 | 3300026075 | Ga0207708_10000153 | Ga0207708_1000015327 | 340 |
| 61 | 3300026078 | Ga0207702_10037222 | Ga0207702_100372223 | 340 |
| 62 | 3300026088 | Ga0207641_10204174 | Ga0207641_102041742 | 340 |
| 63 | 3300026089 | Ga0207648_10000130 | Ga0207648_1000013022 | 340 |
| 64 | 3300026118 | Ga0207675_100000253 | Ga0207675_10000025322 | 340 |
| 65 | 3300026121 | Ga0207683_10178537 | Ga0207683_101785373 | 340 |
| 66 | 3300026142 | Ga0207698_10236381 | Ga0207698_102363811 | 340 |
| 67 | 3300028380 | Ga0268265_10028859 | Ga0268265_100288592 | 340 |
| 68 | 3300028381 | Ga0268264_10037504 | Ga0268264_100375042 | 340 |
| 69 | 3300035115 | Ga0373941_0020213 | Ga0373941_0020213_288_1310 | 340 |
| 70 | 3300035116 | Ga0373945_0002992 | Ga0373945_0002992_4046_5068 | 340 |
| 71 | 3300046472 | Ga0495580_0000845 | Ga0495580_0000845_22775_23797 | 340 |
| 72 | 3300005440 | Ga0070705_100009236 | Ga0070705_1000092363 | 341 |
| 73 | 3300005546 | Ga0070696_100002298 | Ga0070696_10000229811 | 341 |
| 74 | 3300006846 | Ga0075430_100000086 | Ga0075430_10000008645 | 341 |
| 75 | 3300006847 | Ga0075431_100020018 | Ga0075431_1000200186 | 341 |
| 76 | 3300009094 | Ga0111539_10006843 | Ga0111539_1000684311 | 341 |
| 77 | 3300009147 | Ga0114129_10002283 | Ga0114129_100022833 | 341 |
| 78 | 3300009147 | Ga0114129_10003662 | Ga0114129_100036626 | 341 |
| 79 | 3300013297 | Ga0157378_10448598 | Ga0157378_104485981 | 341 |
| 80 | 3300035115 | Ga0373941_0073687 | Ga0373941_0073687_93_1124 | 341 |
| 81 | 3300035691 | Ga0373931_0004555 | Ga0373931_0004555_1370_2395 | 341 |
| 82 | 3300045051 | Ga0451576_0101156 | Ga0451576_0101156_1602_2627 | 341 |
| 83 | 3300049572 | Ga0501036_0000338 | Ga0501036_0000338_41_1072 | 341 |
| 84 | 3300049588 | Ga0501072_0405545 | Ga0501072_0405545_46_1071 | 341 |
| 85 | 3300049743 | Ga0501081_0268891 | Ga0501081_0268891_45_1070 | 341 |
| 86 | 3300050507 | nmdc:mga05p37_3428_c1 | nmdc:mga05p37_3428_c1_765_1790 | 341 |
| 87 | 3300050507 | nmdc:mga05p37_473_c2 | nmdc:mga05p37_473_c2_10160_11236 | 341 |
| 88 | 3300050508 | nmdc:mga09592_15367_c1 | nmdc:mga09592_15367_c1_4338_5363 | 341 |
| 89 | 3300050508 | nmdc:mga09592_241929_c1 | nmdc:mga09592_241929_c1_198_1223 | 341 |
| 90 | 3300050508 | nmdc:mga09592_67117_c1 | nmdc:mga09592_67117_c1_376_1401 | 341 |
| 91 | 3300050509 | nmdc:mga0qj67_11455_c1 | nmdc:mga0qj67_11455_c1_2160_3185 | 341 |
| 92 | 3300050509 | nmdc:mga0qj67_14675_c1 | nmdc:mga0qj67_14675_c1_536_1612 | 341 |
| 93 | 3300050509 | nmdc:mga0qj67_341873_c1 | nmdc:mga0qj67_341873_c1_30_1055 | 341 |
| 94 | 3300050510 | nmdc:mga06r32_11384_c1 | nmdc:mga06r32_11384_c1_222_1298 | 341 |
| 95 | 3300050510 | nmdc:mga06r32_22246_c1 | nmdc:mga06r32_22246_c1_3321_4346 | 341 |
| 96 | 3300050510 | nmdc:mga06r32_73362_c1 | nmdc:mga06r32_73362_c1_99_1124 | 341 |
| 97 | 3300050511 | nmdc:mga08y16_19421_c1 | nmdc:mga08y16_19421_c1_1940_2965 | 341 |
| 98 | 3300050512 | nmdc:mga0n895_14201_c1 | nmdc:mga0n895_14201_c1_3103_4128 | 341 |
| 99 | 3300050512 | nmdc:mga0n895_212762_c1 | nmdc:mga0n895_212762_c1_19_1044 | 341 |
| 100 | 3300050513 | nmdc:mga0rr50_15230_c1 | nmdc:mga0rr50_15230_c1_2827_3852 | 341 |
| 101 | 3300050515 | nmdc:mga0a205_5345_c1 | nmdc:mga0a205_5345_c1_7876_8901 | 341 |
| 102 | 3300009094 | Ga0111539_10001693 | Ga0111539_1000169328 | 342 |
| 103 | 3300044712 | Ga0453684_0377246 | Ga0453684_0377246_187_1266 | 342 |
| 104 | 3300050512 | nmdc:mga0n895_197695_c1 | nmdc:mga0n895_197695_c1_287_1366 | 342 |
| 105 | 3300050515 | nmdc:mga0a205_26940_c1 | nmdc:mga0a205_26940_c1_1446_2537 | 342 |
| 106 | 3300005618 | Ga0068864_100128262 | Ga0068864_1001282623 | 347 |
| 107 | 3300049575 | Ga0501039_0152677 | Ga0501039_0152677_643_1722 | 350 |
| 108 | 3300049577 | Ga0501041_0029519 | Ga0501041_0029519_2174_3253 | 350 |
| 109 | 3300049580 | Ga0501046_0112287 | Ga0501046_0112287_295_1374 | 350 |
| 110 | 3300049587 | Ga0501071_0086989 | Ga0501071_0086989_1155_2234 | 350 |
| 111 | 3300049592 | Ga0501076_0041425 | Ga0501076_0041425_727_1806 | 350 |
| 112 | 3300049742 | Ga0501080_0087287 | Ga0501080_0087287_1713_2792 | 350 |
| 113 | 3300049743 | Ga0501081_0164993 | Ga0501081_0164993_475_1554 | 350 |
| 114 | 3300061734 | Ga0530510_0116679 | Ga0530510_0116679_709_1788 | 350 |
| 115 | 3300005549 | Ga0070704_100090289 | Ga0070704_1000902893 | 351 |
| 116 | 3300005617 | Ga0068859_100547624 | Ga0068859_1005476241 | 351 |
| 117 | 3300006844 | Ga0075428_100009686 | Ga0075428_10000968612 | 351 |
| 118 | 3300006847 | Ga0075431_100016749 | Ga0075431_10001674910 | 351 |
| 119 | 3300006880 | Ga0075429_100003089 | Ga0075429_1000030893 | 351 |
| 120 | 3300006931 | Ga0097620_100547630 | Ga0097620_1005476301 | 351 |
| 121 | 3300009094 | Ga0111539_10030292 | Ga0111539_100302923 | 351 |
| 122 | 3300009147 | Ga0114129_10039602 | Ga0114129_100396023 | 351 |
| 123 | 3300026116 | Ga0207674_10239562 | Ga0207674_102395622 | 351 |
| 124 | 3300050507 | nmdc:mga05p37_503_c1 | nmdc:mga05p37_503_c1_30745_31827 | 351 |
| 125 | 3300050508 | nmdc:mga09592_5141_c1 | nmdc:mga09592_5141_c1_7150_8232 | 351 |
| 126 | 3300050510 | nmdc:mga06r32_35082_c1 | nmdc:mga06r32_35082_c1_1310_2392 | 351 |
| 127 | 3300050510 | nmdc:mga06r32_89647_c1 | nmdc:mga06r32_89647_c1_992_2074 | 351 |
