F467256

General Info

Members Datasets Scaffolds Average Seq Length
593 254 593 356

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0139457|Ga0451577_0139457_966_2156
Length 396
Sequence MPLRRSAFRRSAVKPAIHASPVETAVQSRKIRRKIRAAMKITSIETCLLTVPTPRPMSTEWPHHKFVVADIATDEGVSGHGYSMVFGGGGAEAVLAYLDTRLKGLLIGEDPLQVERLWDKMYRGDRGVRRVGIAGMAISALDIALWDLAGKAAGLPLYKLWGGFTDRVSAYGSGGWGKYSEAELVAEAQRYAAAGCKYYKMKIHHPDPKVNRARVEAVRKAVGPGMRMMVDVNQKLDLEGNRRQAALLEDFDLVWYEEPVLSDDLAACEEVARAIRIPVATGENNYTRYEFRELIQRRAARYLMPDVCRANGYSETLKIGHLAAAHGIAVSPHVVHELSLQVCGALSNGFLVEYMDWAPKDLFEELPECKDGEFRIPAKPGHGIAMTKEALKKYRV

Samples

Sample ID Description Type Environment
1 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
2 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
163 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
183 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
184 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
188 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
229 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
230 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.67
Rhizosphere 99.16
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26128J50194_1000894 3300003347 Bacteria 1808
2 JGI26141J51220_1000826 3300003503 Bacteria 1802
3 Ga0065715_10114096 3300005293 Bacteria 2463
4 Ga0070676_10001199 3300005328 Bacteria 12991
5 Ga0070683_100063983 3300005329 Bacteria 3423
6 Ga0070690_100004007 3300005330 Bacteria 8148
7 Ga0070690_100015226 3300005330 Bacteria 4583
8 Ga0068869_100003166 3300005334 Bacteria 10041
9 Ga0068869_100003313 3300005334 Bacteria 9842
10 Ga0070666_10091539 3300005335 Bacteria 2089
11 Ga0070680_100000149 3300005336 Bacteria 43060
12 Ga0070680_100010180 3300005336 Bacteria 7252
13 Ga0070680_100065485 3300005336 Bacteria 2978
14 Ga0070682_100003456 3300005337 Bacteria 8738
15 Ga0070682_100004482 3300005337 Bacteria 7759
16 Ga0068868_100000056 3300005338 Bacteria 63982
17 Ga0070660_100001484 3300005339 Bacteria 16063
18 Ga0070689_100000200 3300005340 Bacteria 35886
19 Ga0070689_100054730 3300005340 Bacteria 3090
20 Ga0070689_100295474 3300005340 Bacteria 1347
21 Ga0070691_10002484 3300005341 Bacteria 8201
22 Ga0070691_10003669 3300005341 Bacteria 6933
23 Ga0070691_10008969 3300005341 Bacteria 4575
24 Ga0070687_100000052 3300005343 Bacteria 37327
25 Ga0070687_100040762 3300005343 Bacteria 2342
26 Ga0070661_100001482 3300005344 Bacteria 16294
27 Ga0070692_10000237 3300005345 Bacteria 15137
28 Ga0070669_100157823 3300005353 Bacteria 1760
29 Ga0070688_100033852 3300005365 Bacteria 3090
30 Ga0070659_100001725 3300005366 Bacteria 15702
31 Ga0070667_100054095 3300005367 Bacteria 3389
32 Ga0070701_10003888 3300005438 Bacteria 5964
33 Ga0070701_10098173 3300005438 Bacteria 1617
34 Ga0070705_100000638 3300005440 Bacteria 20069
35 Ga0070705_100008127 3300005440 Bacteria 5190
36 Ga0070705_100009236 3300005440 Bacteria 4898
37 Ga0070705_100093941 3300005440 Bacteria 1876
38 Ga0070700_100000211 3300005441 Bacteria 32522
39 Ga0070694_100012825 3300005444 Bacteria 5223
40 Ga0070694_100014905 3300005444 Bacteria 4871
41 Ga0070694_100019179 3300005444 Bacteria 4349
42 Ga0070694_100202874 3300005444 Bacteria 1479
43 Ga0070708_100197938 3300005445 Bacteria 1880
44 Ga0070663_100067992 3300005455 Bacteria 2586
45 Ga0070662_100001423 3300005457 Bacteria 14758
46 Ga0070681_10000525 3300005458 Bacteria 31394
47 Ga0070681_10040330 3300005458 Bacteria 4678
48 Ga0068867_100006487 3300005459 Bacteria 8266
49 Ga0068867_100012689 3300005459 Bacteria 5960
50 Ga0068867_100014336 3300005459 Bacteria 5614
51 Ga0068867_100236697 3300005459 Bacteria 1479
52 Ga0070706_100149877 3300005467 Bacteria 2177
53 Ga0070706_100166342 3300005467 Unclassified 2059
54 Ga0070706_100246353 3300005467 Bacteria 1669
55 Ga0070706_100364510 3300005467 Bacteria 1346
56 Ga0070707_100027164 3300005468 Bacteria 5442
57 Ga0070707_100034501 3300005468 Bacteria 4825
58 Ga0070707_100182361 3300005468 Unclassified 2047
59 Ga0070698_100002031 3300005471 Bacteria 22500
60 Ga0070698_100018091 3300005471 Bacteria 7420
61 Ga0070698_100042807 3300005471 Bacteria 4645
62 Ga0070698_100165087 3300005471 Bacteria 2157
63 Ga0070699_100005247 3300005518 Bacteria 11376
64 Ga0070699_100008860 3300005518 Bacteria 8711
65 Ga0070699_100013971 3300005518 Bacteria 6907
66 Ga0070699_100031566 3300005518 Bacteria 4573
67 Ga0070699_100063401 3300005518 Bacteria 3205
68 Ga0070699_100070352 3300005518 Bacteria 3042
69 Ga0070699_100196508 3300005518 Unclassified 1793
70 Ga0070679_100022523 3300005530 Bacteria 6158
71 Ga0070679_100027284 3300005530 Bacteria 5619
72 Ga0070679_100095686 3300005530 Bacteria 2957
73 Ga0070684_100008881 3300005535 Bacteria 7883
74 Ga0070684_100070340 3300005535 Bacteria 3079
75 Ga0070697_100029077 3300005536 Bacteria 4429
76 Ga0070697_100215992 3300005536 Bacteria 1634
77 Ga0068853_100001823 3300005539 Bacteria 15670
78 Ga0070672_100246796 3300005543 Bacteria 1503
79 Ga0070686_100000545 3300005544 Bacteria 22498
80 Ga0070686_100010212 3300005544 Bacteria 5285
81 Ga0070695_100001651 3300005545 Bacteria 12528
82 Ga0070695_100004303 3300005545 Bacteria 8339
83 Ga0070695_100012905 3300005545 Bacteria 5016
84 Ga0070695_100037942 3300005545 Bacteria 3038
85 Ga0070695_100049167 3300005545 Bacteria 2699
86 Ga0070696_100000012 3300005546 Bacteria 79388
87 Ga0070696_100002298 3300005546 Bacteria 12607
88 Ga0070696_100033450 3300005546 Bacteria 3532
89 Ga0070696_100046429 3300005546 Bacteria 3012
90 Ga0070696_100096985 3300005546 Bacteria 2107
91 Ga0070693_100000579 3300005547 Bacteria 16207
92 Ga0070693_100003873 3300005547 Bacteria 7017
93 Ga0070693_100146810 3300005547 Bacteria 1490
94 Ga0070704_100001021 3300005549 Bacteria 14388
95 Ga0070704_100003341 3300005549 Bacteria 9183
96 Ga0070704_100090289 3300005549 Bacteria 2281
97 Ga0068855_100005123 3300005563 Bacteria 15980
98 Ga0068855_100045041 3300005563 Bacteria 5219
99 Ga0070664_100019414 3300005564 Bacteria 5593
100 Ga0068854_100075964 3300005578 Bacteria 2468
101 Ga0068856_100046268 3300005614 Bacteria 4286
102 Ga0068856_100106739 3300005614 Bacteria 2795
103 Ga0070702_100000225 3300005615 Bacteria 19043
104 Ga0070702_100013212 3300005615 Bacteria 4163
105 Ga0070702_100110666 3300005615 Bacteria 1702
106 Ga0068852_100038813 3300005616 Bacteria 4005
107 Ga0068859_100015807 3300005617 Bacteria 7582
108 Ga0068859_100059404 3300005617 Bacteria 3852
109 Ga0068859_100074965 3300005617 Bacteria 3423
110 Ga0068859_100547624 3300005617 Unclassified 1252
111 Ga0068864_100048082 3300005618 Bacteria 3666
112 Ga0068864_100128262 3300005618 Bacteria 2275
113 Ga0068866_10000850 3300005718 Bacteria 13518
114 Ga0068861_100000033 3300005719 Bacteria 64659
115 Ga0068861_100131639 3300005719 Bacteria 2031
116 Ga0068870_10000437 3300005840 Bacteria 15814
117 Ga0068870_10047180 3300005840 Unclassified 2263
118 Ga0068863_100230438 3300005841 Bacteria 1786
119 Ga0068858_100001425 3300005842 Bacteria 24575
120 Ga0068858_100012686 3300005842 Bacteria 7940
121 Ga0068860_100007436 3300005843 Bacteria 10953
122 Ga0068860_100057420 3300005843 Bacteria 3700
123 Ga0068860_100139938 3300005843 Bacteria 2326
124 Ga0068860_100370308 3300005843 Bacteria 1413
125 Ga0068862_100000735 3300005844 Bacteria 32926
126 Ga0068862_100002850 3300005844 Bacteria 15162
127 Ga0068862_100015430 3300005844 Bacteria 6346
128 Ga0068862_100481446 3300005844 Unclassified 1175
129 Ga0081540_1061624 3300005983 Bacteria 1787
130 Ga0081539_10000462 3300005985 Bacteria 86060