| 128 | 3300050511 | nmdc:mga08y16_185763_c1 | nmdc:mga08y16_185763_c1_193_1275 | 351 |
| 129 | 3300005471 | Ga0070698_100042807 | Ga0070698_1000428071 | 352 |
| 130 | 3300009147 | Ga0114129_10292403 | Ga0114129_102924032 | 353 |
| 131 | 3300005545 | Ga0070695_100012905 | Ga0070695_1000129054 | 357 |
| 132 | 3300005547 | Ga0070693_100146810 | Ga0070693_1001468102 | 357 |
| 133 | 3300005614 | Ga0068856_100106739 | Ga0068856_1001067393 | 357 |
| 134 | 3300006852 | Ga0075433_10000500 | Ga0075433_1000050014 | 357 |
| 135 | 3300006871 | Ga0075434_100003449 | Ga0075434_10000344913 | 357 |
| 136 | 3300006914 | Ga0075436_100002996 | Ga0075436_1000029966 | 357 |
| 137 | 3300007076 | Ga0075435_100000047 | Ga0075435_10000004734 | 357 |
| 138 | 3300009094 | Ga0111539_10017117 | Ga0111539_100171179 | 357 |
| 139 | 3300025942 | Ga0207689_10377772 | Ga0207689_103777721 | 357 |
| 140 | 3300025949 | Ga0207667_10289484 | Ga0207667_102894841 | 357 |
| 141 | 3300046539 | Ga0495621_0060717 | Ga0495621_0060717_44_1117 | 357 |
| 142 | 3300050511 | nmdc:mga08y16_8586_c1 | nmdc:mga08y16_8586_c1_7748_8821 | 357 |
| 143 | 3300050512 | nmdc:mga0n895_1662_c1 | nmdc:mga0n895_1662_c1_11800_12873 | 357 |
| 144 | 3300050513 | nmdc:mga0rr50_359_c1 | nmdc:mga0rr50_359_c1_2291_3364 | 357 |
| 145 | 3300050514 | nmdc:mga08x19_1000_c1 | nmdc:mga08x19_1000_c1_4001_5074 | 357 |
| 146 | 3300050515 | nmdc:mga0a205_75_c1 | nmdc:mga0a205_75_c1_395_1468 | 357 |
| 147 | 3300005444 | Ga0070694_100019179 | Ga0070694_1000191794 | 358 |
| 148 | 3300005444 | Ga0070694_100202874 | Ga0070694_1002028741 | 358 |
| 149 | 3300005467 | Ga0070706_100364510 | Ga0070706_1003645101 | 358 |
| 150 | 3300005471 | Ga0070698_100165087 | Ga0070698_1001650872 | 358 |
| 151 | 3300005518 | Ga0070699_100008860 | Ga0070699_1000088609 | 358 |
| 152 | 3300005518 | Ga0070699_100013971 | Ga0070699_1000139715 | 358 |
| 153 | 3300005536 | Ga0070697_100215992 | Ga0070697_1002159921 | 358 |
| 154 | 3300006852 | Ga0075433_10004787 | Ga0075433_100047873 | 358 |
| 155 | 3300006871 | Ga0075434_100022012 | Ga0075434_1000220122 | 358 |
| 156 | 3300006880 | Ga0075429_100000259 | Ga0075429_10000025920 | 358 |
| 157 | 3300006914 | Ga0075436_100000428 | Ga0075436_1000004285 | 358 |
| 158 | 3300006914 | Ga0075436_100000874 | Ga0075436_1000008743 | 358 |
| 159 | 3300007076 | Ga0075435_100005084 | Ga0075435_10000508411 | 358 |
| 160 | 3300007076 | Ga0075435_100071354 | Ga0075435_1000713542 | 358 |
| 161 | 3300009094 | Ga0111539_10117642 | Ga0111539_101176423 | 358 |
| 162 | 3300009098 | Ga0105245_10050484 | Ga0105245_100504845 | 358 |
| 163 | 3300009147 | Ga0114129_10000430 | Ga0114129_1000043029 | 358 |
| 164 | 3300009147 | Ga0114129_10055532 | Ga0114129_100555322 | 358 |
| 165 | 3300009148 | Ga0105243_10000374 | Ga0105243_1000037434 | 358 |
| 166 | 3300009176 | Ga0105242_10000192 | Ga0105242_1000019234 | 358 |
| 167 | 3300009553 | Ga0105249_10122917 | Ga0105249_101229172 | 358 |
| 168 | 3300014968 | Ga0157379_10470163 | Ga0157379_104701631 | 358 |
| 169 | 3300025912 | Ga0207707_10263395 | Ga0207707_102633952 | 358 |
| 170 | 3300026075 | Ga0207708_10235093 | Ga0207708_102350931 | 358 |
| 171 | 3300027907 | Ga0207428_10000721 | Ga0207428_1000072125 | 358 |
| 172 | 3300031731 | Ga0307405_10242940 | Ga0307405_102429401 | 358 |
| 173 | 3300035089 | Ga0373944_0010354 | Ga0373944_0010354_1286_2362 | 358 |
| 174 | 3300035113 | Ga0373936_0000959 | Ga0373936_0000959_5040_6116 | 358 |
| 175 | 3300035114 | Ga0373939_0001857 | Ga0373939_0001857_615_1691 | 358 |
| 176 | 3300035171 | Ga0373946_0006410 | Ga0373946_0006410_458_1534 | 358 |
| 177 | 3300035207 | Ga0373942_0006378 | Ga0373942_0006378_1268_2344 | 358 |
| 178 | 3300035242 | Ga0373962_0021994 | Ga0373962_0021994_187_1263 | 358 |
| 179 | 3300035410 | Ga0373924_0008820 | Ga0373924_0008820_2134_3210 | 358 |
| 180 | 3300035692 | Ga0373935_0011964 | Ga0373935_0011964_123_1199 | 358 |
| 181 | 3300035695 | Ga0373927_0082726 | Ga0373927_0082726_834_1910 | 358 |
| 182 | 3300035725 | Ga0373947_0067326 | Ga0373947_0067326_202_1278 | 358 |
| 183 | 3300041496 | Ga0451839_0456736 | Ga0451839_0456736_149_1225 | 358 |
| 184 | 3300042156 | Ga0439446_0005070 | Ga0439446_0005070_1174_2250 | 358 |
| 185 | 3300042876 | Ga0451577_0139457 | Ga0451577_0139457_966_2156 | 358 |
| 186 | 3300045051 | Ga0451576_0003101 | Ga0451576_0003101_10068_11195 | 358 |
| 187 | 3300045051 | Ga0451576_0024911 | Ga0451576_0024911_2562_3638 | 358 |
| 188 | 3300045051 | Ga0451576_0252735 | Ga0451576_0252735_34_1110 | 358 |
| 189 | 3300045976 | Ga0466967_0010071 | Ga0466967_0010071_5298_6374 | 358 |
| 190 | 3300046455 | Ga0495603_0044154 | Ga0495603_0044154_385_1461 | 358 |
| 191 | 3300046472 | Ga0495580_0004779 | Ga0495580_0004779_7110_8186 | 358 |
| 192 | 3300046473 | Ga0495582_0046060 | Ga0495582_0046060_509_1585 | 358 |
| 193 | 3300046476 | Ga0495662_0016646 | Ga0495662_0016646_1156_2232 | 358 |
| 194 | 3300046517 | Ga0495630_0046766 | Ga0495630_0046766_962_2038 | 358 |
| 195 | 3300046517 | Ga0495630_0130107 | Ga0495630_0130107_787_1863 | 358 |
| 196 | 3300046526 | Ga0495666_0008044 | Ga0495666_0008044_3240_4316 | 358 |
| 197 | 3300046528 | Ga0495642_0015060 | Ga0495642_0015060_433_1509 | 358 |
| 198 | 3300046535 | Ga0495586_0007966 | Ga0495586_0007966_452_1528 | 358 |
| 199 | 3300046535 | Ga0495586_0077795 | Ga0495586_0077795_82_1158 | 358 |
| 200 | 3300046537 | Ga0495598_0004441 | Ga0495598_0004441_513_1589 | 358 |
| 201 | 3300046615 | Ga0495656_0016044 | Ga0495656_0016044_625_1701 | 358 |
| 202 | 3300046664 | Ga0495659_0006510 | Ga0495659_0006510_1274_2350 | 358 |
| 203 | 3300046674 | Ga0495588_0046765 | Ga0495588_0046765_184_1260 | 358 |
| 204 | 3300046681 | Ga0495647_0001586 | Ga0495647_0001586_5514_6590 | 358 |
| 205 | 3300046684 | Ga0495669_0045474 | Ga0495669_0045474_304_1380 | 358 |
| 206 | 3300047321 | Ga0495676_0060585 | Ga0495676_0060585_1483_2559 | 358 |
| 207 | 3300049582 | Ga0501048_0199881 | Ga0501048_0199881_79_1155 | 358 |
| 208 | 3300049588 | Ga0501072_0053974 | Ga0501072_0053974_1557_2633 | 358 |
| 209 | 3300049591 | Ga0501075_0028294 | Ga0501075_0028294_191_1267 | 358 |
| 210 | 3300049741 | Ga0501079_0046826 | Ga0501079_0046826_21_1097 | 358 |
| 211 | 3300049743 | Ga0501081_0034418 | Ga0501081_0034418_163_1239 | 358 |
| 212 | 3300049743 | Ga0501081_0084412 | Ga0501081_0084412_89_1165 | 358 |
| 213 | 3300050507 | nmdc:mga05p37_1829_c1 | nmdc:mga05p37_1829_c1_6916_7992 | 358 |
| 214 | 3300050508 | nmdc:mga09592_665_c1 | nmdc:mga09592_665_c1_7420_8496 | 358 |
| 215 | 3300050511 | nmdc:mga08y16_14006_c1 | nmdc:mga08y16_14006_c1_1933_3009 | 358 |
| 216 | 3300050511 | nmdc:mga08y16_21631_c1 | nmdc:mga08y16_21631_c1_1652_2728 | 358 |
| 217 | 3300050512 | nmdc:mga0n895_216569_c1 | nmdc:mga0n895_216569_c1_835_1911 | 358 |
| 218 | 3300050513 | nmdc:mga0rr50_38092_c1 | nmdc:mga0rr50_38092_c1_1390_2466 | 358 |
| 219 | 3300050513 | nmdc:mga0rr50_67721_c1 | nmdc:mga0rr50_67721_c1_612_1688 | 358 |
| 220 | 3300050514 | nmdc:mga08x19_13829_c1 | nmdc:mga08x19_13829_c1_688_1764 | 358 |
| 221 | 3300050514 | nmdc:mga08x19_261_c1 | nmdc:mga08x19_261_c1_5898_6974 | 358 |
| 222 | 3300050515 | nmdc:mga0a205_16365_c1 | nmdc:mga0a205_16365_c1_3488_4564 | 358 |
| 223 | 3300050515 | nmdc:mga0a205_337085_c1 | nmdc:mga0a205_337085_c1_20_1096 | 358 |
| 224 | 3300054114 | Ga0501084_0208227 | Ga0501084_0208227_219_1295 | 358 |
| 225 | 3300059426 | Ga0590077_018466 | Ga0590077_018466_307_1383 | 358 |
| 226 | 3300003347 | JGI26128J50194_1000894 | JGI26128J50194_10008941 | 359 |
| 227 | 3300003503 | JGI26141J51220_1000826 | JGI26141J51220_10008262 | 359 |
| 228 | 3300005293 | Ga0065715_10114096 | Ga0065715_101140962 | 359 |
| 229 | 3300005328 | Ga0070676_10001199 | Ga0070676_1000119914 | 359 |
| 230 | 3300005329 | Ga0070683_100063983 | Ga0070683_1000639833 | 359 |
| 231 | 3300005330 | Ga0070690_100015226 | Ga0070690_1000152262 | 359 |
| 232 | 3300005334 | Ga0068869_100003166 | Ga0068869_1000031663 | 359 |
| 233 | 3300005336 | Ga0070680_100010180 | Ga0070680_1000101802 | 359 |
| 234 | 3300005336 | Ga0070680_100065485 | Ga0070680_1000654852 | 359 |
| 235 | 3300005337 | Ga0070682_100003456 | Ga0070682_1000034567 | 359 |
| 236 | 3300005339 | Ga0070660_100001484 | Ga0070660_1000014843 | 359 |
| 237 | 3300005340 | Ga0070689_100054730 | Ga0070689_1000547302 | 359 |
| 238 | 3300005340 | Ga0070689_100295474 | Ga0070689_1002954742 | 359 |
| 239 | 3300005341 | Ga0070691_10003669 | Ga0070691_100036698 | 359 |
| 240 | 3300005341 | Ga0070691_10008969 | Ga0070691_100089693 | 359 |
| 241 | 3300005343 | Ga0070687_100040762 | Ga0070687_1000407622 | 359 |
| 242 | 3300005344 | Ga0070661_100001482 | Ga0070661_1000014823 | 359 |
| 243 | 3300005345 | Ga0070692_10000237 | Ga0070692_100002373 | 359 |
| 244 | 3300005353 | Ga0070669_100157823 | Ga0070669_1001578232 | 359 |
| 245 | 3300005366 | Ga0070659_100001725 | Ga0070659_1000017253 | 359 |
| 246 | 3300005367 | Ga0070667_100054095 | Ga0070667_1000540951 | 359 |
| 247 | 3300005438 | Ga0070701_10098173 | Ga0070701_100981731 | 359 |
| 248 | 3300005440 | Ga0070705_100008127 | Ga0070705_1000081273 | 359 |
| 249 | 3300005440 | Ga0070705_100093941 | Ga0070705_1000939412 | 359 |
| 250 | 3300005444 | Ga0070694_100014905 | Ga0070694_1000149054 | 359 |
| 251 | 3300005445 | Ga0070708_100197938 | Ga0070708_1001979381 | 359 |
| 252 | 3300005455 | Ga0070663_100067992 | Ga0070663_1000679921 | 359 |
| 253 | 3300005457 | Ga0070662_100001423 | Ga0070662_10000142310 | 359 |
| 254 | 3300005458 | Ga0070681_10000525 | Ga0070681_100005251 | 359 |
| 255 | 3300005458 | Ga0070681_10040330 | Ga0070681_100403303 | 359 |
| 256 | 3300005459 | Ga0068867_100012689 | Ga0068867_1000126893 | 359 |
| 257 | 3300005459 | Ga0068867_100014336 | Ga0068867_1000143363 | 359 |
| 258 | 3300005459 | Ga0068867_100236697 | Ga0068867_1002366972 | 359 |
| 259 | 3300005467 | Ga0070706_100149877 | Ga0070706_1001498772 | 359 |
| 260 | 3300005467 | Ga0070706_100166342 | Ga0070706_1001663422 | 359 |
| 261 | 3300005467 | Ga0070706_100246353 | Ga0070706_1002463531 | 359 |
| 262 | 3300005468 | Ga0070707_100027164 | Ga0070707_1000271644 | 359 |
| 263 | 3300005468 | Ga0070707_100034501 | Ga0070707_1000345012 | 359 |
| 264 | 3300005468 | Ga0070707_100182361 | Ga0070707_1001823612 | 359 |
| 265 | 3300005471 | Ga0070698_100002031 | Ga0070698_10000203127 | 359 |
| 266 | 3300005471 | Ga0070698_100018091 | Ga0070698_1000180915 | 359 |