131 Ga0070716_100021860 3300006173 Bacteria 3374
132 Ga0097621_100000939 3300006237 Bacteria 20422
133 Ga0068871_100001863 3300006358 Bacteria 14259
134 Ga0068871_100003056 3300006358 Bacteria 11486
135 Ga0075428_100009686 3300006844 Bacteria 10701
136 Ga0075428_100010456 3300006844 Bacteria 10308
137 Ga0075428_100024711 3300006844 Bacteria 6648
138 Ga0075430_100000086 3300006846 Bacteria 52815
139 Ga0075431_100016749 3300006847 Bacteria 7443
140 Ga0075431_100020018 3300006847 Bacteria 6833
141 Ga0075431_100191257 3300006847 Bacteria 2097
142 Ga0075433_10000500 3300006852 Bacteria 25544
143 Ga0075433_10001084 3300006852 Bacteria 19620
144 Ga0075433_10004787 3300006852 Bacteria 10563
145 Ga0075433_10051178 3300006852 Bacteria 3596
146 Ga0075434_100003449 3300006871 Bacteria 14136
147 Ga0075434_100022012 3300006871 Bacteria 6204
148 Ga0075434_100068637 3300006871 Bacteria 3532
149 Ga0075429_100000259 3300006880 Bacteria 36776
150 Ga0075429_100003089 3300006880 Bacteria 14125
151 Ga0075429_100077207 3300006880 Bacteria 2902
152 Ga0075429_100164001 3300006880 Bacteria 1946
153 Ga0075429_100273463 3300006880 Unclassified 1479
154 Ga0068865_100000844 3300006881 Bacteria 17310
155 Ga0068865_100142418 3300006881 Bacteria 1809
156 Ga0075436_100000428 3300006914 Bacteria 26958
157 Ga0075436_100000874 3300006914 Bacteria 20002
158 Ga0075436_100002996 3300006914 Bacteria 11564
159 Ga0075436_100007399 3300006914 Bacteria 7512
160 Ga0075436_100038875 3300006914 Bacteria 3283
161 Ga0097620_100015807 3300006931 Bacteria 7582
162 Ga0097620_100059402 3300006931 Bacteria 3852
163 Ga0097620_100074965 3300006931 Bacteria 3423
164 Ga0097620_100547630 3300006931 Unclassified 1252
165 Ga0075435_100000047 3300007076 Bacteria 60782
166 Ga0075435_100005084 3300007076 Bacteria 9141
167 Ga0075435_100016888 3300007076 Bacteria 5510
168 Ga0075435_100019309 3300007076 Bacteria 5203
169 Ga0075435_100032594 3300007076 Bacteria 4115
170 Ga0075435_100071354 3300007076 Bacteria 2836
171 Ga0099794_10002556 3300007265 Bacteria 6741
172 Ga0099794_10089567 3300007265 Bacteria 1526
173 Ga0111539_10001693 3300009094 Bacteria 29397
174 Ga0111539_10006843 3300009094 Bacteria 14647
175 Ga0111539_10009904 3300009094 Bacteria 12026
176 Ga0111539_10017117 3300009094 Bacteria 8973
177 Ga0111539_10030292 3300009094 Bacteria 6578
178 Ga0111539_10117642 3300009094 Bacteria 3115
179 Ga0105245_10027918 3300009098 Bacteria 4974
180 Ga0105245_10050484 3300009098 Bacteria 3728
181 Ga0114129_10000430 3300009147 Bacteria 49930
182 Ga0114129_10002283 3300009147 Bacteria 26550
183 Ga0114129_10003662 3300009147 Bacteria 21610
184 Ga0114129_10004826 3300009147 Bacteria 19052
185 Ga0114129_10039602 3300009147 Bacteria 6645
186 Ga0114129_10055532 3300009147 Bacteria 5549
187 Ga0114129_10088122 3300009147 Bacteria 4304
188 Ga0114129_10292403 3300009147 Unclassified 2174
189 Ga0105243_10000374 3300009148 Bacteria 48005
190 Ga0105241_10000133 3300009174 Bacteria 53690
191 Ga0105241_10101271 3300009174 Bacteria 2290
192 Ga0105242_10000192 3300009176 Bacteria 47321
193 Ga0105242_10067713 3300009176 Bacteria 2952
194 Ga0105242_10388307 3300009176 Bacteria 1299
195 Ga0105248_10238643 3300009177 Bacteria 2046
196 Ga0105248_10356588 3300009177 Bacteria 1647
197 Ga0105237_10207698 3300009545 Bacteria 1958
198 Ga0105249_10122917 3300009553 Bacteria 2469
199 Ga0105249_10242318 3300009553 Bacteria 1783
200 Ga0105239_10051262 3300010375 Bacteria 4525
201 Ga0105246_10297936 3300011119 Bacteria 1301
202 Ga0157373_10013951 3300013100 Bacteria 5893
203 Ga0157371_10085185 3300013102 Bacteria 2239
204 Ga0157369_10062664 3300013105 Bacteria 4007
205 Ga0157378_10004115 3300013297 Bacteria 12844
206 Ga0157378_10448598 3300013297 Unclassified 1280
207 Ga0157372_10006881 3300013307 Bacteria 12099
208 Ga0157372_10037276 3300013307 Bacteria 5361
209 Ga0157375_10139004 3300013308 Bacteria 2554
210 Ga0157379_10470163 3300014968 Bacteria 1163
211 Ga0157376_10033953 3300014969 Bacteria 4114
212 Ga0207653_10007379 3300025885 Bacteria 3427
213 Ga0207642_10000362 3300025899 Bacteria 13648
214 Ga0207688_10008520 3300025901 Bacteria 5583
215 Ga0207647_10146962 3300025904 Unclassified 1379
216 Ga0207699_10127321 3300025906 Bacteria 1656
217 Ga0207645_10002226 3300025907 Bacteria 15461
218 Ga0207643_10001163 3300025908 Bacteria 15640
219 Ga0207684_10001116 3300025910 Bacteria 29985
220 Ga0207684_10040381 3300025910 Bacteria 3955
221 Ga0207684_10044522 3300025910 Bacteria 3764
222 Ga0207684_10069708 3300025910 Unclassified 2988
223 Ga0207654_10089814 3300025911 Bacteria 1870
224 Ga0207707_10000556 3300025912 Bacteria 37797
225 Ga0207707_10161410 3300025912 Bacteria 1959
226 Ga0207707_10263395 3300025912 Bacteria 1495
227 Ga0207671_10115518 3300025914 Bacteria 2046
228 Ga0207660_10002844 3300025917 Bacteria 11320
229 Ga0207660_10231122 3300025917 Bacteria 1454
230 Ga0207662_10000126 3300025918 Bacteria 36663
231 Ga0207662_10060764 3300025918 Bacteria 2267
232 Ga0207657_10003869 3300025919 Bacteria 15892
233 Ga0207649_10005083 3300025920 Bacteria 7111
234 Ga0207652_10016524 3300025921 Bacteria 6027
235 Ga0207652_10024890 3300025921 Bacteria 4969
236 Ga0207652_10110452 3300025921 Bacteria 2438
237 Ga0207646_10015141 3300025922 Bacteria 7295
238 Ga0207646_10075464 3300025922 Bacteria 3012
239 Ga0207646_10089324 3300025922 Bacteria 2758
240 Ga0207646_10113168 3300025922 Unclassified 2436
241 Ga0207659_10146765 3300025926 Bacteria 1838
242 Ga0207687_10000739 3300025927 Bacteria 22162
243 Ga0207690_10025096 3300025932 Bacteria 3738
244 Ga0207706_10045328 3300025933 Bacteria 3897
245 Ga0207706_10120940 3300025933 Bacteria 2302
246 Ga0207686_10000564 3300025934 Bacteria 23601
247 Ga0207709_10000444 3300025935 Bacteria 38874
248 Ga0207709_10032445 3300025935 Bacteria 3058
249 Ga0207670_10004733 3300025936 Bacteria 7380
250 Ga0207670_10050653 3300025936 Bacteria 2784
251 Ga0207704_10018655 3300025938 Bacteria 3627
252 Ga0207711_10320237 3300025941 Bacteria 1433
253 Ga0207689_10000240 3300025942 Bacteria 48953
254 Ga0207689_10001708 3300025942 Bacteria 20783
255 Ga0207689_10067886 3300025942 Bacteria 2930
256 Ga0207689_10377772 3300025942 Bacteria 1180
257 Ga0207661_10083813 3300025944 Bacteria 2639
258 Ga0207679_10050632 3300025945 Bacteria 3036
259 Ga0207667_10005121 3300025949 Bacteria 16007
260 Ga0207667_10289484 3300025949 Bacteria 1674
261 Ga0207651_10103011 3300025960 Bacteria 2123
262 Ga0207712_10023431 3300025961 Bacteria 4073
263 Ga0207712_10289797 3300025961 Bacteria 1339
264 Ga0207640_10284003 3300025981 Bacteria 1301
265 Ga0207658_10179278 3300025986 Bacteria 1752
266 Ga0207677_10000680 3300026023 Bacteria 20127
267 Ga0207703_10011438 3300026035 Bacteria 6901
268 Ga0207703_10012196 3300026035 Bacteria 6701
269 Ga0207639_10006287 3300026041 Bacteria 8066
270 Ga0207639_10042416 3300026041 Bacteria 3410
271 Ga0207678_10021293 3300026067 Bacteria 5684
272 Ga0207708_10000153 3300026075 Bacteria 54987
273 Ga0207708_10235093 3300026075 Bacteria 1472
274 Ga0207702_10037222 3300026078 Bacteria 4072
275 Ga0207702_10173553 3300026078 Bacteria 1979
276 Ga0207641_10204174 3300026088 Bacteria 1824
277 Ga0207648_10000130 3300026089 Bacteria 74342
278 Ga0207648_10064265 3300026089 Bacteria 3199
279 Ga0207648_10064672 3300026089 Bacteria 3188
280 Ga0207648_10066485 3300026089 Bacteria 3144
281 Ga0207676_10156850 3300026095 Bacteria 1967
282 Ga0207674_10005434 3300026116 Bacteria 15131
283 Ga0207674_10008790 3300026116 Bacteria 11628