| 267 | 3300005518 | Ga0070699_100005247 | Ga0070699_1000052472 | 359 |
| 268 | 3300005518 | Ga0070699_100031566 | Ga0070699_1000315663 | 359 |
| 269 | 3300005518 | Ga0070699_100063401 | Ga0070699_1000634011 | 359 |
| 270 | 3300005518 | Ga0070699_100070352 | Ga0070699_1000703523 | 359 |
| 271 | 3300005518 | Ga0070699_100196508 | Ga0070699_1001965082 | 359 |
| 272 | 3300005530 | Ga0070679_100022523 | Ga0070679_1000225235 | 359 |
| 273 | 3300005530 | Ga0070679_100095686 | Ga0070679_1000956863 | 359 |
| 274 | 3300005535 | Ga0070684_100008881 | Ga0070684_1000088816 | 359 |
| 275 | 3300005535 | Ga0070684_100070340 | Ga0070684_1000703402 | 359 |
| 276 | 3300005536 | Ga0070697_100029077 | Ga0070697_1000290775 | 359 |
| 277 | 3300005539 | Ga0068853_100001823 | Ga0068853_10000182316 | 359 |
| 278 | 3300005543 | Ga0070672_100246796 | Ga0070672_1002467962 | 359 |
| 279 | 3300005544 | Ga0070686_100010212 | Ga0070686_1000102122 | 359 |
| 280 | 3300005545 | Ga0070695_100001651 | Ga0070695_10000165113 | 359 |
| 281 | 3300005545 | Ga0070695_100004303 | Ga0070695_1000043037 | 359 |
| 282 | 3300005545 | Ga0070695_100049167 | Ga0070695_1000491672 | 359 |
| 283 | 3300005546 | Ga0070696_100033450 | Ga0070696_1000334503 | 359 |
| 284 | 3300005546 | Ga0070696_100046429 | Ga0070696_1000464294 | 359 |
| 285 | 3300005546 | Ga0070696_100096985 | Ga0070696_1000969852 | 359 |
| 286 | 3300005547 | Ga0070693_100003873 | Ga0070693_1000038733 | 359 |
| 287 | 3300005549 | Ga0070704_100003341 | Ga0070704_1000033418 | 359 |
| 288 | 3300005563 | Ga0068855_100005123 | Ga0068855_10000512318 | 359 |
| 289 | 3300005564 | Ga0070664_100019414 | Ga0070664_1000194143 | 359 |
| 290 | 3300005578 | Ga0068854_100075964 | Ga0068854_1000759643 | 359 |
| 291 | 3300005615 | Ga0070702_100013212 | Ga0070702_1000132121 | 359 |
| 292 | 3300005615 | Ga0070702_100110666 | Ga0070702_1001106662 | 359 |
| 293 | 3300005616 | Ga0068852_100038813 | Ga0068852_1000388134 | 359 |
| 294 | 3300005617 | Ga0068859_100015807 | Ga0068859_1000158076 | 359 |
| 295 | 3300005617 | Ga0068859_100059404 | Ga0068859_1000594043 | 359 |
| 296 | 3300005618 | Ga0068864_100048082 | Ga0068864_1000480822 | 359 |
| 297 | 3300005719 | Ga0068861_100131639 | Ga0068861_1001316392 | 359 |
| 298 | 3300005840 | Ga0068870_10000437 | Ga0068870_1000043714 | 359 |
| 299 | 3300005840 | Ga0068870_10047180 | Ga0068870_100471801 | 359 |
| 300 | 3300005842 | Ga0068858_100012686 | Ga0068858_1000126866 | 359 |
| 301 | 3300005843 | Ga0068860_100057420 | Ga0068860_1000574202 | 359 |
| 302 | 3300005843 | Ga0068860_100139938 | Ga0068860_1001399382 | 359 |
| 303 | 3300005843 | Ga0068860_100370308 | Ga0068860_1003703082 | 359 |
| 304 | 3300005844 | Ga0068862_100002850 | Ga0068862_10000285016 | 359 |
| 305 | 3300005844 | Ga0068862_100015430 | Ga0068862_1000154303 | 359 |
| 306 | 3300005844 | Ga0068862_100481446 | Ga0068862_1004814461 | 359 |
| 307 | 3300005983 | Ga0081540_1061624 | Ga0081540_10616242 | 359 |
| 308 | 3300005985 | Ga0081539_10000462 | Ga0081539_1000046223 | 359 |
| 309 | 3300006173 | Ga0070716_100021860 | Ga0070716_1000218603 | 359 |
| 310 | 3300006358 | Ga0068871_100001863 | Ga0068871_1000018637 | 359 |
| 311 | 3300006844 | Ga0075428_100010456 | Ga0075428_1000104567 | 359 |
| 312 | 3300006844 | Ga0075428_100024711 | Ga0075428_1000247118 | 359 |
| 313 | 3300006847 | Ga0075431_100191257 | Ga0075431_1001912571 | 359 |
| 314 | 3300006852 | Ga0075433_10001084 | Ga0075433_1000108421 | 359 |
| 315 | 3300006852 | Ga0075433_10051178 | Ga0075433_100511783 | 359 |
| 316 | 3300006871 | Ga0075434_100068637 | Ga0075434_1000686373 | 359 |
| 317 | 3300006880 | Ga0075429_100077207 | Ga0075429_1000772074 | 359 |
| 318 | 3300006880 | Ga0075429_100164001 | Ga0075429_1001640012 | 359 |
| 319 | 3300006880 | Ga0075429_100273463 | Ga0075429_1002734631 | 359 |
| 320 | 3300006881 | Ga0068865_100142418 | Ga0068865_1001424182 | 359 |
| 321 | 3300006914 | Ga0075436_100007399 | Ga0075436_1000073993 | 359 |
| 322 | 3300006914 | Ga0075436_100038875 | Ga0075436_1000388753 | 359 |
| 323 | 3300006931 | Ga0097620_100015807 | Ga0097620_1000158077 | 359 |
| 324 | 3300006931 | Ga0097620_100059402 | Ga0097620_1000594023 | 359 |
| 325 | 3300007076 | Ga0075435_100016888 | Ga0075435_1000168883 | 359 |
| 326 | 3300007076 | Ga0075435_100019309 | Ga0075435_1000193095 | 359 |
| 327 | 3300007076 | Ga0075435_100032594 | Ga0075435_1000325942 | 359 |
| 328 | 3300007265 | Ga0099794_10002556 | Ga0099794_100025566 | 359 |
| 329 | 3300007265 | Ga0099794_10089567 | Ga0099794_100895672 | 359 |
| 330 | 3300009094 | Ga0111539_10009904 | Ga0111539_1000990415 | 359 |
| 331 | 3300009098 | Ga0105245_10027918 | Ga0105245_100279181 | 359 |
| 332 | 3300009147 | Ga0114129_10004826 | Ga0114129_100048268 | 359 |
| 333 | 3300009147 | Ga0114129_10088122 | Ga0114129_100881223 | 359 |
| 334 | 3300009174 | Ga0105241_10000133 | Ga0105241_1000013342 | 359 |
| 335 | 3300009176 | Ga0105242_10067713 | Ga0105242_100677134 | 359 |
| 336 | 3300009176 | Ga0105242_10388307 | Ga0105242_103883071 | 359 |
| 337 | 3300009177 | Ga0105248_10356588 | Ga0105248_103565882 | 359 |
| 338 | 3300009545 | Ga0105237_10207698 | Ga0105237_102076982 | 359 |
| 339 | 3300009553 | Ga0105249_10242318 | Ga0105249_102423182 | 359 |
| 340 | 3300011119 | Ga0105246_10297936 | Ga0105246_102979361 | 359 |
| 341 | 3300013100 | Ga0157373_10013951 | Ga0157373_100139515 | 359 |
| 342 | 3300013102 | Ga0157371_10085185 | Ga0157371_100851852 | 359 |
| 343 | 3300013105 | Ga0157369_10062664 | Ga0157369_100626643 | 359 |
| 344 | 3300013307 | Ga0157372_10006881 | Ga0157372_1000688113 | 359 |
| 345 | 3300013307 | Ga0157372_10037276 | Ga0157372_100372762 | 359 |
| 346 | 3300013308 | Ga0157375_10139004 | Ga0157375_101390042 | 359 |
| 347 | 3300014969 | Ga0157376_10033953 | Ga0157376_100339532 | 359 |
| 348 | 3300025885 | Ga0207653_10007379 | Ga0207653_100073792 | 359 |
| 349 | 3300025901 | Ga0207688_10008520 | Ga0207688_100085206 | 359 |
| 350 | 3300025904 | Ga0207647_10146962 | Ga0207647_101469621 | 359 |
| 351 | 3300025906 | Ga0207699_10127321 | Ga0207699_101273211 | 359 |
| 352 | 3300025907 | Ga0207645_10002226 | Ga0207645_100022263 | 359 |
| 353 | 3300025908 | Ga0207643_10001163 | Ga0207643_1000116315 | 359 |
| 354 | 3300025910 | Ga0207684_10001116 | Ga0207684_1000111635 | 359 |
| 355 | 3300025910 | Ga0207684_10040381 | Ga0207684_100403813 | 359 |
| 356 | 3300025910 | Ga0207684_10044522 | Ga0207684_100445223 | 359 |
| 357 | 3300025910 | Ga0207684_10069708 | Ga0207684_100697083 | 359 |
| 358 | 3300025912 | Ga0207707_10000556 | Ga0207707_1000055616 | 359 |
| 359 | 3300025912 | Ga0207707_10161410 | Ga0207707_101614103 | 359 |
| 360 | 3300025914 | Ga0207671_10115518 | Ga0207671_101155182 | 359 |
| 361 | 3300025917 | Ga0207660_10002844 | Ga0207660_1000284413 | 359 |
| 362 | 3300025917 | Ga0207660_10231122 | Ga0207660_102311222 | 359 |
| 363 | 3300025918 | Ga0207662_10060764 | Ga0207662_100607642 | 359 |
| 364 | 3300025919 | Ga0207657_10003869 | Ga0207657_100038693 | 359 |
| 365 | 3300025920 | Ga0207649_10005083 | Ga0207649_100050836 | 359 |
| 366 | 3300025921 | Ga0207652_10016524 | Ga0207652_100165246 | 359 |
| 367 | 3300025921 | Ga0207652_10110452 | Ga0207652_101104522 | 359 |
| 368 | 3300025922 | Ga0207646_10015141 | Ga0207646_100151417 | 359 |
| 369 | 3300025922 | Ga0207646_10075464 | Ga0207646_100754644 | 359 |
| 370 | 3300025922 | Ga0207646_10089324 | Ga0207646_100893242 | 359 |
| 371 | 3300025922 | Ga0207646_10113168 | Ga0207646_101131682 | 359 |
| 372 | 3300025932 | Ga0207690_10025096 | Ga0207690_100250963 | 359 |
| 373 | 3300025933 | Ga0207706_10045328 | Ga0207706_100453283 | 359 |
| 374 | 3300025933 | Ga0207706_10120940 | Ga0207706_101209402 | 359 |
| 375 | 3300025935 | Ga0207709_10032445 | Ga0207709_100324453 | 359 |
| 376 | 3300025936 | Ga0207670_10050653 | Ga0207670_100506533 | 359 |
| 377 | 3300025942 | Ga0207689_10001708 | Ga0207689_100017083 | 359 |
| 378 | 3300025942 | Ga0207689_10067886 | Ga0207689_100678862 | 359 |
| 379 | 3300025944 | Ga0207661_10083813 | Ga0207661_100838133 | 359 |
| 380 | 3300025945 | Ga0207679_10050632 | Ga0207679_100506323 | 359 |
| 381 | 3300025949 | Ga0207667_10005121 | Ga0207667_1000512116 | 359 |
| 382 | 3300025960 | Ga0207651_10103011 | Ga0207651_101030111 | 359 |
| 383 | 3300025961 | Ga0207712_10289797 | Ga0207712_102897971 | 359 |
| 384 | 3300025981 | Ga0207640_10284003 | Ga0207640_102840032 | 359 |
| 385 | 3300025986 | Ga0207658_10179278 | Ga0207658_101792782 | 359 |
| 386 | 3300026035 | Ga0207703_10012196 | Ga0207703_100121966 | 359 |
| 387 | 3300026041 | Ga0207639_10006287 | Ga0207639_100062877 | 359 |
| 388 | 3300026067 | Ga0207678_10021293 | Ga0207678_100212936 | 359 |
| 389 | 3300026078 | Ga0207702_10173553 | Ga0207702_101735531 | 359 |
| 390 | 3300026089 | Ga0207648_10064265 | Ga0207648_100642654 | 359 |
| 391 | 3300026089 | Ga0207648_10064672 | Ga0207648_100646723 | 359 |
| 392 | 3300026089 | Ga0207648_10066485 | Ga0207648_100664853 | 359 |
| 393 | 3300026095 | Ga0207676_10156850 | Ga0207676_101568502 | 359 |
| 394 | 3300026116 | Ga0207674_10005434 | Ga0207674_1000543416 | 359 |
| 395 | 3300026116 | Ga0207674_10008790 | Ga0207674_1000879011 | 359 |
| 396 | 3300026118 | Ga0207675_100018522 | Ga0207675_1000185223 | 359 |
| 397 | 3300026142 | Ga0207698_10264687 | Ga0207698_102646872 | 359 |
| 398 | 3300027364 | Ga0209967_1000731 | Ga0209967_10007314 | 359 |
| 399 | 3300027378 | Ga0209981_1001009 | Ga0209981_10010094 | 359 |
| 400 | 3300027424 | Ga0209984_1000948 | Ga0209984_10009483 | 359 |
| 401 | 3300027471 | Ga0209995_1002532 | Ga0209995_10025322 | 359 |
| 402 | 3300027526 | Ga0209968_1001882 | Ga0209968_10018823 | 359 |
| 403 | 3300027543 | Ga0209999_1000956 | Ga0209999_10009563 | 359 |
| 404 | 3300027665 | Ga0209983_1000928 | Ga0209983_10009283 | 359 |
| 405 | 3300027671 | Ga0209588_1044431 | Ga0209588_10444312 | 359 |
| 406 | 3300027682 | Ga0209971_1004436 | Ga0209971_10044362 | 359 |
| 407 | 3300027695 | Ga0209966_1000256 | Ga0209966_100025617 | 359 |
| 408 | 3300027717 | Ga0209998_10000070 | Ga0209998_1000007039 | 359 |
| 409 | 3300027876 | Ga0209974_10000099 | Ga0209974_100000994 | 359 |
| 410 | 3300027907 | Ga0207428_10000794 | Ga0207428_100007948 | 359 |
| 411 | 3300027907 | Ga0207428_10006425 | Ga0207428_1000642511 | 359 |
| 412 | 3300028380 | Ga0268265_10038678 | Ga0268265_100386783 | 359 |
| 413 | 3300028381 | Ga0268264_10042535 | Ga0268264_100425353 | 359 |
| 414 | 3300028381 | Ga0268264_10143371 | Ga0268264_101433712 | 359 |