284 Ga0207674_10239562 3300026116 Unclassified 1761
285 Ga0207675_100000253 3300026118 Bacteria 51284
286 Ga0207675_100018522 3300026118 Bacteria 6494
287 Ga0207683_10178537 3300026121 Bacteria 1925
288 Ga0207698_10236381 3300026142 Bacteria 1662
289 Ga0207698_10264687 3300026142 Bacteria 1581
290 Ga0209967_1000731 3300027364 Bacteria 4223
291 Ga0209981_1001009 3300027378 Bacteria 3550
292 Ga0209984_1000948 3300027424 Bacteria 3099
293 Ga0209995_1002532 3300027471 Bacteria 2894
294 Ga0209968_1001882 3300027526 Bacteria 3183
295 Ga0209999_1000956 3300027543 Bacteria 4865
296 Ga0209983_1000928 3300027665 Bacteria 6438
297 Ga0209588_1044431 3300027671 Bacteria 1437
298 Ga0209971_1004436 3300027682 Bacteria 3332
299 Ga0209966_1000256 3300027695 Bacteria 19430
300 Ga0209998_10000070 3300027717 Bacteria 40919
301 Ga0209974_10000099 3300027876 Bacteria 24483
302 Ga0207428_10000721 3300027907 Bacteria 38142
303 Ga0207428_10000794 3300027907 Bacteria 35722
304 Ga0207428_10006425 3300027907 Bacteria 10856
305 Ga0268265_10028859 3300028380 Bacteria 3976
306 Ga0268265_10038678 3300028380 Bacteria 3510
307 Ga0268264_10037504 3300028381 Bacteria 3996
308 Ga0268264_10042535 3300028381 Bacteria 3761
309 Ga0268264_10143371 3300028381 Bacteria 2133
310 Ga0268264_10149836 3300028381 Bacteria 2090
311 Ga0307408_100004301 3300031548 Bacteria 9666
312 Ga0307408_100160785 3300031548 Bacteria 1784
313 Ga0307405_10031779 3300031731 Bacteria 3112
314 Ga0307405_10242940 3300031731 Bacteria 1335
315 Ga0307412_10222407 3300031911 Unclassified 1448
316 Ga0307416_100047136 3300032002 Bacteria 3408
317 Ga0307416_100232448 3300032002 Unclassified 1779
318 Ga0373948_0003581 3300034817 Bacteria 2398
319 Ga0373940_0003844 3300035088 Bacteria 3114
320 Ga0373944_0010354 3300035089 Bacteria 2540
321 Ga0373936_0000959 3300035113 Bacteria 10286
322 Ga0373939_0001857 3300035114 Bacteria 5063
323 Ga0373941_0020213 3300035115 Bacteria 1864
324 Ga0373941_0073687 3300035115 Bacteria 1139
325 Ga0373945_0002992 3300035116 Bacteria 5312
326 Ga0373946_0006410 3300035171 Bacteria 4265
327 Ga0373955_0012841 3300035172 Bacteria 4037
328 Ga0373942_0004845 3300035207 Bacteria 3125
329 Ga0373942_0006378 3300035207 Bacteria 2723
330 Ga0373961_0010146 3300035241 Bacteria 2318
331 Ga0373961_0033438 3300035241 Bacteria 1448
332 Ga0373962_0021994 3300035242 Bacteria 1687
333 Ga0373924_0008820 3300035410 Bacteria 3678
334 Ga0373931_0004555 3300035691 Bacteria 6342
335 Ga0373931_0141349 3300035691 Bacteria 1394
336 Ga0373935_0011964 3300035692 Bacteria 5212
337 Ga0373927_0082726 3300035695 Bacteria 2081
338 Ga0373933_0001569 3300035724 Bacteria 13375
339 Ga0373947_0067326 3300035725 Bacteria 2187
340 Ga0373937_0001440 3300036401 Bacteria 19895
341 Ga0395900_0374052 3300037418 Unclassified 1394
342 Ga0436360_1309494 3300039438 Bacteria 2197
343 Ga0439461_0001446 3300041410 Bacteria 3670
344 Ga0451839_0456736 3300041496 Bacteria 1689
345 Ga0439441_002359 3300042001 Bacteria 2651
346 Ga0439455_0000404 3300042012 Bacteria 5727
347 Ga0439446_0005070 3300042156 Bacteria 3372
348 Ga0439434_0007668 3300042435 Bacteria 3162
349 Ga0439459_0001683 3300042438 Bacteria 3293
350 Ga0439460_0000467 3300042461 Bacteria 8757
351 Ga0451577_0030057 3300042876 Bacteria 4909
352 Ga0451577_0064436 3300042876 Bacteria 3268
353 Ga0451577_0139457 3300042876 Bacteria 2178
354 Ga0453683_0038018 3300044673 Unclassified 3026
355 Ga0453684_0053783 3300044712 Bacteria 5252
356 Ga0453684_0187883 3300044712 Bacteria 2419
357 Ga0453684_0377246 3300044712 Bacteria 1593
358 Ga0451576_0003101 3300045051 Bacteria 23314
359 Ga0451576_0014943 3300045051 Bacteria 8622
360 Ga0451576_0024911 3300045051 Bacteria 6456
361 Ga0451576_0073051 3300045051 Bacteria 3569
362 Ga0451576_0098988 3300045051 Bacteria 3033
363 Ga0451576_0101156 3300045051 Bacteria 2997
364 Ga0451576_0252735 3300045051 Bacteria 1842
365 Ga0451576_0400865 3300045051 Bacteria 1438
366 Ga0451576_0510050 3300045051 Bacteria 1263
367 Ga0466967_0010071 3300045976 Bacteria 7065
368 Ga0495603_0044154 3300046455 Bacteria 2660
369 Ga0495580_0000845 3300046472 Bacteria 26536
370 Ga0495580_0004779 3300046472 Bacteria 11342
371 Ga0495580_0031006 3300046472 Bacteria 3867
372 Ga0495582_0046060 3300046473 Bacteria 2402
373 Ga0495662_0016646 3300046476 Bacteria 3562
374 Ga0495630_0046766 3300046517 Bacteria 3235
375 Ga0495630_0130107 3300046517 Bacteria 1911
376 Ga0495666_0008044 3300046526 Bacteria 5285
377 Ga0495642_0015060 3300046528 Bacteria 3003
378 Ga0495586_0007966 3300046535 Bacteria 5650
379 Ga0495586_0077795 3300046535 Bacteria 1819
380 Ga0495598_0004441 3300046537 Bacteria 3037
381 Ga0495621_0060717 3300046539 Bacteria 1372
382 Ga0495656_0016044 3300046615 Bacteria 2838
383 Ga0495659_0006510 3300046664 Bacteria 3688
384 Ga0495588_0046765 3300046674 Bacteria 2220
385 Ga0495647_0001586 3300046681 Bacteria 7024
386 Ga0495669_0045474 3300046684 Bacteria 1957
387 Ga0495669_0074494 3300046684 Bacteria 1552
388 Ga0495676_0060585 3300047321 Bacteria 2965
389 Ga0496102_0049341 3300048905 Bacteria 3829
390 Ga0496102_0084015 3300048905 Bacteria 2938
391 Ga0496106_0029604 3300048909 Bacteria 4082
392 Ga0496106_0164325 3300048909 Bacteria 1757
393 Ga0501031_0042967 3300049568 Bacteria 2950
394 Ga0501033_0215223 3300049570 Unclassified 1369
395 Ga0501033_0292380 3300049570 Bacteria 1148
396 Ga0501036_0000338 3300049572 Bacteria 32764
397 Ga0501036_0061415 3300049572 Bacteria 3183
398 Ga0501036_0120391 3300049572 Bacteria 2217
399 Ga0501036_0211346 3300049572 Bacteria 1630
400 Ga0501036_0291388 3300049572 Bacteria 1366
401 Ga0501037_0019615 3300049573 Bacteria 4989
402 Ga0501038_0000401 3300049574 Bacteria 37613
403 Ga0501038_0029223 3300049574 Bacteria 4887
404 Ga0501039_0001876 3300049575 Bacteria 15542
405 Ga0501039_0016881 3300049575 Bacteria 5596
406 Ga0501039_0152677 3300049575 Bacteria 1814
407 Ga0501039_0240421 3300049575 Bacteria 1423
408 Ga0501040_0000653 3300049576 Bacteria 21332
409 Ga0501040_0018245 3300049576 Bacteria 4658
410 Ga0501040_0039044 3300049576 Bacteria 3228
411 Ga0501041_0029253 3300049577 Bacteria 3323
412 Ga0501041_0029519 3300049577 Bacteria 3308
413 Ga0501041_0040148 3300049577 Bacteria 2840
414 Ga0501041_0058507 3300049577 Bacteria 2358
415 Ga0501041_0166326 3300049577 Bacteria 1379
416 Ga0501042_0000024 3300049578 Bacteria 49123
417 Ga0501042_0008169 3300049578 Bacteria 6896
418 Ga0501042_0008561 3300049578 Bacteria 6765
419 Ga0501042_0022252 3300049578 Bacteria 4428
420 Ga0501042_0038801 3300049578 Bacteria 3382
421 Ga0501042_0100646 3300049578 Bacteria 2078
422 Ga0501042_0127340 3300049578 Bacteria 1834
423 Ga0501042_0157118 3300049578 Bacteria 1640
424 Ga0501042_0315331 3300049578 Bacteria 1130
425 Ga0501043_0180170 3300049579 Bacteria 1646
426 Ga0501043_0218129 3300049579 Bacteria 1477
427 Ga0501046_0019373 3300049580 Bacteria 5646
428 Ga0501046_0026823 3300049580 Bacteria 4705
429 Ga0501046_0079126 3300049580 Bacteria 2542
430 Ga0501046_0092413 3300049580 Bacteria 2326
431 Ga0501046_0102816 3300049580 Bacteria 2190
432 Ga0501046_0112287 3300049580 Bacteria 2081
433 Ga0501046_0181946 3300049580 Unclassified 1571
434 Ga0501046_0281945 3300049580 Bacteria 1217
435 Ga0501047_0065762 3300049581 Bacteria 3495
436 Ga0501048_0074683 3300049582 Bacteria 2392
437 Ga0501048_0083980 3300049582 Bacteria 2245
438 Ga0501048_0199881 3300049582 Bacteria 1417
439 Ga0501048_0235441 3300049582 Bacteria 1299
440 Ga0501068_0004340 3300049584 Bacteria 7710