| 415 | 3300028381 | Ga0268264_10149836 | Ga0268264_101498362 | 359 |
| 416 | 3300031548 | Ga0307408_100004301 | Ga0307408_1000043013 | 359 |
| 417 | 3300031548 | Ga0307408_100160785 | Ga0307408_1001607853 | 359 |
| 418 | 3300031731 | Ga0307405_10031779 | Ga0307405_100317793 | 359 |
| 419 | 3300031911 | Ga0307412_10222407 | Ga0307412_102224072 | 359 |
| 420 | 3300032002 | Ga0307416_100047136 | Ga0307416_1000471362 | 359 |
| 421 | 3300032002 | Ga0307416_100232448 | Ga0307416_1002324482 | 359 |
| 422 | 3300034817 | Ga0373948_0003581 | Ga0373948_0003581_490_1569 | 359 |
| 423 | 3300035088 | Ga0373940_0003844 | Ga0373940_0003844_1947_3026 | 359 |
| 424 | 3300035172 | Ga0373955_0012841 | Ga0373955_0012841_1548_2627 | 359 |
| 425 | 3300035207 | Ga0373942_0004845 | Ga0373942_0004845_227_1306 | 359 |
| 426 | 3300035241 | Ga0373961_0010146 | Ga0373961_0010146_782_1861 | 359 |
| 427 | 3300035691 | Ga0373931_0141349 | Ga0373931_0141349_53_1138 | 359 |
| 428 | 3300035724 | Ga0373933_0001569 | Ga0373933_0001569_1253_2332 | 359 |
| 429 | 3300036401 | Ga0373937_0001440 | Ga0373937_0001440_11027_12106 | 359 |
| 430 | 3300037418 | Ga0395900_0374052 | Ga0395900_0374052_25_1104 | 359 |
| 431 | 3300039438 | Ga0436360_1309494 | Ga0436360_1309494_672_1751 | 359 |
| 432 | 3300041410 | Ga0439461_0001446 | Ga0439461_0001446_1136_2224 | 359 |
| 433 | 3300042001 | Ga0439441_002359 | Ga0439441_002359_1548_2627 | 359 |
| 434 | 3300042012 | Ga0439455_0000404 | Ga0439455_0000404_2614_3693 | 359 |
| 435 | 3300042435 | Ga0439434_0007668 | Ga0439434_0007668_225_1313 | 359 |
| 436 | 3300042438 | Ga0439459_0001683 | Ga0439459_0001683_1299_2378 | 359 |
| 437 | 3300042461 | Ga0439460_0000467 | Ga0439460_0000467_4269_5348 | 359 |
| 438 | 3300042876 | Ga0451577_0030057 | Ga0451577_0030057_2621_3709 | 359 |
| 439 | 3300042876 | Ga0451577_0064436 | Ga0451577_0064436_1421_2500 | 359 |
| 440 | 3300044673 | Ga0453683_0038018 | Ga0453683_0038018_1283_2371 | 359 |
| 441 | 3300044712 | Ga0453684_0053783 | Ga0453684_0053783_1858_2946 | 359 |
| 442 | 3300044712 | Ga0453684_0187883 | Ga0453684_0187883_991_2070 | 359 |
| 443 | 3300045051 | Ga0451576_0014943 | Ga0451576_0014943_1311_2390 | 359 |
| 444 | 3300045051 | Ga0451576_0073051 | Ga0451576_0073051_738_1817 | 359 |
| 445 | 3300045051 | Ga0451576_0098988 | Ga0451576_0098988_1085_2164 | 359 |
| 446 | 3300046472 | Ga0495580_0031006 | Ga0495580_0031006_290_1369 | 359 |
| 447 | 3300046684 | Ga0495669_0074494 | Ga0495669_0074494_458_1537 | 359 |
| 448 | 3300048905 | Ga0496102_0049341 | Ga0496102_0049341_464_1549 | 359 |
| 449 | 3300048905 | Ga0496102_0084015 | Ga0496102_0084015_1361_2440 | 359 |
| 450 | 3300048909 | Ga0496106_0029604 | Ga0496106_0029604_2512_3591 | 359 |
| 451 | 3300048909 | Ga0496106_0164325 | Ga0496106_0164325_365_1450 | 359 |
| 452 | 3300049568 | Ga0501031_0042967 | Ga0501031_0042967_572_1657 | 359 |
| 453 | 3300049570 | Ga0501033_0215223 | Ga0501033_0215223_141_1220 | 359 |
| 454 | 3300049570 | Ga0501033_0292380 | Ga0501033_0292380_42_1121 | 359 |
| 455 | 3300049572 | Ga0501036_0061415 | Ga0501036_0061415_846_1925 | 359 |
| 456 | 3300049572 | Ga0501036_0120391 | Ga0501036_0120391_133_1221 | 359 |
| 457 | 3300049572 | Ga0501036_0211346 | Ga0501036_0211346_527_1612 | 359 |
| 458 | 3300049572 | Ga0501036_0291388 | Ga0501036_0291388_12_1091 | 359 |
| 459 | 3300049573 | Ga0501037_0019615 | Ga0501037_0019615_3407_4486 | 359 |
| 460 | 3300049574 | Ga0501038_0000401 | Ga0501038_0000401_23883_24968 | 359 |
| 461 | 3300049574 | Ga0501038_0029223 | Ga0501038_0029223_182_1261 | 359 |
| 462 | 3300049575 | Ga0501039_0001876 | Ga0501039_0001876_4904_5989 | 359 |
| 463 | 3300049575 | Ga0501039_0016881 | Ga0501039_0016881_555_1640 | 359 |
| 464 | 3300049575 | Ga0501039_0240421 | Ga0501039_0240421_255_1334 | 359 |
| 465 | 3300049576 | Ga0501040_0000653 | Ga0501040_0000653_4026_5111 | 359 |
| 466 | 3300049576 | Ga0501040_0018245 | Ga0501040_0018245_97_1176 | 359 |
| 467 | 3300049576 | Ga0501040_0039044 | Ga0501040_0039044_1489_2568 | 359 |
| 468 | 3300049577 | Ga0501041_0029253 | Ga0501041_0029253_1207_2292 | 359 |
| 469 | 3300049577 | Ga0501041_0040148 | Ga0501041_0040148_1316_2395 | 359 |
| 470 | 3300049577 | Ga0501041_0058507 | Ga0501041_0058507_1031_2119 | 359 |
| 471 | 3300049577 | Ga0501041_0166326 | Ga0501041_0166326_277_1356 | 359 |
| 472 | 3300049578 | Ga0501042_0000024 | Ga0501042_0000024_43457_44542 | 359 |
| 473 | 3300049578 | Ga0501042_0008169 | Ga0501042_0008169_5630_6715 | 359 |
| 474 | 3300049578 | Ga0501042_0008561 | Ga0501042_0008561_4455_5534 | 359 |
| 475 | 3300049578 | Ga0501042_0022252 | Ga0501042_0022252_3169_4248 | 359 |
| 476 | 3300049578 | Ga0501042_0038801 | Ga0501042_0038801_2253_3332 | 359 |
| 477 | 3300049578 | Ga0501042_0100646 | Ga0501042_0100646_819_1898 | 359 |
| 478 | 3300049578 | Ga0501042_0127340 | Ga0501042_0127340_675_1763 | 359 |
| 479 | 3300049578 | Ga0501042_0157118 | Ga0501042_0157118_412_1497 | 359 |
| 480 | 3300049579 | Ga0501043_0180170 | Ga0501043_0180170_387_1466 | 359 |
| 481 | 3300049579 | Ga0501043_0218129 | Ga0501043_0218129_92_1177 | 359 |
| 482 | 3300049580 | Ga0501046_0019373 | Ga0501046_0019373_3096_4181 | 359 |
| 483 | 3300049580 | Ga0501046_0026823 | Ga0501046_0026823_3177_4262 | 359 |
| 484 | 3300049580 | Ga0501046_0079126 | Ga0501046_0079126_80_1168 | 359 |
| 485 | 3300049580 | Ga0501046_0092413 | Ga0501046_0092413_23_1108 | 359 |
| 486 | 3300049580 | Ga0501046_0102816 | Ga0501046_0102816_182_1261 | 359 |
| 487 | 3300049580 | Ga0501046_0181946 | Ga0501046_0181946_338_1417 | 359 |
| 488 | 3300049580 | Ga0501046_0281945 | Ga0501046_0281945_72_1151 | 359 |
| 489 | 3300049581 | Ga0501047_0065762 | Ga0501047_0065762_958_2037 | 359 |
| 490 | 3300049582 | Ga0501048_0074683 | Ga0501048_0074683_1160_2239 | 359 |
| 491 | 3300049582 | Ga0501048_0083980 | Ga0501048_0083980_950_2029 | 359 |
| 492 | 3300049582 | Ga0501048_0235441 | Ga0501048_0235441_96_1175 | 359 |
| 493 | 3300049584 | Ga0501068_0004340 | Ga0501068_0004340_3162_4241 | 359 |
| 494 | 3300049584 | Ga0501068_0008331 | Ga0501068_0008331_1242_2327 | 359 |
| 495 | 3300049584 | Ga0501068_0062093 | Ga0501068_0062093_283_1371 | 359 |
| 496 | 3300049584 | Ga0501068_0154447 | Ga0501068_0154447_290_1369 | 359 |
| 497 | 3300049585 | Ga0501069_0046821 | Ga0501069_0046821_1095_2252 | 359 |
| 498 | 3300049586 | Ga0501070_0018693 | Ga0501070_0018693_3788_4867 | 359 |
| 499 | 3300049586 | Ga0501070_0250805 | Ga0501070_0250805_222_1379 | 359 |
| 500 | 3300049587 | Ga0501071_0000232 | Ga0501071_0000232_3091_4176 | 359 |
| 501 | 3300049587 | Ga0501071_0024558 | Ga0501071_0024558_2599_3684 | 359 |
| 502 | 3300049587 | Ga0501071_0028572 | Ga0501071_0028572_36_1193 | 359 |
| 503 | 3300049587 | Ga0501071_0071686 | Ga0501071_0071686_430_1509 | 359 |
| 504 | 3300049588 | Ga0501072_0000370 | Ga0501072_0000370_18958_20043 | 359 |
| 505 | 3300049588 | Ga0501072_0004162 | Ga0501072_0004162_6405_7484 | 359 |
| 506 | 3300049588 | Ga0501072_0015729 | Ga0501072_0015729_1270_2355 | 359 |
| 507 | 3300049588 | Ga0501072_0030484 | Ga0501072_0030484_2140_3219 | 359 |
| 508 | 3300049588 | Ga0501072_0031056 | Ga0501072_0031056_441_1526 | 359 |
| 509 | 3300049588 | Ga0501072_0053905 | Ga0501072_0053905_1643_2728 | 359 |
| 510 | 3300049588 | Ga0501072_0065072 | Ga0501072_0065072_195_1274 | 359 |
| 511 | 3300049588 | Ga0501072_0099823 | Ga0501072_0099823_732_1811 | 359 |
| 512 | 3300049589 | Ga0501073_0258382 | Ga0501073_0258382_63_1142 | 359 |
| 513 | 3300049590 | Ga0501074_0000394 | Ga0501074_0000394_9507_10592 | 359 |
| 514 | 3300049590 | Ga0501074_0032635 | Ga0501074_0032635_84_1163 | 359 |
| 515 | 3300049590 | Ga0501074_0066239 | Ga0501074_0066239_118_1197 | 359 |
| 516 | 3300049591 | Ga0501075_0000149 | Ga0501075_0000149_25366_26451 | 359 |
| 517 | 3300049591 | Ga0501075_0004311 | Ga0501075_0004311_7656_8741 | 359 |
| 518 | 3300049591 | Ga0501075_0007147 | Ga0501075_0007147_164_1243 | 359 |
| 519 | 3300049591 | Ga0501075_0202367 | Ga0501075_0202367_363_1442 | 359 |
| 520 | 3300049592 | Ga0501076_0000439 | Ga0501076_0000439_18144_19229 | 359 |
| 521 | 3300049592 | Ga0501076_0011961 | Ga0501076_0011961_4057_5142 | 359 |
| 522 | 3300049592 | Ga0501076_0049814 | Ga0501076_0049814_163_1248 | 359 |
| 523 | 3300049592 | Ga0501076_0076927 | Ga0501076_0076927_339_1418 | 359 |
| 524 | 3300049592 | Ga0501076_0094939 | Ga0501076_0094939_603_1682 | 359 |
| 525 | 3300049592 | Ga0501076_0104025 | Ga0501076_0104025_137_1222 | 359 |
| 526 | 3300049593 | Ga0501077_0000816 | Ga0501077_0000816_8472_9557 | 359 |
| 527 | 3300049593 | Ga0501077_0002050 | Ga0501077_0002050_6570_7649 | 359 |
| 528 | 3300049593 | Ga0501077_0007869 | Ga0501077_0007869_912_2069 | 359 |
| 529 | 3300049593 | Ga0501077_0036174 | Ga0501077_0036174_1490_2569 | 359 |
| 530 | 3300049593 | Ga0501077_0057739 | Ga0501077_0057739_264_1349 | 359 |
| 531 | 3300049593 | Ga0501077_0117814 | Ga0501077_0117814_310_1398 | 359 |
| 532 | 3300049593 | Ga0501077_0155896 | Ga0501077_0155896_326_1405 | 359 |
| 533 | 3300049741 | Ga0501079_0000446 | Ga0501079_0000446_16094_17179 | 359 |
| 534 | 3300049741 | Ga0501079_0001113 | Ga0501079_0001113_16287_17366 | 359 |
| 535 | 3300049741 | Ga0501079_0012858 | Ga0501079_0012858_3008_4093 | 359 |
| 536 | 3300049741 | Ga0501079_0022654 | Ga0501079_0022654_1928_3085 | 359 |
| 537 | 3300049741 | Ga0501079_0028656 | Ga0501079_0028656_2622_3701 | 359 |
| 538 | 3300049741 | Ga0501079_0046601 | Ga0501079_0046601_2154_3233 | 359 |
| 539 | 3300049741 | Ga0501079_0132011 | Ga0501079_0132011_106_1185 | 359 |
| 540 | 3300049741 | Ga0501079_0169389 | Ga0501079_0169389_581_1669 | 359 |
| 541 | 3300049741 | Ga0501079_0180845 | Ga0501079_0180845_413_1492 | 359 |
| 542 | 3300049742 | Ga0501080_0001577 | Ga0501080_0001577_8400_9485 | 359 |
| 543 | 3300049742 | Ga0501080_0075763 | Ga0501080_0075763_717_1805 | 359 |
| 544 | 3300049742 | Ga0501080_0088973 | Ga0501080_0088973_1710_2789 | 359 |
| 545 | 3300049742 | Ga0501080_0242657 | Ga0501080_0242657_80_1159 | 359 |
| 546 | 3300049743 | Ga0501081_0000028 | Ga0501081_0000028_47555_48640 | 359 |
| 547 | 3300049743 | Ga0501081_0000106 | Ga0501081_0000106_8118_9197 | 359 |
| 548 | 3300049743 | Ga0501081_0005345 | Ga0501081_0005345_859_1947 | 359 |
| 549 | 3300049743 | Ga0501081_0007059 | Ga0501081_0007059_5176_6333 | 359 |
| 550 | 3300049743 | Ga0501081_0013904 | Ga0501081_0013904_1519_2604 | 359 |
| 551 | 3300049743 | Ga0501081_0031757 | Ga0501081_0031757_92_1171 | 359 |