441 Ga0501068_0008331 3300049584 Bacteria 5766
442 Ga0501068_0062093 3300049584 Bacteria 2271
443 Ga0501068_0154447 3300049584 Bacteria 1444
444 Ga0501069_0046821 3300049585 Bacteria 2400
445 Ga0501070_0018693 3300049586 Bacteria 5814
446 Ga0501070_0250805 3300049586 Bacteria 1448
447 Ga0501071_0000232 3300049587 Bacteria 25461
448 Ga0501071_0024558 3300049587 Bacteria 4217
449 Ga0501071_0028572 3300049587 Bacteria 3932
450 Ga0501071_0071686 3300049587 Bacteria 2526
451 Ga0501071_0086989 3300049587 Bacteria 2292
452 Ga0501072_0000370 3300049588 Bacteria 32057
453 Ga0501072_0004162 3300049588 Bacteria 10950
454 Ga0501072_0015729 3300049588 Bacteria 5799
455 Ga0501072_0030484 3300049588 Bacteria 4219
456 Ga0501072_0031056 3300049588 Bacteria 4180
457 Ga0501072_0053905 3300049588 Bacteria 3168
458 Ga0501072_0053974 3300049588 Bacteria 3166
459 Ga0501072_0065072 3300049588 Bacteria 2875
460 Ga0501072_0099823 3300049588 Bacteria 2307
461 Ga0501072_0405545 3300049588 Bacteria 1081
462 Ga0501073_0258382 3300049589 Unclassified 1202
463 Ga0501074_0000394 3300049590 Bacteria 25979
464 Ga0501074_0032635 3300049590 Bacteria 3771
465 Ga0501074_0066239 3300049590 Bacteria 2598
466 Ga0501075_0000149 3300049591 Bacteria 34951
467 Ga0501075_0004311 3300049591 Bacteria 9623
468 Ga0501075_0007147 3300049591 Bacteria 7726
469 Ga0501075_0028294 3300049591 Bacteria 4137
470 Ga0501075_0202367 3300049591 Bacteria 1514
471 Ga0501076_0000439 3300049592 Bacteria 26304
472 Ga0501076_0011961 3300049592 Bacteria 6483
473 Ga0501076_0041425 3300049592 Bacteria 3623
474 Ga0501076_0049814 3300049592 Bacteria 3313
475 Ga0501076_0076927 3300049592 Bacteria 2676
476 Ga0501076_0094939 3300049592 Bacteria 2401
477 Ga0501076_0104025 3300049592 Bacteria 2290
478 Ga0501077_0000816 3300049593 Bacteria 18915
479 Ga0501077_0002050 3300049593 Bacteria 12146
480 Ga0501077_0007869 3300049593 Bacteria 6583
481 Ga0501077_0036174 3300049593 Bacteria 3145
482 Ga0501077_0057739 3300049593 Bacteria 2464
483 Ga0501077_0117814 3300049593 Bacteria 1683
484 Ga0501077_0155896 3300049593 Bacteria 1449
485 Ga0501079_0000446 3300049741 Bacteria 26915
486 Ga0501079_0001113 3300049741 Bacteria 18689
487 Ga0501079_0012858 3300049741 Bacteria 6390
488 Ga0501079_0022654 3300049741 Bacteria 4819
489 Ga0501079_0028656 3300049741 Bacteria 4273
490 Ga0501079_0046601 3300049741 Bacteria 3345
491 Ga0501079_0046826 3300049741 Bacteria 3337
492 Ga0501079_0132011 3300049741 Bacteria 1944
493 Ga0501079_0169389 3300049741 Bacteria 1703
494 Ga0501079_0180845 3300049741 Bacteria 1645
495 Ga0501080_0001577 3300049742 Bacteria 19304
496 Ga0501080_0075763 3300049742 Bacteria 3129
497 Ga0501080_0087287 3300049742 Bacteria 2898
498 Ga0501080_0088973 3300049742 Bacteria 2868
499 Ga0501080_0242657 3300049742 Bacteria 1644
500 Ga0501081_0000028 3300049743 Bacteria 52926
501 Ga0501081_0000106 3300049743 Bacteria 35374
502 Ga0501081_0005345 3300049743 Bacteria 8287
503 Ga0501081_0007059 3300049743 Bacteria 7303
504 Ga0501081_0013904 3300049743 Bacteria 5298
505 Ga0501081_0031757 3300049743 Bacteria 3579
506 Ga0501081_0034418 3300049743 Bacteria 3447
507 Ga0501081_0038501 3300049743 Bacteria 3267
508 Ga0501081_0084412 3300049743 Bacteria 2227
509 Ga0501081_0145869 3300049743 Bacteria 1698
510 Ga0501081_0164993 3300049743 Bacteria 1597
511 Ga0501081_0268891 3300049743 Bacteria 1247
512 Ga0501083_0181252 3300049744 Bacteria 1375
513 Ga0501035_0027904 3300049822 Bacteria 5157
514 Ga0501045_0000638 3300049824 Bacteria 22176
515 Ga0501045_0005728 3300049824 Bacteria 8603
516 Ga0501045_0019214 3300049824 Bacteria 4868
517 Ga0501045_0019403 3300049824 Bacteria 4846
518 Ga0501045_0070859 3300049824 Bacteria 2565
519 Ga0501045_0087471 3300049824 Unclassified 2301
520 nmdc:mga05p37_1829_c1 3300050507 Bacteria 24804
521 nmdc:mga05p37_21830_c1 3300050507 Bacteria 7755
522 nmdc:mga05p37_294_c1 3300050507 Bacteria 52291
523 nmdc:mga05p37_3428_c1 3300050507 Bacteria 18492
524 nmdc:mga05p37_473_c2 3300050507 Bacteria 29340
525 nmdc:mga05p37_503_c1 3300050507 Bacteria 43030
526 nmdc:mga05p37_53958_c1 3300050507 Bacteria 4945
527 nmdc:mga05p37_585385_c1 3300050507 Bacteria 1263
528 nmdc:mga05p37_76679_c1 3300050507 Bacteria 4115
529 nmdc:mga09592_15367_c1 3300050508 Bacteria 6252
530 nmdc:mga09592_169697_c1 3300050508 Bacteria 1886
531 nmdc:mga09592_217838_c1 3300050508 Bacteria 1654
532 nmdc:mga09592_241929_c1 3300050508 Bacteria 1564
533 nmdc:mga09592_41545_c1 3300050508 Bacteria 3867
534 nmdc:mga09592_5141_c1 3300050508 Bacteria 10626
535 nmdc:mga09592_665_c1 3300050508 Bacteria 26260
536 nmdc:mga09592_67117_c1 3300050508 Bacteria 3042
537 nmdc:mga0qj67_11455_c1 3300050509 Bacteria 6645
538 nmdc:mga0qj67_14675_c1 3300050509 Bacteria 5924
539 nmdc:mga0qj67_341873_c1 3300050509 Bacteria 1210
540 nmdc:mga06r32_11384_c1 3300050510 Bacteria 8012
541 nmdc:mga06r32_22246_c1 3300050510 Bacteria 5859
542 nmdc:mga06r32_280039_c1 3300050510 Bacteria 1655
543 nmdc:mga06r32_35082_c1 3300050510 Bacteria 4732
544 nmdc:mga06r32_73362_c1 3300050510 Bacteria 3315
545 nmdc:mga06r32_89647_c1 3300050510 Bacteria 3003
546 nmdc:mga08y16_14006_c1 3300050511 Bacteria 8441
547 nmdc:mga08y16_185763_c1 3300050511 Bacteria 2157
548 nmdc:mga08y16_19421_c1 3300050511 Bacteria 7165
549 nmdc:mga08y16_21631_c1 3300050511 Bacteria 6791
550 nmdc:mga08y16_217486_c1 3300050511 Bacteria 1978
551 nmdc:mga08y16_3197_c1 3300050511 Bacteria 16953
552 nmdc:mga08y16_8586_c1 3300050511 Bacteria 10705
553 nmdc:mga0n895_14201_c1 3300050512 Bacteria 7223
554 nmdc:mga0n895_1662_c1 3300050512 Bacteria 16791
555 nmdc:mga0n895_197695_c1 3300050512 Unclassified 2042
556 nmdc:mga0n895_212762_c1 3300050512 Bacteria 1963
557 nmdc:mga0n895_216569_c1 3300050512 Bacteria 1944
558 nmdc:mga0rr50_15230_c1 3300050513 Bacteria 5071
559 nmdc:mga0rr50_359_c1 3300050513 Bacteria 24852
560 nmdc:mga0rr50_38092_c1 3300050513 Bacteria 3476
561 nmdc:mga0rr50_67721_c1 3300050513 Bacteria 2713
562 nmdc:mga08x19_1000_c1 3300050514 Bacteria 17670
563 nmdc:mga08x19_11181_c1 3300050514 Bacteria 5403
564 nmdc:mga08x19_13829_c1 3300050514 Bacteria 4889
565 nmdc:mga08x19_19389_c1 3300050514 Bacteria 4173
566 nmdc:mga08x19_261_c1 3300050514 Bacteria 40081
567 nmdc:mga08x19_9220_c1 3300050514 Bacteria 5895
568 nmdc:mga0a205_16365_c1 3300050515 Bacteria 6948
569 nmdc:mga0a205_26940_c1 3300050515 Bacteria 5487
570 nmdc:mga0a205_337085_c1 3300050515 Bacteria 1377
571 nmdc:mga0a205_5345_c1 3300050515 Bacteria 11575
572 nmdc:mga0a205_75_c1 3300050515 Bacteria 54682
573 Ga0501084_0000525 3300054114 Bacteria 29296
574 Ga0501084_0008168 3300054114 Bacteria 8632
575 Ga0501084_0067064 3300054114 Bacteria 3003
576 Ga0501084_0107357 3300054114 Bacteria 2345
577 Ga0501084_0208227 3300054114 Bacteria 1650
578 Ga0590077_018466 3300059426 Bacteria 1472
579 Ga0501082_0000626 3300060353 Bacteria 31129
580 Ga0501082_0001643 3300060353 Bacteria 19706
581 Ga0501082_0022459 3300060353 Bacteria 5434
582 Ga0501082_0030033 3300060353 Bacteria 4683
583 Ga0501082_0041252 3300060353 Bacteria 3979
584 Ga0501082_0131080 3300060353 Bacteria 2175
585 Ga0530510_0000071 3300061734 Bacteria 51658
586 Ga0530510_0000932 3300061734 Bacteria 19326
587 Ga0530510_0002497 3300061734 Bacteria 12634
588 Ga0530510_0009032 3300061734 Bacteria 6985
589 Ga0530510_0024049 3300061734 Bacteria 4345
590 Ga0530510_0066451 3300061734 Bacteria 2614
591 Ga0530510_0080163 3300061734 Bacteria 2375
592 Ga0530510_0116679 3300061734 Bacteria 1957
593 Ga0530510_0152760 3300061734 Bacteria 1705

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035241 Ga0373961_0033438 Ga0373961_0033438_435_1424 329
2 3300045051 Ga0451576_0400865 Ga0451576_0400865_50_1039 329
3 3300045051 Ga0451576_0510050 Ga0451576_0510050_11_1003 330
4 3300049578 Ga0501042_0315331 Ga0501042_0315331_21_1046 332
5 3300005330 Ga0070690_100004007 Ga0070690_1000040079 340
6 3300005334 Ga0068869_100003313 Ga0068869_1000033139 340
7 3300005335 Ga0070666_10091539 Ga0070666_100915392 340
8 3300005336 Ga0070680_100000149 Ga0070680_10000014928 340
9 3300005337 Ga0070682_100004482 Ga0070682_1000044824 340
10 3300005338 Ga0068868_100000056 Ga0068868_1000000569 340
11 3300005340 Ga0070689_100000200 Ga0070689_1000002004 340
12 3300005341 Ga0070691_10002484 Ga0070691_100024843 340
13 3300005343 Ga0070687_100000052 Ga0070687_10000005234 340
14 3300005365 Ga0070688_100033852 Ga0070688_1000338522 340
15 3300005438 Ga0070701_10003888 Ga0070701_100038884 340
16 3300005440 Ga0070705_100000638 Ga0070705_10000063821 340
17 3300005441 Ga0070700_100000211 Ga0070700_10000021121 340
18 3300005444 Ga0070694_100012825 Ga0070694_1000128256 340
19 3300005459 Ga0068867_100006487 Ga0068867_1000064879 340
20 3300005530 Ga0070679_100027284 Ga0070679_1000272845 340
21 3300005544 Ga0070686_100000545 Ga0070686_10000054515 340
22 3300005545 Ga0070695_100037942 Ga0070695_1000379421 340
23 3300005546 Ga0070696_100000012 Ga0070696_10000001264 340
24 3300005547 Ga0070693_100000579 Ga0070693_1000005793 340
25 3300005549 Ga0070704_100001021 Ga0070704_10000102117 340
26 3300005563 Ga0068855_100045041 Ga0068855_1000450413 340
27 3300005614 Ga0068856_100046268 Ga0068856_1000462684 340
28 3300005615 Ga0070702_100000225 Ga0070702_10000022519 340
29 3300005617 Ga0068859_100074965 Ga0068859_1000749654 340
30 3300005718 Ga0068866_10000850 Ga0068866_100008509 340
31 3300005719 Ga0068861_100000033 Ga0068861_10000003360 340
32 3300005841 Ga0068863_100230438 Ga0068863_1002304383 340
33 3300005842 Ga0068858_100001425 Ga0068858_10000142522 340
34 3300005843 Ga0068860_100007436 Ga0068860_1000074366 340
35 3300005844 Ga0068862_100000735 Ga0068862_10000073534 340
36 3300006237 Ga0097621_100000939 Ga0097621_10000093922 340
37 3300006358 Ga0068871_100003056 Ga0068871_1000030569 340
38 3300006881 Ga0068865_100000844 Ga0068865_1000008446 340
39 3300006931 Ga0097620_100074965 Ga0097620_1000749654 340
40 3300009174 Ga0105241_10101271 Ga0105241_101012712 340
41 3300009177 Ga0105248_10238643 Ga0105248_102386432 340
42 3300010375 Ga0105239_10051262 Ga0105239_100512623 340
43 3300013297 Ga0157378_10004115 Ga0157378_100041159 340
44 3300025899 Ga0207642_10000362 Ga0207642_100003629 340
45 3300025911 Ga0207654_10089814 Ga0207654_100898142 340
46 3300025918 Ga0207662_10000126 Ga0207662_1000012634 340
47 3300025921 Ga0207652_10024890 Ga0207652_100248903 340
48 3300025926 Ga0207659_10146765 Ga0207659_101467652 340
49 3300025927 Ga0207687_10000739 Ga0207687_1000073914 340
50 3300025934 Ga0207686_10000564 Ga0207686_1000056413 340
51 3300025935 Ga0207709_10000444 Ga0207709_1000044418 340
52 3300025936 Ga0207670_10004733 Ga0207670_100047333 340
53 3300025938 Ga0207704_10018655 Ga0207704_100186552 340
54 3300025941 Ga0207711_10320237 Ga0207711_103202371 340
55 3300025942 Ga0207689_10000240 Ga0207689_1000024019 340
56 3300025961 Ga0207712_10023431 Ga0207712_100234313 340
57 3300026023 Ga0207677_10000680 Ga0207677_1000068013 340
58 3300026035 Ga0207703_10011438 Ga0207703_100114385 340
59 3300026041 Ga0207639_10042416 Ga0207639_100424162 340
60 3300026075 Ga0207708_10000153 Ga0207708_1000015327 340
61 3300026078 Ga0207702_10037222 Ga0207702_100372223 340
62 3300026088 Ga0207641_10204174 Ga0207641_102041742 340
63 3300026089 Ga0207648_10000130 Ga0207648_1000013022 340
64 3300026118 Ga0207675_100000253 Ga0207675_10000025322 340
65 3300026121 Ga0207683_10178537 Ga0207683_101785373 340
66 3300026142 Ga0207698_10236381 Ga0207698_102363811 340
67 3300028380 Ga0268265_10028859 Ga0268265_100288592 340
68 3300028381 Ga0268264_10037504 Ga0268264_100375042 340
69 3300035115 Ga0373941_0020213 Ga0373941_0020213_288_1310 340
70 3300035116 Ga0373945_0002992 Ga0373945_0002992_4046_5068 340
71 3300046472 Ga0495580_0000845 Ga0495580_0000845_22775_23797 340
72 3300005440 Ga0070705_100009236 Ga0070705_1000092363 341
73 3300005546 Ga0070696_100002298 Ga0070696_10000229811 341
74 3300006846 Ga0075430_100000086 Ga0075430_10000008645 341
75 3300006847 Ga0075431_100020018 Ga0075431_1000200186 341
76 3300009094 Ga0111539_10006843 Ga0111539_1000684311 341
77 3300009147 Ga0114129_10002283 Ga0114129_100022833 341
78 3300009147 Ga0114129_10003662 Ga0114129_100036626 341
79 3300013297 Ga0157378_10448598 Ga0157378_104485981 341
80 3300035115 Ga0373941_0073687 Ga0373941_0073687_93_1124 341
81 3300035691 Ga0373931_0004555 Ga0373931_0004555_1370_2395 341
82 3300045051 Ga0451576_0101156 Ga0451576_0101156_1602_2627 341
83 3300049572 Ga0501036_0000338 Ga0501036_0000338_41_1072 341
84 3300049588 Ga0501072_0405545 Ga0501072_0405545_46_1071 341
85 3300049743 Ga0501081_0268891 Ga0501081_0268891_45_1070 341
86 3300050507 nmdc:mga05p37_3428_c1 nmdc:mga05p37_3428_c1_765_1790 341
87 3300050507 nmdc:mga05p37_473_c2 nmdc:mga05p37_473_c2_10160_11236 341
88 3300050508 nmdc:mga09592_15367_c1 nmdc:mga09592_15367_c1_4338_5363 341
89 3300050508 nmdc:mga09592_241929_c1 nmdc:mga09592_241929_c1_198_1223 341
90 3300050508 nmdc:mga09592_67117_c1 nmdc:mga09592_67117_c1_376_1401 341
91 3300050509 nmdc:mga0qj67_11455_c1 nmdc:mga0qj67_11455_c1_2160_3185 341
92 3300050509 nmdc:mga0qj67_14675_c1 nmdc:mga0qj67_14675_c1_536_1612 341
93 3300050509 nmdc:mga0qj67_341873_c1 nmdc:mga0qj67_341873_c1_30_1055 341
94 3300050510 nmdc:mga06r32_11384_c1 nmdc:mga06r32_11384_c1_222_1298 341
95 3300050510 nmdc:mga06r32_22246_c1 nmdc:mga06r32_22246_c1_3321_4346 341
96 3300050510 nmdc:mga06r32_73362_c1 nmdc:mga06r32_73362_c1_99_1124 341
97 3300050511 nmdc:mga08y16_19421_c1 nmdc:mga08y16_19421_c1_1940_2965 341
98 3300050512 nmdc:mga0n895_14201_c1 nmdc:mga0n895_14201_c1_3103_4128 341
99 3300050512 nmdc:mga0n895_212762_c1 nmdc:mga0n895_212762_c1_19_1044 341
100 3300050513 nmdc:mga0rr50_15230_c1 nmdc:mga0rr50_15230_c1_2827_3852 341
101 3300050515 nmdc:mga0a205_5345_c1 nmdc:mga0a205_5345_c1_7876_8901 341
102 3300009094 Ga0111539_10001693 Ga0111539_1000169328 342
103 3300044712 Ga0453684_0377246 Ga0453684_0377246_187_1266 342
104 3300050512 nmdc:mga0n895_197695_c1 nmdc:mga0n895_197695_c1_287_1366 342
105 3300050515 nmdc:mga0a205_26940_c1 nmdc:mga0a205_26940_c1_1446_2537 342
106 3300005618 Ga0068864_100128262 Ga0068864_1001282623 347
107 3300049575 Ga0501039_0152677 Ga0501039_0152677_643_1722 350
108 3300049577 Ga0501041_0029519 Ga0501041_0029519_2174_3253 350
109 3300049580 Ga0501046_0112287 Ga0501046_0112287_295_1374 350
110 3300049587 Ga0501071_0086989 Ga0501071_0086989_1155_2234 350
111 3300049592 Ga0501076_0041425 Ga0501076_0041425_727_1806 350
112 3300049742 Ga0501080_0087287 Ga0501080_0087287_1713_2792 350
113 3300049743 Ga0501081_0164993 Ga0501081_0164993_475_1554 350
114 3300061734 Ga0530510_0116679 Ga0530510_0116679_709_1788 350
115 3300005549 Ga0070704_100090289 Ga0070704_1000902893 351
116 3300005617 Ga0068859_100547624 Ga0068859_1005476241 351
117 3300006844 Ga0075428_100009686 Ga0075428_10000968612 351
118 3300006847 Ga0075431_100016749 Ga0075431_10001674910 351
119 3300006880 Ga0075429_100003089 Ga0075429_1000030893 351
120 3300006931 Ga0097620_100547630 Ga0097620_1005476301 351
121 3300009094 Ga0111539_10030292 Ga0111539_100302923 351
122 3300009147 Ga0114129_10039602 Ga0114129_100396023 351
123 3300026116 Ga0207674_10239562 Ga0207674_102395622 351
124 3300050507 nmdc:mga05p37_503_c1 nmdc:mga05p37_503_c1_30745_31827 351
125 3300050508 nmdc:mga09592_5141_c1 nmdc:mga09592_5141_c1_7150_8232 351
126 3300050510 nmdc:mga06r32_35082_c1 nmdc:mga06r32_35082_c1_1310_2392 351
127 3300050510 nmdc:mga06r32_89647_c1 nmdc:mga06r32_89647_c1_992_2074 351
128 3300050511 nmdc:mga08y16_185763_c1 nmdc:mga08y16_185763_c1_193_1275 351
129 3300005471 Ga0070698_100042807 Ga0070698_1000428071 352
130 3300009147 Ga0114129_10292403 Ga0114129_102924032 353
131 3300005545 Ga0070695_100012905 Ga0070695_1000129054 357
132 3300005547 Ga0070693_100146810 Ga0070693_1001468102 357
133 3300005614 Ga0068856_100106739 Ga0068856_1001067393 357
134 3300006852 Ga0075433_10000500 Ga0075433_1000050014 357
135 3300006871 Ga0075434_100003449 Ga0075434_10000344913 357
136 3300006914 Ga0075436_100002996 Ga0075436_1000029966 357
137 3300007076 Ga0075435_100000047 Ga0075435_10000004734 357
138 3300009094 Ga0111539_10017117 Ga0111539_100171179 357
139 3300025942 Ga0207689_10377772 Ga0207689_103777721 357
140 3300025949 Ga0207667_10289484 Ga0207667_102894841 357
141 3300046539 Ga0495621_0060717 Ga0495621_0060717_44_1117 357
142 3300050511 nmdc:mga08y16_8586_c1 nmdc:mga08y16_8586_c1_7748_8821 357
143 3300050512 nmdc:mga0n895_1662_c1 nmdc:mga0n895_1662_c1_11800_12873 357
144 3300050513 nmdc:mga0rr50_359_c1 nmdc:mga0rr50_359_c1_2291_3364 357
145 3300050514 nmdc:mga08x19_1000_c1 nmdc:mga08x19_1000_c1_4001_5074 357
146 3300050515 nmdc:mga0a205_75_c1 nmdc:mga0a205_75_c1_395_1468 357
147 3300005444 Ga0070694_100019179 Ga0070694_1000191794 358
148 3300005444 Ga0070694_100202874 Ga0070694_1002028741 358
149 3300005467 Ga0070706_100364510 Ga0070706_1003645101 358
150 3300005471 Ga0070698_100165087 Ga0070698_1001650872 358
151 3300005518 Ga0070699_100008860 Ga0070699_1000088609 358
152 3300005518 Ga0070699_100013971 Ga0070699_1000139715 358
153 3300005536 Ga0070697_100215992 Ga0070697_1002159921 358
154 3300006852 Ga0075433_10004787 Ga0075433_100047873 358
155 3300006871 Ga0075434_100022012 Ga0075434_1000220122 358
156 3300006880 Ga0075429_100000259 Ga0075429_10000025920 358
157 3300006914 Ga0075436_100000428 Ga0075436_1000004285 358
158 3300006914 Ga0075436_100000874 Ga0075436_1000008743 358
159 3300007076 Ga0075435_100005084 Ga0075435_10000508411 358
160 3300007076 Ga0075435_100071354 Ga0075435_1000713542 358
161 3300009094 Ga0111539_10117642 Ga0111539_101176423 358
162 3300009098 Ga0105245_10050484 Ga0105245_100504845 358
163 3300009147 Ga0114129_10000430 Ga0114129_1000043029 358
164 3300009147 Ga0114129_10055532 Ga0114129_100555322 358
165 3300009148 Ga0105243_10000374 Ga0105243_1000037434 358
166 3300009176 Ga0105242_10000192 Ga0105242_1000019234 358
167 3300009553 Ga0105249_10122917 Ga0105249_101229172 358
168 3300014968 Ga0157379_10470163 Ga0157379_104701631 358
169 3300025912 Ga0207707_10263395 Ga0207707_102633952 358
170 3300026075 Ga0207708_10235093 Ga0207708_102350931 358
171 3300027907 Ga0207428_10000721 Ga0207428_1000072125 358
172 3300031731 Ga0307405_10242940 Ga0307405_102429401 358
173 3300035089 Ga0373944_0010354 Ga0373944_0010354_1286_2362 358
174 3300035113 Ga0373936_0000959 Ga0373936_0000959_5040_6116 358
175 3300035114 Ga0373939_0001857 Ga0373939_0001857_615_1691 358
176 3300035171 Ga0373946_0006410 Ga0373946_0006410_458_1534 358
177 3300035207 Ga0373942_0006378 Ga0373942_0006378_1268_2344 358
178 3300035242 Ga0373962_0021994 Ga0373962_0021994_187_1263 358
179 3300035410 Ga0373924_0008820 Ga0373924_0008820_2134_3210 358
180 3300035692 Ga0373935_0011964 Ga0373935_0011964_123_1199 358
181 3300035695 Ga0373927_0082726 Ga0373927_0082726_834_1910 358
182 3300035725 Ga0373947_0067326 Ga0373947_0067326_202_1278 358
183 3300041496 Ga0451839_0456736 Ga0451839_0456736_149_1225 358
184 3300042156 Ga0439446_0005070 Ga0439446_0005070_1174_2250 358
185 3300042876 Ga0451577_0139457 Ga0451577_0139457_966_2156 358
186 3300045051 Ga0451576_0003101 Ga0451576_0003101_10068_11195 358
187 3300045051 Ga0451576_0024911 Ga0451576_0024911_2562_3638 358
188 3300045051 Ga0451576_0252735 Ga0451576_0252735_34_1110 358
189 3300045976 Ga0466967_0010071 Ga0466967_0010071_5298_6374 358
190 3300046455 Ga0495603_0044154 Ga0495603_0044154_385_1461 358
191 3300046472 Ga0495580_0004779 Ga0495580_0004779_7110_8186 358
192 3300046473 Ga0495582_0046060 Ga0495582_0046060_509_1585 358
193 3300046476 Ga0495662_0016646 Ga0495662_0016646_1156_2232 358
194 3300046517 Ga0495630_0046766 Ga0495630_0046766_962_2038 358
195 3300046517 Ga0495630_0130107 Ga0495630_0130107_787_1863 358
196 3300046526 Ga0495666_0008044 Ga0495666_0008044_3240_4316 358
197 3300046528 Ga0495642_0015060 Ga0495642_0015060_433_1509 358
198 3300046535 Ga0495586_0007966 Ga0495586_0007966_452_1528 358
199 3300046535 Ga0495586_0077795 Ga0495586_0077795_82_1158 358
200 3300046537 Ga0495598_0004441 Ga0495598_0004441_513_1589 358
201 3300046615 Ga0495656_0016044 Ga0495656_0016044_625_1701 358
202 3300046664 Ga0495659_0006510 Ga0495659_0006510_1274_2350 358
203 3300046674 Ga0495588_0046765 Ga0495588_0046765_184_1260 358
204 3300046681 Ga0495647_0001586 Ga0495647_0001586_5514_6590 358
205 3300046684 Ga0495669_0045474 Ga0495669_0045474_304_1380 358
206 3300047321 Ga0495676_0060585 Ga0495676_0060585_1483_2559 358
207 3300049582 Ga0501048_0199881 Ga0501048_0199881_79_1155 358
208 3300049588 Ga0501072_0053974 Ga0501072_0053974_1557_2633 358
209 3300049591 Ga0501075_0028294 Ga0501075_0028294_191_1267 358
210 3300049741 Ga0501079_0046826 Ga0501079_0046826_21_1097 358
211 3300049743 Ga0501081_0034418 Ga0501081_0034418_163_1239 358
212 3300049743 Ga0501081_0084412 Ga0501081_0084412_89_1165 358
213 3300050507 nmdc:mga05p37_1829_c1 nmdc:mga05p37_1829_c1_6916_7992 358
214 3300050508 nmdc:mga09592_665_c1 nmdc:mga09592_665_c1_7420_8496 358
215 3300050511 nmdc:mga08y16_14006_c1 nmdc:mga08y16_14006_c1_1933_3009 358
216 3300050511 nmdc:mga08y16_21631_c1 nmdc:mga08y16_21631_c1_1652_2728 358
217 3300050512 nmdc:mga0n895_216569_c1 nmdc:mga0n895_216569_c1_835_1911 358
218 3300050513 nmdc:mga0rr50_38092_c1 nmdc:mga0rr50_38092_c1_1390_2466 358
219 3300050513 nmdc:mga0rr50_67721_c1 nmdc:mga0rr50_67721_c1_612_1688 358
220 3300050514 nmdc:mga08x19_13829_c1 nmdc:mga08x19_13829_c1_688_1764 358
221 3300050514 nmdc:mga08x19_261_c1 nmdc:mga08x19_261_c1_5898_6974 358
222 3300050515 nmdc:mga0a205_16365_c1 nmdc:mga0a205_16365_c1_3488_4564 358
223 3300050515 nmdc:mga0a205_337085_c1 nmdc:mga0a205_337085_c1_20_1096 358
224 3300054114 Ga0501084_0208227 Ga0501084_0208227_219_1295 358
225 3300059426 Ga0590077_018466 Ga0590077_018466_307_1383 358
226 3300003347 JGI26128J50194_1000894 JGI26128J50194_10008941 359
227 3300003503 JGI26141J51220_1000826 JGI26141J51220_10008262 359
228 3300005293 Ga0065715_10114096 Ga0065715_101140962 359
229 3300005328 Ga0070676_10001199 Ga0070676_1000119914 359
230 3300005329 Ga0070683_100063983 Ga0070683_1000639833 359
231 3300005330 Ga0070690_100015226 Ga0070690_1000152262 359
232 3300005334 Ga0068869_100003166 Ga0068869_1000031663 359
233 3300005336 Ga0070680_100010180 Ga0070680_1000101802 359
234 3300005336 Ga0070680_100065485 Ga0070680_1000654852 359
235 3300005337 Ga0070682_100003456 Ga0070682_1000034567 359
236 3300005339 Ga0070660_100001484 Ga0070660_1000014843 359
237 3300005340 Ga0070689_100054730 Ga0070689_1000547302 359
238 3300005340 Ga0070689_100295474 Ga0070689_1002954742 359
239 3300005341 Ga0070691_10003669 Ga0070691_100036698 359
240 3300005341 Ga0070691_10008969 Ga0070691_100089693 359
241 3300005343 Ga0070687_100040762 Ga0070687_1000407622 359
242 3300005344 Ga0070661_100001482 Ga0070661_1000014823 359
243 3300005345 Ga0070692_10000237 Ga0070692_100002373 359
244 3300005353 Ga0070669_100157823 Ga0070669_1001578232 359
245 3300005366 Ga0070659_100001725 Ga0070659_1000017253 359
246 3300005367 Ga0070667_100054095 Ga0070667_1000540951 359
247 3300005438 Ga0070701_10098173 Ga0070701_100981731 359
248 3300005440 Ga0070705_100008127 Ga0070705_1000081273 359
249 3300005440 Ga0070705_100093941 Ga0070705_1000939412 359
250 3300005444 Ga0070694_100014905 Ga0070694_1000149054 359
251 3300005445 Ga0070708_100197938 Ga0070708_1001979381 359
252 3300005455 Ga0070663_100067992 Ga0070663_1000679921 359
253 3300005457 Ga0070662_100001423 Ga0070662_10000142310 359
254 3300005458 Ga0070681_10000525 Ga0070681_100005251 359
255 3300005458 Ga0070681_10040330 Ga0070681_100403303 359
256 3300005459 Ga0068867_100012689 Ga0068867_1000126893 359
257 3300005459 Ga0068867_100014336 Ga0068867_1000143363 359
258 3300005459 Ga0068867_100236697 Ga0068867_1002366972 359
259 3300005467 Ga0070706_100149877 Ga0070706_1001498772 359
260 3300005467 Ga0070706_100166342 Ga0070706_1001663422 359
261 3300005467 Ga0070706_100246353 Ga0070706_1002463531 359
262 3300005468 Ga0070707_100027164 Ga0070707_1000271644 359
263 3300005468 Ga0070707_100034501 Ga0070707_1000345012 359
264 3300005468 Ga0070707_100182361 Ga0070707_1001823612 359
265 3300005471 Ga0070698_100002031 Ga0070698_10000203127 359
266 3300005471 Ga0070698_100018091 Ga0070698_1000180915 359
267 3300005518 Ga0070699_100005247 Ga0070699_1000052472 359
268 3300005518 Ga0070699_100031566 Ga0070699_1000315663 359
269 3300005518 Ga0070699_100063401 Ga0070699_1000634011 359
270 3300005518 Ga0070699_100070352 Ga0070699_1000703523 359
271 3300005518 Ga0070699_100196508 Ga0070699_1001965082 359
272 3300005530 Ga0070679_100022523 Ga0070679_1000225235 359
273 3300005530 Ga0070679_100095686 Ga0070679_1000956863 359
274 3300005535 Ga0070684_100008881 Ga0070684_1000088816 359
275 3300005535 Ga0070684_100070340 Ga0070684_1000703402 359
276 3300005536 Ga0070697_100029077 Ga0070697_1000290775 359
277 3300005539 Ga0068853_100001823 Ga0068853_10000182316 359
278 3300005543 Ga0070672_100246796 Ga0070672_1002467962 359
279 3300005544 Ga0070686_100010212 Ga0070686_1000102122 359
280 3300005545 Ga0070695_100001651 Ga0070695_10000165113 359
281 3300005545 Ga0070695_100004303 Ga0070695_1000043037 359
282 3300005545 Ga0070695_100049167 Ga0070695_1000491672 359
283 3300005546 Ga0070696_100033450 Ga0070696_1000334503 359
284 3300005546 Ga0070696_100046429 Ga0070696_1000464294 359
285 3300005546 Ga0070696_100096985 Ga0070696_1000969852 359
286 3300005547 Ga0070693_100003873 Ga0070693_1000038733 359
287 3300005549 Ga0070704_100003341 Ga0070704_1000033418 359
288 3300005563 Ga0068855_100005123 Ga0068855_10000512318 359
289 3300005564 Ga0070664_100019414 Ga0070664_1000194143 359
290 3300005578 Ga0068854_100075964 Ga0068854_1000759643 359
291 3300005615 Ga0070702_100013212 Ga0070702_1000132121 359
292 3300005615 Ga0070702_100110666 Ga0070702_1001106662 359
293 3300005616 Ga0068852_100038813 Ga0068852_1000388134 359
294 3300005617 Ga0068859_100015807 Ga0068859_1000158076 359
295 3300005617 Ga0068859_100059404 Ga0068859_1000594043 359
296 3300005618 Ga0068864_100048082 Ga0068864_1000480822 359
297 3300005719 Ga0068861_100131639 Ga0068861_1001316392 359
298 3300005840 Ga0068870_10000437 Ga0068870_1000043714 359
299 3300005840 Ga0068870_10047180 Ga0068870_100471801 359
300 3300005842 Ga0068858_100012686 Ga0068858_1000126866 359
301 3300005843 Ga0068860_100057420 Ga0068860_1000574202 359
302 3300005843 Ga0068860_100139938 Ga0068860_1001399382 359
303 3300005843 Ga0068860_100370308 Ga0068860_1003703082 359
304 3300005844 Ga0068862_100002850 Ga0068862_10000285016 359
305 3300005844 Ga0068862_100015430 Ga0068862_1000154303 359
306 3300005844 Ga0068862_100481446 Ga0068862_1004814461 359
307 3300005983 Ga0081540_1061624 Ga0081540_10616242 359
308 3300005985 Ga0081539_10000462 Ga0081539_1000046223 359
309 3300006173 Ga0070716_100021860 Ga0070716_1000218603 359
310 3300006358 Ga0068871_100001863 Ga0068871_1000018637 359
311 3300006844 Ga0075428_100010456 Ga0075428_1000104567 359
312 3300006844 Ga0075428_100024711 Ga0075428_1000247118 359
313 3300006847 Ga0075431_100191257 Ga0075431_1001912571 359
314 3300006852 Ga0075433_10001084 Ga0075433_1000108421 359
315 3300006852 Ga0075433_10051178 Ga0075433_100511783 359
316 3300006871 Ga0075434_100068637 Ga0075434_1000686373 359
317 3300006880 Ga0075429_100077207 Ga0075429_1000772074 359
318 3300006880 Ga0075429_100164001 Ga0075429_1001640012 359
319 3300006880 Ga0075429_100273463 Ga0075429_1002734631 359
320 3300006881 Ga0068865_100142418 Ga0068865_1001424182 359
321 3300006914 Ga0075436_100007399 Ga0075436_1000073993 359
322 3300006914 Ga0075436_100038875 Ga0075436_1000388753 359
323 3300006931 Ga0097620_100015807 Ga0097620_1000158077 359
324 3300006931 Ga0097620_100059402 Ga0097620_1000594023 359
325 3300007076 Ga0075435_100016888 Ga0075435_1000168883 359
326 3300007076 Ga0075435_100019309 Ga0075435_1000193095 359
327 3300007076 Ga0075435_100032594 Ga0075435_1000325942 359
328 3300007265 Ga0099794_10002556 Ga0099794_100025566 359
329 3300007265 Ga0099794_10089567 Ga0099794_100895672 359
330 3300009094 Ga0111539_10009904 Ga0111539_1000990415 359
331 3300009098 Ga0105245_10027918 Ga0105245_100279181 359
332 3300009147 Ga0114129_10004826 Ga0114129_100048268 359
333 3300009147 Ga0114129_10088122 Ga0114129_100881223 359
334 3300009174 Ga0105241_10000133 Ga0105241_1000013342 359
335 3300009176 Ga0105242_10067713 Ga0105242_100677134 359
336 3300009176 Ga0105242_10388307 Ga0105242_103883071 359
337 3300009177 Ga0105248_10356588 Ga0105248_103565882 359
338 3300009545 Ga0105237_10207698 Ga0105237_102076982 359
339 3300009553 Ga0105249_10242318 Ga0105249_102423182 359
340 3300011119 Ga0105246_10297936 Ga0105246_102979361 359
341 3300013100 Ga0157373_10013951 Ga0157373_100139515 359
342 3300013102 Ga0157371_10085185 Ga0157371_100851852 359
343 3300013105 Ga0157369_10062664 Ga0157369_100626643 359
344 3300013307 Ga0157372_10006881 Ga0157372_1000688113 359
345 3300013307 Ga0157372_10037276 Ga0157372_100372762 359
346 3300013308 Ga0157375_10139004 Ga0157375_101390042 359
347 3300014969 Ga0157376_10033953 Ga0157376_100339532 359
348 3300025885 Ga0207653_10007379 Ga0207653_100073792 359
349 3300025901 Ga0207688_10008520 Ga0207688_100085206 359
350 3300025904 Ga0207647_10146962 Ga0207647_101469621 359
351 3300025906 Ga0207699_10127321 Ga0207699_101273211 359
352 3300025907 Ga0207645_10002226 Ga0207645_100022263 359
353 3300025908 Ga0207643_10001163 Ga0207643_1000116315 359
354 3300025910 Ga0207684_10001116 Ga0207684_1000111635 359
355 3300025910 Ga0207684_10040381 Ga0207684_100403813 359
356 3300025910 Ga0207684_10044522 Ga0207684_100445223 359
357 3300025910 Ga0207684_10069708 Ga0207684_100697083 359
358 3300025912 Ga0207707_10000556 Ga0207707_1000055616 359
359 3300025912 Ga0207707_10161410 Ga0207707_101614103 359
360 3300025914 Ga0207671_10115518 Ga0207671_101155182 359
361 3300025917 Ga0207660_10002844 Ga0207660_1000284413 359
362 3300025917 Ga0207660_10231122 Ga0207660_102311222 359
363 3300025918 Ga0207662_10060764 Ga0207662_100607642 359
364 3300025919 Ga0207657_10003869 Ga0207657_100038693 359
365 3300025920 Ga0207649_10005083 Ga0207649_100050836 359
366 3300025921 Ga0207652_10016524 Ga0207652_100165246 359
367 3300025921 Ga0207652_10110452 Ga0207652_101104522 359
368 3300025922 Ga0207646_10015141 Ga0207646_100151417 359
369 3300025922 Ga0207646_10075464 Ga0207646_100754644 359
370 3300025922 Ga0207646_10089324 Ga0207646_100893242 359
371 3300025922 Ga0207646_10113168 Ga0207646_101131682 359
372 3300025932 Ga0207690_10025096 Ga0207690_100250963 359
373 3300025933 Ga0207706_10045328 Ga0207706_100453283 359
374 3300025933 Ga0207706_10120940 Ga0207706_101209402 359
375 3300025935 Ga0207709_10032445 Ga0207709_100324453 359
376 3300025936 Ga0207670_10050653 Ga0207670_100506533 359
377 3300025942 Ga0207689_10001708 Ga0207689_100017083 359
378 3300025942 Ga0207689_10067886 Ga0207689_100678862 359
379 3300025944 Ga0207661_10083813 Ga0207661_100838133 359
380 3300025945 Ga0207679_10050632 Ga0207679_100506323 359
381 3300025949 Ga0207667_10005121 Ga0207667_1000512116 359
382 3300025960 Ga0207651_10103011 Ga0207651_101030111 359
383 3300025961 Ga0207712_10289797 Ga0207712_102897971 359
384 3300025981 Ga0207640_10284003 Ga0207640_102840032 359
385 3300025986 Ga0207658_10179278 Ga0207658_101792782 359
386 3300026035 Ga0207703_10012196 Ga0207703_100121966 359
387 3300026041 Ga0207639_10006287 Ga0207639_100062877 359
388 3300026067 Ga0207678_10021293 Ga0207678_100212936 359
389 3300026078 Ga0207702_10173553 Ga0207702_101735531 359
390 3300026089 Ga0207648_10064265 Ga0207648_100642654 359
391 3300026089 Ga0207648_10064672 Ga0207648_100646723 359
392 3300026089 Ga0207648_10066485 Ga0207648_100664853 359
393 3300026095 Ga0207676_10156850 Ga0207676_101568502 359
394 3300026116 Ga0207674_10005434 Ga0207674_1000543416 359
395 3300026116 Ga0207674_10008790 Ga0207674_1000879011 359
396 3300026118 Ga0207675_100018522 Ga0207675_1000185223 359
397 3300026142 Ga0207698_10264687 Ga0207698_102646872 359
398 3300027364 Ga0209967_1000731 Ga0209967_10007314 359
399 3300027378 Ga0209981_1001009 Ga0209981_10010094 359
400 3300027424 Ga0209984_1000948 Ga0209984_10009483 359
401 3300027471 Ga0209995_1002532 Ga0209995_10025322 359
402 3300027526 Ga0209968_1001882 Ga0209968_10018823 359
403 3300027543 Ga0209999_1000956 Ga0209999_10009563 359
404 3300027665 Ga0209983_1000928 Ga0209983_10009283 359
405 3300027671 Ga0209588_1044431 Ga0209588_10444312 359
406 3300027682 Ga0209971_1004436 Ga0209971_10044362 359
407 3300027695 Ga0209966_1000256 Ga0209966_100025617 359
408 3300027717 Ga0209998_10000070 Ga0209998_1000007039 359
409 3300027876 Ga0209974_10000099 Ga0209974_100000994 359
410 3300027907 Ga0207428_10000794 Ga0207428_100007948 359
411 3300027907 Ga0207428_10006425 Ga0207428_1000642511 359
412 3300028380 Ga0268265_10038678 Ga0268265_100386783 359
413 3300028381 Ga0268264_10042535 Ga0268264_100425353 359
414 3300028381 Ga0268264_10143371 Ga0268264_101433712 359
415 3300028381 Ga0268264_10149836 Ga0268264_101498362 359
416 3300031548 Ga0307408_100004301 Ga0307408_1000043013 359
417 3300031548 Ga0307408_100160785 Ga0307408_1001607853 359
418 3300031731 Ga0307405_10031779 Ga0307405_100317793 359
419 3300031911 Ga0307412_10222407 Ga0307412_102224072 359
420 3300032002 Ga0307416_100047136 Ga0307416_1000471362 359
421 3300032002 Ga0307416_100232448 Ga0307416_1002324482 359
422 3300034817 Ga0373948_0003581 Ga0373948_0003581_490_1569 359
423 3300035088 Ga0373940_0003844 Ga0373940_0003844_1947_3026 359
424 3300035172 Ga0373955_0012841 Ga0373955_0012841_1548_2627 359
425 3300035207 Ga0373942_0004845 Ga0373942_0004845_227_1306 359
426 3300035241 Ga0373961_0010146 Ga0373961_0010146_782_1861 359
427 3300035691 Ga0373931_0141349 Ga0373931_0141349_53_1138 359
428 3300035724 Ga0373933_0001569 Ga0373933_0001569_1253_2332 359
429 3300036401 Ga0373937_0001440 Ga0373937_0001440_11027_12106 359
430 3300037418 Ga0395900_0374052 Ga0395900_0374052_25_1104 359
431 3300039438 Ga0436360_1309494 Ga0436360_1309494_672_1751 359
432 3300041410 Ga0439461_0001446 Ga0439461_0001446_1136_2224 359
433 3300042001 Ga0439441_002359 Ga0439441_002359_1548_2627 359
434 3300042012 Ga0439455_0000404 Ga0439455_0000404_2614_3693 359
435 3300042435 Ga0439434_0007668 Ga0439434_0007668_225_1313 359
436 3300042438 Ga0439459_0001683 Ga0439459_0001683_1299_2378 359
437 3300042461 Ga0439460_0000467 Ga0439460_0000467_4269_5348 359
438 3300042876 Ga0451577_0030057 Ga0451577_0030057_2621_3709 359
439 3300042876 Ga0451577_0064436 Ga0451577_0064436_1421_2500 359
440 3300044673 Ga0453683_0038018 Ga0453683_0038018_1283_2371 359
441 3300044712 Ga0453684_0053783 Ga0453684_0053783_1858_2946 359
442 3300044712 Ga0453684_0187883 Ga0453684_0187883_991_2070 359
443 3300045051 Ga0451576_0014943 Ga0451576_0014943_1311_2390 359
444 3300045051 Ga0451576_0073051 Ga0451576_0073051_738_1817 359
445 3300045051 Ga0451576_0098988 Ga0451576_0098988_1085_2164 359
446 3300046472 Ga0495580_0031006 Ga0495580_0031006_290_1369 359
447 3300046684 Ga0495669_0074494 Ga0495669_0074494_458_1537 359
448 3300048905 Ga0496102_0049341 Ga0496102_0049341_464_1549 359
449 3300048905 Ga0496102_0084015 Ga0496102_0084015_1361_2440 359
450 3300048909 Ga0496106_0029604 Ga0496106_0029604_2512_3591 359
451 3300048909 Ga0496106_0164325 Ga0496106_0164325_365_1450 359
452 3300049568 Ga0501031_0042967 Ga0501031_0042967_572_1657 359
453 3300049570 Ga0501033_0215223 Ga0501033_0215223_141_1220 359
454 3300049570 Ga0501033_0292380 Ga0501033_0292380_42_1121 359
455 3300049572 Ga0501036_0061415 Ga0501036_0061415_846_1925 359
456 3300049572 Ga0501036_0120391 Ga0501036_0120391_133_1221 359
457 3300049572 Ga0501036_0211346 Ga0501036_0211346_527_1612 359
458 3300049572 Ga0501036_0291388 Ga0501036_0291388_12_1091 359
459 3300049573 Ga0501037_0019615 Ga0501037_0019615_3407_4486 359
460 3300049574 Ga0501038_0000401 Ga0501038_0000401_23883_24968 359
461 3300049574 Ga0501038_0029223 Ga0501038_0029223_182_1261 359
462 3300049575 Ga0501039_0001876 Ga0501039_0001876_4904_5989 359
463 3300049575 Ga0501039_0016881 Ga0501039_0016881_555_1640 359
464 3300049575 Ga0501039_0240421 Ga0501039_0240421_255_1334 359
465 3300049576 Ga0501040_0000653 Ga0501040_0000653_4026_5111 359
466 3300049576 Ga0501040_0018245 Ga0501040_0018245_97_1176 359
467 3300049576 Ga0501040_0039044 Ga0501040_0039044_1489_2568 359
468 3300049577 Ga0501041_0029253 Ga0501041_0029253_1207_2292 359
469 3300049577 Ga0501041_0040148 Ga0501041_0040148_1316_2395 359
470 3300049577 Ga0501041_0058507 Ga0501041_0058507_1031_2119 359
471 3300049577 Ga0501041_0166326 Ga0501041_0166326_277_1356 359
472 3300049578 Ga0501042_0000024 Ga0501042_0000024_43457_44542 359
473 3300049578 Ga0501042_0008169 Ga0501042_0008169_5630_6715 359
474 3300049578 Ga0501042_0008561 Ga0501042_0008561_4455_5534 359
475 3300049578 Ga0501042_0022252 Ga0501042_0022252_3169_4248 359
476 3300049578 Ga0501042_0038801 Ga0501042_0038801_2253_3332 359
477 3300049578 Ga0501042_0100646 Ga0501042_0100646_819_1898 359
478 3300049578 Ga0501042_0127340 Ga0501042_0127340_675_1763 359
479 3300049578 Ga0501042_0157118 Ga0501042_0157118_412_1497 359
480 3300049579 Ga0501043_0180170 Ga0501043_0180170_387_1466 359
481 3300049579 Ga0501043_0218129 Ga0501043_0218129_92_1177 359
482 3300049580 Ga0501046_0019373 Ga0501046_0019373_3096_4181 359
483 3300049580 Ga0501046_0026823 Ga0501046_0026823_3177_4262 359
484 3300049580 Ga0501046_0079126 Ga0501046_0079126_80_1168 359
485 3300049580 Ga0501046_0092413 Ga0501046_0092413_23_1108 359
486 3300049580 Ga0501046_0102816 Ga0501046_0102816_182_1261 359
487 3300049580 Ga0501046_0181946 Ga0501046_0181946_338_1417 359
488 3300049580 Ga0501046_0281945 Ga0501046_0281945_72_1151 359
489 3300049581 Ga0501047_0065762 Ga0501047_0065762_958_2037 359
490 3300049582 Ga0501048_0074683 Ga0501048_0074683_1160_2239 359
491 3300049582 Ga0501048_0083980 Ga0501048_0083980_950_2029 359
492 3300049582 Ga0501048_0235441 Ga0501048_0235441_96_1175 359
493 3300049584 Ga0501068_0004340 Ga0501068_0004340_3162_4241 359
494 3300049584 Ga0501068_0008331 Ga0501068_0008331_1242_2327 359
495 3300049584 Ga0501068_0062093 Ga0501068_0062093_283_1371 359
496 3300049584 Ga0501068_0154447 Ga0501068_0154447_290_1369 359
497 3300049585 Ga0501069_0046821 Ga0501069_0046821_1095_2252 359
498 3300049586 Ga0501070_0018693 Ga0501070_0018693_3788_4867 359
499 3300049586 Ga0501070_0250805 Ga0501070_0250805_222_1379 359
500 3300049587 Ga0501071_0000232 Ga0501071_0000232_3091_4176 359
501 3300049587 Ga0501071_0024558 Ga0501071_0024558_2599_3684 359
502 3300049587 Ga0501071_0028572 Ga0501071_0028572_36_1193 359
503 3300049587 Ga0501071_0071686 Ga0501071_0071686_430_1509 359
504 3300049588 Ga0501072_0000370 Ga0501072_0000370_18958_20043 359
505 3300049588 Ga0501072_0004162 Ga0501072_0004162_6405_7484 359
506 3300049588 Ga0501072_0015729 Ga0501072_0015729_1270_2355 359
507 3300049588 Ga0501072_0030484 Ga0501072_0030484_2140_3219 359
508 3300049588 Ga0501072_0031056 Ga0501072_0031056_441_1526 359
509 3300049588 Ga0501072_0053905 Ga0501072_0053905_1643_2728 359
510 3300049588 Ga0501072_0065072 Ga0501072_0065072_195_1274 359
511 3300049588 Ga0501072_0099823 Ga0501072_0099823_732_1811 359
512 3300049589 Ga0501073_0258382 Ga0501073_0258382_63_1142 359
513 3300049590 Ga0501074_0000394 Ga0501074_0000394_9507_10592 359
514 3300049590 Ga0501074_0032635 Ga0501074_0032635_84_1163 359
515 3300049590 Ga0501074_0066239 Ga0501074_0066239_118_1197 359
516 3300049591 Ga0501075_0000149 Ga0501075_0000149_25366_26451 359
517 3300049591 Ga0501075_0004311 Ga0501075_0004311_7656_8741 359
518 3300049591 Ga0501075_0007147 Ga0501075_0007147_164_1243 359
519 3300049591 Ga0501075_0202367 Ga0501075_0202367_363_1442 359
520 3300049592 Ga0501076_0000439 Ga0501076_0000439_18144_19229 359
521 3300049592 Ga0501076_0011961 Ga0501076_0011961_4057_5142 359
522 3300049592 Ga0501076_0049814 Ga0501076_0049814_163_1248 359
523 3300049592 Ga0501076_0076927 Ga0501076_0076927_339_1418 359
524 3300049592 Ga0501076_0094939 Ga0501076_0094939_603_1682 359
525 3300049592 Ga0501076_0104025 Ga0501076_0104025_137_1222 359
526 3300049593 Ga0501077_0000816 Ga0501077_0000816_8472_9557 359
527 3300049593 Ga0501077_0002050 Ga0501077_0002050_6570_7649 359
528 3300049593 Ga0501077_0007869 Ga0501077_0007869_912_2069 359
529 3300049593 Ga0501077_0036174 Ga0501077_0036174_1490_2569 359
530 3300049593 Ga0501077_0057739 Ga0501077_0057739_264_1349 359
531 3300049593 Ga0501077_0117814 Ga0501077_0117814_310_1398 359
532 3300049593 Ga0501077_0155896 Ga0501077_0155896_326_1405 359
533 3300049741 Ga0501079_0000446 Ga0501079_0000446_16094_17179 359
534 3300049741 Ga0501079_0001113 Ga0501079_0001113_16287_17366 359
535 3300049741 Ga0501079_0012858 Ga0501079_0012858_3008_4093 359
536 3300049741 Ga0501079_0022654 Ga0501079_0022654_1928_3085 359
537 3300049741 Ga0501079_0028656 Ga0501079_0028656_2622_3701 359
538 3300049741 Ga0501079_0046601 Ga0501079_0046601_2154_3233 359
539 3300049741 Ga0501079_0132011 Ga0501079_0132011_106_1185 359
540 3300049741 Ga0501079_0169389 Ga0501079_0169389_581_1669 359
541 3300049741 Ga0501079_0180845 Ga0501079_0180845_413_1492 359
542 3300049742 Ga0501080_0001577 Ga0501080_0001577_8400_9485 359
543 3300049742 Ga0501080_0075763 Ga0501080_0075763_717_1805 359
544 3300049742 Ga0501080_0088973 Ga0501080_0088973_1710_2789 359
545 3300049742 Ga0501080_0242657 Ga0501080_0242657_80_1159 359
546 3300049743 Ga0501081_0000028 Ga0501081_0000028_47555_48640 359
547 3300049743 Ga0501081_0000106 Ga0501081_0000106_8118_9197 359
548 3300049743 Ga0501081_0005345 Ga0501081_0005345_859_1947 359
549 3300049743 Ga0501081_0007059 Ga0501081_0007059_5176_6333 359
550 3300049743 Ga0501081_0013904 Ga0501081_0013904_1519_2604 359
551 3300049743 Ga0501081_0031757 Ga0501081_0031757_92_1171 359
552 3300049743 Ga0501081_0038501 Ga0501081_0038501_513_1598 359
553 3300049743 Ga0501081_0145869 Ga0501081_0145869_469_1548 359
554 3300049744 Ga0501083_0181252 Ga0501083_0181252_96_1175 359
555 3300049822 Ga0501035_0027904 Ga0501035_0027904_474_1553 359
556 3300049824 Ga0501045_0000638 Ga0501045_0000638_8506_9591 359
557 3300049824 Ga0501045_0005728 Ga0501045_0005728_3525_4682 359
558 3300049824 Ga0501045_0019214 Ga0501045_0019214_2831_3916 359
559 3300049824 Ga0501045_0019403 Ga0501045_0019403_2750_3829 359
560 3300049824 Ga0501045_0070859 Ga0501045_0070859_883_1968 359
561 3300049824 Ga0501045_0087471 Ga0501045_0087471_189_1268 359
562 3300050507 nmdc:mga05p37_21830_c1 nmdc:mga05p37_21830_c1_5726_6805 359
563 3300050507 nmdc:mga05p37_294_c1 nmdc:mga05p37_294_c1_44655_45740 359
564 3300050507 nmdc:mga05p37_53958_c1 nmdc:mga05p37_53958_c1_3730_4809 359
565 3300050507 nmdc:mga05p37_585385_c1 nmdc:mga05p37_585385_c1_148_1227 359
566 3300050507 nmdc:mga05p37_76679_c1 nmdc:mga05p37_76679_c1_1486_2565 359
567 3300050508 nmdc:mga09592_169697_c1 nmdc:mga09592_169697_c1_375_1454 359
568 3300050508 nmdc:mga09592_217838_c1 nmdc:mga09592_217838_c1_117_1199 359
569 3300050508 nmdc:mga09592_41545_c1 nmdc:mga09592_41545_c1_1401_2480 359
570 3300050510 nmdc:mga06r32_280039_c1 nmdc:mga06r32_280039_c1_544_1626 359
571 3300050511 nmdc:mga08y16_217486_c1 nmdc:mga08y16_217486_c1_635_1720 359
572 3300050511 nmdc:mga08y16_3197_c1 nmdc:mga08y16_3197_c1_12873_13952 359
573 3300050514 nmdc:mga08x19_11181_c1 nmdc:mga08x19_11181_c1_3002_4081 359
574 3300050514 nmdc:mga08x19_19389_c1 nmdc:mga08x19_19389_c1_495_1574 359
575 3300050514 nmdc:mga08x19_9220_c1 nmdc:mga08x19_9220_c1_3021_4100 359
576 3300054114 Ga0501084_0000525 Ga0501084_0000525_9409_10494 359
577 3300054114 Ga0501084_0008168 Ga0501084_0008168_7462_8550 359
578 3300054114 Ga0501084_0067064 Ga0501084_0067064_936_2015 359
579 3300054114 Ga0501084_0107357 Ga0501084_0107357_40_1119 359
580 3300060353 Ga0501082_0000626 Ga0501082_0000626_13823_14908 359
581 3300060353 Ga0501082_0001643 Ga0501082_0001643_320_1399 359
582 3300060353 Ga0501082_0022459 Ga0501082_0022459_1943_3028 359
583 3300060353 Ga0501082_0030033 Ga0501082_0030033_1052_2209 359
584 3300060353 Ga0501082_0041252 Ga0501082_0041252_2884_3963 359
585 3300060353 Ga0501082_0131080 Ga0501082_0131080_566_1651 359
586 3300061734 Ga0530510_0000071 Ga0530510_0000071_13554_14639 359
587 3300061734 Ga0530510_0000932 Ga0530510_0000932_14067_15152 359
588 3300061734 Ga0530510_0002497 Ga0530510_0002497_8124_9209 359
589 3300061734 Ga0530510_0009032 Ga0530510_0009032_5690_6769 359
590 3300061734 Ga0530510_0024049 Ga0530510_0024049_432_1511 359
591 3300061734 Ga0530510_0066451 Ga0530510_0066451_981_2060 359
592 3300061734 Ga0530510_0080163 Ga0530510_0080163_1147_2232 359
593 3300061734 Ga0530510_0152760 Ga0530510_0152760_405_1562 359

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

183

390

0.97

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

43

162

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hnc-assembly1.cif.gz_B p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid 0.9477 2 358
5xd8-assembly1.cif.gz_A crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase 0.946 2 359
3ck5-assembly2.cif.gz_D crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.9424 3 348
5xd7-assembly1.cif.gz_A-2 crystal structure analysis of 3,6-anhydro-l-galactonate cycloisomerase 0.9418 2 359
4hnc-assembly1.cif.gz_B p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid 0.9399 2 358
ID Description Score Start End Superfamily
3uxlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9373 118 348 3.20.20.120
3ck5D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9348 118 348 3.20.20.120
5xd9A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9298 117 348 3.20.20.120
4mggG01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9291 1 116 3.30.390.10
4h19A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9278 118 348 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A1P8Y012-F1-model_v4 deleted 0.9509 2 359
AF-A0A6B1EAD3-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9493 2 359 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A6N8YX23-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9482 2 359 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A848W4B3-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme N-terminal domain-containing protein 0.9478 1 167 GO:0000287
GO:0016052
GO:0016836
AF-A0A2K8QTU7-F1-model_v4 deleted 0.9459 122 316

Feature Viewer

pLDDT pTM Quality
94.67 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map