| 552 | 3300049743 | Ga0501081_0038501 | Ga0501081_0038501_513_1598 | 359 |
| 553 | 3300049743 | Ga0501081_0145869 | Ga0501081_0145869_469_1548 | 359 |
| 554 | 3300049744 | Ga0501083_0181252 | Ga0501083_0181252_96_1175 | 359 |
| 555 | 3300049822 | Ga0501035_0027904 | Ga0501035_0027904_474_1553 | 359 |
| 556 | 3300049824 | Ga0501045_0000638 | Ga0501045_0000638_8506_9591 | 359 |
| 557 | 3300049824 | Ga0501045_0005728 | Ga0501045_0005728_3525_4682 | 359 |
| 558 | 3300049824 | Ga0501045_0019214 | Ga0501045_0019214_2831_3916 | 359 |
| 559 | 3300049824 | Ga0501045_0019403 | Ga0501045_0019403_2750_3829 | 359 |
| 560 | 3300049824 | Ga0501045_0070859 | Ga0501045_0070859_883_1968 | 359 |
| 561 | 3300049824 | Ga0501045_0087471 | Ga0501045_0087471_189_1268 | 359 |
| 562 | 3300050507 | nmdc:mga05p37_21830_c1 | nmdc:mga05p37_21830_c1_5726_6805 | 359 |
| 563 | 3300050507 | nmdc:mga05p37_294_c1 | nmdc:mga05p37_294_c1_44655_45740 | 359 |
| 564 | 3300050507 | nmdc:mga05p37_53958_c1 | nmdc:mga05p37_53958_c1_3730_4809 | 359 |
| 565 | 3300050507 | nmdc:mga05p37_585385_c1 | nmdc:mga05p37_585385_c1_148_1227 | 359 |
| 566 | 3300050507 | nmdc:mga05p37_76679_c1 | nmdc:mga05p37_76679_c1_1486_2565 | 359 |
| 567 | 3300050508 | nmdc:mga09592_169697_c1 | nmdc:mga09592_169697_c1_375_1454 | 359 |
| 568 | 3300050508 | nmdc:mga09592_217838_c1 | nmdc:mga09592_217838_c1_117_1199 | 359 |
| 569 | 3300050508 | nmdc:mga09592_41545_c1 | nmdc:mga09592_41545_c1_1401_2480 | 359 |
| 570 | 3300050510 | nmdc:mga06r32_280039_c1 | nmdc:mga06r32_280039_c1_544_1626 | 359 |
| 571 | 3300050511 | nmdc:mga08y16_217486_c1 | nmdc:mga08y16_217486_c1_635_1720 | 359 |
| 572 | 3300050511 | nmdc:mga08y16_3197_c1 | nmdc:mga08y16_3197_c1_12873_13952 | 359 |
| 573 | 3300050514 | nmdc:mga08x19_11181_c1 | nmdc:mga08x19_11181_c1_3002_4081 | 359 |
| 574 | 3300050514 | nmdc:mga08x19_19389_c1 | nmdc:mga08x19_19389_c1_495_1574 | 359 |
| 575 | 3300050514 | nmdc:mga08x19_9220_c1 | nmdc:mga08x19_9220_c1_3021_4100 | 359 |
| 576 | 3300054114 | Ga0501084_0000525 | Ga0501084_0000525_9409_10494 | 359 |
| 577 | 3300054114 | Ga0501084_0008168 | Ga0501084_0008168_7462_8550 | 359 |
| 578 | 3300054114 | Ga0501084_0067064 | Ga0501084_0067064_936_2015 | 359 |
| 579 | 3300054114 | Ga0501084_0107357 | Ga0501084_0107357_40_1119 | 359 |
| 580 | 3300060353 | Ga0501082_0000626 | Ga0501082_0000626_13823_14908 | 359 |
| 581 | 3300060353 | Ga0501082_0001643 | Ga0501082_0001643_320_1399 | 359 |
| 582 | 3300060353 | Ga0501082_0022459 | Ga0501082_0022459_1943_3028 | 359 |
| 583 | 3300060353 | Ga0501082_0030033 | Ga0501082_0030033_1052_2209 | 359 |
| 584 | 3300060353 | Ga0501082_0041252 | Ga0501082_0041252_2884_3963 | 359 |
| 585 | 3300060353 | Ga0501082_0131080 | Ga0501082_0131080_566_1651 | 359 |
| 586 | 3300061734 | Ga0530510_0000071 | Ga0530510_0000071_13554_14639 | 359 |
| 587 | 3300061734 | Ga0530510_0000932 | Ga0530510_0000932_14067_15152 | 359 |
| 588 | 3300061734 | Ga0530510_0002497 | Ga0530510_0002497_8124_9209 | 359 |
| 589 | 3300061734 | Ga0530510_0009032 | Ga0530510_0009032_5690_6769 | 359 |
| 590 | 3300061734 | Ga0530510_0024049 | Ga0530510_0024049_432_1511 | 359 |
| 591 | 3300061734 | Ga0530510_0066451 | Ga0530510_0066451_981_2060 | 359 |
| 592 | 3300061734 | Ga0530510_0080163 | Ga0530510_0080163_1147_2232 | 359 |
| 593 | 3300061734 | Ga0530510_0152760 | Ga0530510_0152760_405_1562 | 359 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hnc-assembly1.cif.gz_B | p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid | 0.9477 | 2 | 358 |
| 5xd8-assembly1.cif.gz_A | crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase | 0.946 | 2 | 359 |
| 3ck5-assembly2.cif.gz_D | crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium | 0.9424 | 3 | 348 |
| 5xd7-assembly1.cif.gz_A-2 | crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase | 0.9418 | 2 | 359 |
| 4hnc-assembly1.cif.gz_B | p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid | 0.9399 | 2 | 358 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3uxlA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9373 | 118 | 348 | 3.20.20.120 |
| 3ck5D02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9348 | 118 | 348 | 3.20.20.120 |
| 5xd9A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9298 | 117 | 348 | 3.20.20.120 |
| 4mggG01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9291 | 1 | 116 | 3.30.390.10 |
| 4h19A02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9278 | 118 | 348 | 3.20.20.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1P8Y012-F1-model_v4 | deleted | 0.9509 | 2 | 359 |
|
| AF-A0A6B1EAD3-F1-model_v4 | Mandelate racemase/muconate lactonizing enzyme family protein | 0.9493 | 2 | 359 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 |
| AF-A0A6N8YX23-F1-model_v4 | Mandelate racemase/muconate lactonizing enzyme family protein | 0.9482 | 2 | 359 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 |
| AF-A0A848W4B3-F1-model_v4 | Mandelate racemase/muconate lactonizing enzyme N-terminal domain-containing protein | 0.9478 | 1 | 167 |
GO:0000287
GO:0016052 GO:0016836 |
| AF-A0A2K8QTU7-F1-model_v4 | deleted | 0.9459 | 122 | 316 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar