F467254

General Info

Members Datasets Scaffolds Average Seq Length
593 275 578 298

Family's Representative Sequence

Representative Sequence 3300042134|Ga0450898_015273|Ga0450898_015273_167_1195
Length 342
Sequence LGNKLEASQFLLWIFNLSRKSQTSYQSQVRQKKIKMSKVKSYLSLIKFSHTIFAMPFAMIGFSIAATNFNYLEPIYSNQEIDTNFKVFVLFLQDNLYIFFLIILCMVFARSAAMAFNRYLDRSFDAKNPRTAIREIPAGIIKANSVLLFTIVNCLLFIVCTFFINRLCFYLSPVALLVVLGYSYTKRFTPLCHLVLGLGLSLAPIGAYLAVTGQFSLLPILFSLAVIFWVSGFDIIYALQDEEFDKSQKLYSIPSWLGKTKALRVSELLHLLSAACVIIAGIYGGFGWLYWAGVAVFAGMLIYQHSIVKPTDLRKVNLAFMTANGIASVVFAIFVIADLFIN

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
7 2914759650 Rhizosphaericola mali Isolate Rhizosphere
8 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
9 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
10 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
11 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
12 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
13 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
25 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
33 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
34 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
39 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
40 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
41 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
45 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
46 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
107 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
109 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
110 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
112 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
113 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
115 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
176 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
177 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
178 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
193 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
194 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
195 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
250 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
254 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
256 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
257 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
260 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
261 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
262 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
263 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
266 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
267 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
268 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
271 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
272 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
275 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.47
Metatranscriptomes 0
Isolates 2.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.26
Nodule 0
Rhizoplane 0.17
Rhizosphere 86.34
Stem 0
Stem Tuber 0
Unclassified 5.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012057 3300001979 Bacteria 3267
2 JGI24740J21852_10047170 3300001979 Bacteria 1259
3 JGI24739J22299_10001623 3300001989 Bacteria 8535
4 JGI25154J39366_1000854 3300002738 Bacteria 13221
5 JGI25164J39214_1001693 3300002772 Bacteria 4482
6 JGI25406J46586_10000164 3300003203 Bacteria 29453
7 JGI25165J46597_1000157 3300003214 Bacteria 108987
8 JGI25153J46596_10014282 3300003215 Bacteria 3310
9 rootH1_10094382 3300003316 Bacteria 2833
10 rootH1_10146021 3300003316 Bacteria 1795
11 rootL2_10189602 3300003322 Bacteria 1723
12 rootL2_10237994 3300003322 Bacteria 2648
13 rootH1_10005105 3300003323 Bacteria 17579
14 rootH1_10005851 3300003323 Bacteria 85811
15 rootH1_10084867 3300003323 Bacteria 9308
16 rootH1_10331010 3300003323 Bacteria 1927
17 JGI25160J50197_1000890 3300003354 Bacteria 15723
18 JGI25160J50197_1007865 3300003354 Bacteria 4122
19 Ga0055528_1002738 3300003790 Bacteria 9236
20 Ga0065165_1000102 3300005262 Bacteria 140917
21 Ga0065712_10077630 3300005290 Bacteria 3464
22 Ga0065712_10080611 3300005290 Bacteria 3086
23 Ga0070658_10000028 3300005327 Bacteria 157278
24 Ga0070676_10000729 3300005328 Bacteria 16102
25 Ga0070676_10009111 3300005328 Bacteria 5368
26 Ga0070676_10012764 3300005328 Bacteria 4595
27 Ga0070683_100002830 3300005329 Bacteria 13887
28 Ga0070683_100015680 3300005329 Bacteria 6663
29 Ga0070690_100144798 3300005330 Bacteria 1616
30 Ga0070670_100116859 3300005331 Bacteria 2300
31 Ga0070670_100251970 3300005331 Bacteria 1538
32 Ga0070670_100299459 3300005331 Bacteria 1406
33 Ga0070670_100410780 3300005331 Bacteria 1196
34 Ga0070677_10150272 3300005333 Bacteria 1083
35 Ga0068869_100009985 3300005334 Bacteria 6173
36 Ga0068869_100022928 3300005334 Bacteria 4306
37 Ga0068869_100202084 3300005334 Bacteria 1567
38 Ga0070666_10000028 3300005335 Bacteria 144796
39 Ga0070666_10059242 3300005335 Bacteria 2590
40 Ga0070666_10074435 3300005335 Bacteria 2315
41 Ga0068868_100010912 3300005338 Bacteria 6593
42 Ga0068868_100067489 3300005338 Bacteria 2847
43 Ga0068868_100134398 3300005338 Bacteria 2026
44 Ga0068868_100273784 3300005338 Bacteria 1427
45 Ga0070660_100037380 3300005339 Bacteria 3681
46 Ga0070660_100069527 3300005339 Bacteria 2746
47 Ga0070689_100001483 3300005340 Bacteria 14964
48 Ga0070689_100023519 3300005340 Bacteria 4614
49 Ga0070689_100145605 3300005340 Bacteria 1908
50 Ga0070687_100034067 3300005343 Bacteria 2519
51 Ga0070687_100232966 3300005343 Unclassified 1134
52 Ga0070661_100035433 3300005344 Bacteria 3624
53 Ga0070668_100032760 3300005347 Bacteria 3954
54 Ga0070668_100055191 3300005347 Bacteria 3066
55 Ga0070668_100107943 3300005347 Bacteria 2213
56 Ga0070668_100123676 3300005347 Unclassified 2071
57 Ga0070669_100000458 3300005353 Bacteria 30951
58 Ga0070669_100026149 3300005353 Unclassified 4198
59 Ga0070675_100006330 3300005354 Bacteria 9088
60 Ga0070675_100040800 3300005354 Bacteria 3791
61 Ga0070675_100159481 3300005354 Bacteria 1939
62 Ga0070671_100040707 3300005355 Bacteria 3861
63 Ga0070674_100046398 3300005356 Bacteria 2972
64 Ga0070673_100006930 3300005364 Bacteria 7414
65 Ga0070673_100049130 3300005364 Bacteria 3292
66 Ga0070673_100062586 3300005364 Bacteria 2957
67 Ga0070688_100000687 3300005365 Bacteria 16799
68 Ga0070659_100032381 3300005366 Bacteria 4054
69 Ga0070659_100328670 3300005366 Bacteria 1279
70 Ga0070667_100024432 3300005367 Bacteria 5019
71 Ga0070667_100438707 3300005367 Unclassified 1192
72 Ga0070667_100466602 3300005367 Bacteria 1155
73 Ga0070701_10090655 3300005438 Bacteria 1674
74 Ga0070700_100105214 3300005441 Bacteria 1866
75 Ga0070663_100073442 3300005455 Bacteria 2495
76 Ga0070678_100059675 3300005456 Unclassified 2804
77 Ga0070678_100304090 3300005456 Bacteria 1356
78 Ga0070662_100000014 3300005457 Bacteria 110124
79 Ga0070662_100052770 3300005457 Bacteria 2941
80 Ga0070662_100066471 3300005457 Bacteria 2645
81 Ga0068867_100022159 3300005459 Bacteria 4539
82 Ga0068867_100055539 3300005459 Bacteria 2929
83 Ga0068867_100256346 3300005459 Bacteria 1424
84 Ga0070685_10004614 3300005466 Bacteria 6972
85 Ga0070685_10013580 3300005466 Bacteria 4298
86 Ga0070698_100000219 3300005471 Bacteria 56179
87 Ga0070698_100009802 3300005471 Bacteria 10239
88 Ga0070684_100014418 3300005535 Bacteria 6404
89 Ga0070684_100029225 3300005535 Bacteria 4669
90 Ga0070684_100073194 3300005535 Bacteria 3019
91 Ga0068853_100012013 3300005539 Bacteria 7044
92 Ga0068853_100062150 3300005539 Bacteria 3231
93 Ga0070672_100031816 3300005543 Bacteria 3976
94 Ga0070672_100053708 3300005543 Bacteria 3151
95 Ga0070672_100064678 3300005543 Bacteria 2890
96 Ga0070665_100000032 3300005548 Bacteria 333352
97 Ga0070665_100081886 3300005548 Bacteria 3233
98 Ga0070665_100135403 3300005548 Bacteria 2465
99 Ga0070665_100141395 3300005548 Bacteria 2410
100 Ga0068855_100000630 3300005563 Bacteria 43230
101 Ga0068855_100028766 3300005563 Bacteria 6649
102 Ga0068855_100032903 3300005563 Bacteria 6190
103 Ga0068855_100155847 3300005563 Bacteria 2595
104 Ga0070664_100006536 3300005564 Bacteria 9400
105 Ga0070664_100036214 3300005564 Bacteria 4146
106 Ga0070664_100325814 3300005564 Bacteria 1393
107 Ga0070664_100411541 3300005564 Unclassified 1238
108 Ga0068857_100005714 3300005577 Bacteria 10636
109 Ga0068857_100036767 3300005577 Bacteria 4338
110 Ga0068857_100089405 3300005577 Bacteria 2756
111 Ga0068857_100143953 3300005577 Unclassified 2156
112 Ga0068857_100161398 3300005577 Bacteria 2034
113 Ga0068857_100215645 3300005577 Bacteria 1752
114 Ga0068857_100231430 3300005577 Bacteria 1690
115 Ga0068856_100050531 3300005614 Bacteria 4099
116 Ga0068856_100060738 3300005614 Bacteria 3734
117 Ga0068856_100161078 3300005614 Unclassified 2254
118 Ga0068852_100004976 3300005616 Bacteria 9451
119 Ga0068852_100132110 3300005616 Bacteria 2300
120 Ga0068859_100000012 3300005617 Bacteria 300376
121 Ga0068859_100010347 3300005617 Bacteria 9388
122 Ga0068859_100026157 3300005617 Bacteria 5853
123 Ga0068859_100091356 3300005617 Bacteria 3095
124 Ga0068859_100127529 3300005617 Bacteria 2614
125 Ga0068864_100020745 3300005618 Bacteria 5499
126 Ga0068864_100121457 3300005618 Bacteria 2336
127 Ga0068861_100001813 3300005719 Bacteria 13764
128 Ga0068861_100011572 3300005719 Bacteria 6139
129 Ga0068861_100041855 3300005719 Bacteria 3433
130 Ga0068851_10000228 3300005834 Bacteria 27061
131 Ga0068863_100001512 3300005841 Bacteria 22973
132 Ga0068863_100002125 3300005841 Bacteria 19657
133 Ga0068863_100008194 3300005841 Bacteria 10212
134 Ga0068863_100020588 3300005841 Bacteria 6305
135 Ga0068863_100089381 3300005841 Bacteria 2920
136 Ga0068863_100325515 3300005841 Unclassified 1493
137 Ga0068860_100020290 3300005843 Bacteria 6437
138 Ga0068860_100078259 3300005843 Unclassified 3144
139 Ga0068860_100090144 3300005843 Bacteria 2920
140 Ga0068860_100091816 3300005843 Bacteria 2893
141 Ga0068862_100003547 3300005844 Bacteria 13375
142 Ga0068862_100107535 3300005844 Bacteria 2445
143 Ga0081539_10000042 3300005985 Bacteria 289955
144 Ga0070715_10091273 3300006163 Bacteria 1402
145 Ga0075366_10016453 3300006195 Bacteria 4252
146 Ga0075366_10115672 3300006195 Bacteria 1615
147 Ga0097621_100008782 3300006237 Bacteria 7302
148 Ga0097621_100028757 3300006237 Bacteria 4384
149 Ga0097621_100196360 3300006237 Unclassified 1750
150 Ga0068871_100017736 3300006358 Bacteria 5394
151 Ga0068871_100043176 3300006358 Bacteria 3622
152 Ga0068871_100050991 3300006358 Bacteria 3349
153 Ga0068871_100081188 3300006358 Bacteria 2686
154 Ga0068865_100002711 3300006881 Bacteria 10509
155 Ga0068865_100047650 3300006881 Unclassified 2946
156 Ga0068865_100063048 3300006881 Unclassified 2604
157 Ga0068865_100135461 3300006881 Unclassified 1850
158 Ga0068865_100376380 3300006881 Unclassified 1157
159 Ga0097620_100000012 3300006931 Bacteria 300376
160 Ga0097620_100010347 3300006931 Bacteria 9388
161 Ga0097620_100026156 3300006931 Bacteria 5853
162 Ga0097620_100091346 3300006931 Bacteria 3095
163 Ga0097620_100127525 3300006931 Bacteria 2614
164 Ga0105240_10002716 3300009093 Bacteria 28079
165 Ga0105240_10002823 3300009093 Bacteria 27474
166 Ga0105240_10018922 3300009093 Bacteria 9223
167 Ga0105240_10302673 3300009093 Bacteria 1829
168 Ga0111539_10006834 3300009094 Bacteria 14661
169 Ga0111539_10512566 3300009094 Bacteria 1397
170 Ga0105245_10638670 3300009098 Bacteria 1094
171 Ga0105247_10003345 3300009101 Bacteria 10493
172 Ga0105247_10008343 3300009101 Bacteria 6317
173 Ga0105241_10000619 3300009174 Bacteria 26737
174 Ga0105241_10002362 3300009174 Bacteria 14177
175 Ga0105241_10037436 3300009174 Bacteria 3655
176 Ga0105241_10360114 3300009174 Bacteria 1265
177 Ga0105241_10454688 3300009174 Bacteria 1133
178 Ga0105242_10008063 3300009176 Bacteria 8110
179 Ga0105242_10025765 3300009176 Bacteria 4658
180 Ga0105242_10500477 3300009176 Bacteria 1156
181 Ga0105237_10007560 3300009545 Bacteria 11876
182 Ga0105237_10009852 3300009545 Bacteria 10215
183 Ga0105237_10025455 3300009545 Bacteria 6051
184 Ga0105237_10027370 3300009545 Bacteria 5820
185 Ga0105237_10090081 3300009545 Bacteria 3057
186 Ga0105249_10002774 3300009553 Bacteria 15117
187 Ga0105249_10002929 3300009553 Bacteria 14722
188 Ga0105249_10022623 3300009553 Bacteria 5632
189 Ga0105249_10040052 3300009553 Bacteria 4255
190 Ga0105249_10049007 3300009553 Bacteria 3852
191 Ga0105249_10190631 3300009553 Bacteria 2001
192 Ga0105249_10355923 3300009553 Bacteria 1484
193 Ga0105249_10478935 3300009553 Bacteria 1287
194 Ga0105239_10000001 3300010375 Bacteria 617353
195 Ga0105239_10000007 3300010375 Bacteria 385297
196 Ga0105239_10008174 3300010375 Bacteria 11935
197 Ga0105239_10010863 3300010375 Bacteria 10172
198 Ga0105239_10015270 3300010375 Bacteria 8508
199 Ga0105239_10066806 3300010375 Bacteria 3950
200 Ga0105239_10303668 3300010375 Bacteria 1798
201 Ga0105239_10405650 3300010375 Bacteria 1543
202 Ga0105246_10009579 3300011119 Bacteria 5969
203 Ga0105246_10035275 3300011119 Bacteria 3342
204 Ga0105246_10230982 3300011119 Unclassified 1457
205 Ga0157373_10000245 3300013100 Bacteria 44563
206 Ga0157373_10003820 3300013100 Bacteria 11390
207 Ga0157373_10030765 3300013100 Bacteria 3862
208 Ga0157373_10073880 3300013100 Bacteria 2406
209 Ga0157371_10002946 3300013102 Bacteria 15852
210 Ga0157371_10005024 3300013102 Bacteria 11332
211 Ga0157371_10028051 3300013102 Bacteria 4079
212 Ga0157371_10132026 3300013102 Bacteria 1777
213 Ga0157371_10315454 3300013102 Unclassified 1134
214 Ga0157370_10033991 3300013104 Bacteria 4968
215 Ga0157369_10007184 3300013105 Bacteria 12833
216 Ga0157369_10095010 3300013105 Bacteria 3182
217 Ga0157369_10154347 3300013105 Bacteria 2426
218 Ga0157374_10040762 3300013296 Bacteria 4278
219 Ga0157374_10222550 3300013296 Bacteria 1852
220 Ga0157374_10290149 3300013296 Bacteria 1617
221 Ga0157378_10010275 3300013297 Bacteria 8174
222 Ga0157378_10045090 3300013297 Bacteria 3917
223 Ga0157378_10111593 3300013297 Bacteria 2507
224 Ga0157378_10247280 3300013297 Bacteria 1706
225 Ga0157378_10862054 3300013297 Bacteria 934
226 Ga0163162_10000010 3300013306 Bacteria 302032
227 Ga0163162_10000525 3300013306 Bacteria 35526
228 Ga0163162_10000634 3300013306 Bacteria 32545
229 Ga0163162_10032203 3300013306 Bacteria 5205
230 Ga0163162_10081200 3300013306 Bacteria 3312
231 Ga0163162_10083522 3300013306 Bacteria 3268
232 Ga0157372_10000073 3300013307 Bacteria 107356
233 Ga0157372_10000173 3300013307 Bacteria 71416
234 Ga0157372_10002062 3300013307 Bacteria 21839
235 Ga0157372_10023318 3300013307 Bacteria 6708
236 Ga0157372_10029574 3300013307 Bacteria 5984
237 Ga0157372_10039319 3300013307 Bacteria 5220
238 Ga0157372_10044826 3300013307 Bacteria 4902
239 Ga0157372_10114020 3300013307 Bacteria 3098
240 Ga0157372_10130862 3300013307 Bacteria 2887
241 Ga0157372_10177807 3300013307 Bacteria 2463
242 Ga0157372_10278540 3300013307 Unclassified 1944
243 Ga0157372_10357251 3300013307 Bacteria 1702
244 Ga0157372_10373763 3300013307 Bacteria 1661
245 Ga0157372_10375431 3300013307 Bacteria 1657
246 Ga0157372_10568942 3300013307 Bacteria 1321
247 Ga0157375_10006292 3300013308 Bacteria 10341
248 Ga0157375_10034238 3300013308 Bacteria 4837
249 Ga0157375_10656968 3300013308 Bacteria 1204
250 Ga0163163_10160409 3300014325 Bacteria 2294
251 Ga0157380_10000135 3300014326 Bacteria 41225
252 Ga0157380_10000252 3300014326 Bacteria 32093
253 Ga0157380_10013322 3300014326 Bacteria 5992
254 Ga0157380_10108658 3300014326 Bacteria 2325
255 Ga0157380_10166679 3300014326 Bacteria 1920
256 Ga0157377_10181738 3300014745 Bacteria 1323
257 Ga0157376_10054634 3300014969 Bacteria 3330
258 Ga0157376_10466205 3300014969 Unclassified 1235
259 Ga0157376_10793494 3300014969 Bacteria 959
260 Ga0163161_10011562 3300017792 Bacteria 6127
261 Ga0163161_10146495 3300017792 Unclassified 1791
262 Ga0213872_10009259 3300021361 Bacteria 4730
263 Ga0213876_10079875 3300021384 Bacteria 1729
264 Ga0209563_109961 3300025230 Bacteria 1413
265 Ga0207427_100025 3300025231 Bacteria 433726
266 Ga0209437_100010 3300025233 Bacteria 838447
267 Ga0209258_100293 3300025242 Bacteria 82199
268 Ga0209646_1000002 3300025246 Bacteria 1425781
269 Ga0209646_1005513 3300025246 Bacteria 2199
270 Ga0209026_1000430 3300025250 Bacteria 35017
271 Ga0209148_1000278 3300025254 Bacteria 79641
272 Ga0209233_1000017 3300025261 Bacteria 898076
273 Ga0209233_1005361 3300025261 Bacteria 4260
274 Ga0209673_1000530 3300025273 Bacteria 62542
275 Ga0209758_1000722 3300025297 Bacteria 48485
276 Ga0209758_1025593 3300025297 Bacteria 2583
277 Ga0209050_1000134 3300025298 Bacteria 184417
278 Ga0207426_1000051 3300025302 Bacteria 391700
279 Ga0207426_1000192 3300025302 Bacteria 151680
280 Ga0207426_1000357 3300025302 Bacteria 83200
281 Ga0207426_1001446 3300025302 Bacteria 19697
282 Ga0209257_1008115 3300025304 Bacteria 6098
283 Ga0207697_10010930 3300025315 Bacteria 3856
284 Ga0207656_10000115 3300025321 Bacteria 30785
285 Ga0207656_10061901 3300025321 Bacteria 1644
286 Ga0207642_10188108 3300025899 Bacteria 1131
287 Ga0207710_10004222 3300025900 Bacteria 6296
288 Ga0207710_10004223 3300025900 Bacteria 6296
289 Ga0207680_10000181 3300025903 Bacteria 30852
290 Ga0207680_10091314 3300025903 Bacteria 1937
291 Ga0207680_10103510 3300025903 Bacteria 1833
292 Ga0207647_10000680 3300025904 Bacteria 26722
293 Ga0207647_10002403 3300025904 Bacteria 14210
294 Ga0207647_10013369 3300025904 Bacteria 5693
295 Ga0207645_10011492 3300025907 Bacteria 6042
296 Ga0207645_10024200 3300025907 Bacteria 3939
297 Ga0207643_10034582 3300025908 Bacteria 2832
298 Ga0207705_10000045 3300025909 Bacteria 180625
299 Ga0207654_10000479 3300025911 Bacteria 22913
300 Ga0207654_10001057 3300025911 Bacteria 14992
301 Ga0207695_10000023 3300025913 Bacteria 657903
302 Ga0207695_10000110 3300025913 Bacteria 250079
303 Ga0207695_10000229 3300025913 Bacteria 149313
304 Ga0207695_10050039 3300025913 Bacteria 4399
305 Ga0207671_10004878 3300025914 Bacteria 12608
306 Ga0207671_10005924 3300025914 Bacteria 11082
307 Ga0207671_10008745 3300025914 Bacteria 8532
308 Ga0207671_10201532 3300025914 Bacteria 1554
309 Ga0207662_10106590 3300025918 Bacteria 1743
310 Ga0207657_10009277 3300025919 Bacteria 9911
311 Ga0207649_10017272 3300025920 Bacteria 4090
312 Ga0207652_10071364 3300025921 Bacteria 3017
313 Ga0207652_10276461 3300025921 Unclassified 1515
314 Ga0207681_10002677 3300025923 Bacteria 11289
315 Ga0207681_10061421 3300025923 Bacteria 2583
316 Ga0207650_10008262 3300025925 Bacteria 7107
317 Ga0207650_10061252 3300025925 Unclassified 2809
318 Ga0207650_10177608 3300025925 Bacteria 1695
319 Ga0207650_10202388 3300025925 Bacteria 1591
320 Ga0207659_10152396 3300025926 Bacteria 1806
321 Ga0207644_10036049 3300025931 Bacteria 3470
322 Ga0207644_10075505 3300025931 Bacteria 2477
323 Ga0207644_10088835 3300025931 Bacteria 2299
324 Ga0207690_10020483 3300025932 Bacteria 4088
325 Ga0207690_10287066 3300025932 Bacteria 1283
326 Ga0207690_10418320 3300025932 Bacteria 1072
327 Ga0207706_10000057 3300025933 Bacteria 112805
328 Ga0207706_10019199 3300025933 Bacteria 6147
329 Ga0207706_10095795 3300025933 Bacteria 2610
330 Ga0207709_10096299 3300025935 Bacteria 1946
331 Ga0207670_10014700 3300025936 Bacteria 4655
332 Ga0207669_10057787 3300025937 Bacteria 2363
333 Ga0207704_10000266 3300025938 Bacteria 25142
334 Ga0207704_10046645 3300025938 Bacteria 2584
335 Ga0207704_10142524 3300025938 Unclassified 1679
336 Ga0207704_10300724 3300025938 Unclassified 1229
337 Ga0207691_10065091 3300025940 Bacteria 3301
338 Ga0207689_10001630 3300025942 Bacteria 21256
339 Ga0207689_10016741 3300025942 Bacteria 6205
340 Ga0207689_10017184 3300025942 Bacteria 6123
341 Ga0207689_10099714 3300025942 Bacteria 2387
342 Ga0207689_10200020 3300025942 Bacteria 1649
343 Ga0207689_10325186 3300025942 Bacteria 1276
344 Ga0207661_10004033 3300025944 Bacteria 10260
345 Ga0207661_10014406 3300025944 Bacteria 5796
346 Ga0207679_10011383 3300025945 Bacteria 5758
347 Ga0207679_10049931 3300025945 Bacteria 3054
348 Ga0207667_10000700 3300025949 Bacteria 43461
349 Ga0207667_10002856 3300025949 Bacteria 21432
350 Ga0207667_10026481 3300025949 Bacteria 6335
351 Ga0207667_10060807 3300025949 Bacteria 3954
352 Ga0207667_10329976 3300025949 Bacteria 1558
353 Ga0207651_10020767 3300025960 Bacteria 3972
354 Ga0207651_10050980 3300025960 Bacteria 2814
355 Ga0207651_10189585 3300025960 Bacteria 1639
356 Ga0207712_10001140 3300025961 Bacteria 18539
357 Ga0207712_10007009 3300025961 Bacteria 7108
358 Ga0207712_10010175 3300025961 Bacteria 5964
359 Ga0207712_10014418 3300025961 Bacteria 5085
360 Ga0207712_10028607 3300025961 Bacteria 3729
361 Ga0207712_10094060 3300025961 Bacteria 2213
362 Ga0207668_10038829 3300025972 Bacteria 3199
363 Ga0207668_10133857 3300025972 Unclassified 1897
364 Ga0207668_10198597 3300025972 Unclassified 1595
365 Ga0207658_10161954 3300025986 Bacteria 1834
366 Ga0207677_10035102 3300026023 Bacteria 3253
367 Ga0207677_10088731 3300026023 Bacteria 2243
368 Ga0207677_10090880 3300026023 Unclassified 2219
369 Ga0207703_10110480 3300026035 Bacteria 2345
370 Ga0207639_10011707 3300026041 Bacteria 6100
371 Ga0207639_10097313 3300026041 Bacteria 2370
372 Ga0207639_10151736 3300026041 Bacteria 1941
373 Ga0207678_10237726 3300026067 Bacteria 1560
374 Ga0207708_10123788 3300026075 Bacteria 2017
375 Ga0207702_10042340 3300026078 Bacteria 3820
376 Ga0207641_10000152 3300026088 Bacteria 98311
377 Ga0207641_10003237 3300026088 Bacteria 14531
378 Ga0207641_10008689 3300026088 Bacteria 8388
379 Ga0207641_10023563 3300026088 Bacteria 5070
380 Ga0207641_10149241 3300026088 Unclassified 2116
381 Ga0207641_10155323 3300026088 Bacteria 2075
382 Ga0207648_10000404 3300026089 Bacteria 48036
383 Ga0207648_10014266 3300026089 Bacteria 7345
384 Ga0207648_10027693 3300026089 Bacteria 5029
385 Ga0207648_10066807 3300026089 Bacteria 3136
386 Ga0207648_10144184 3300026089 Bacteria 2100
387 Ga0207648_10197243 3300026089 Bacteria 1785
388 Ga0207648_10354571 3300026089 Bacteria 1323
389 Ga0207676_10033473 3300026095 Bacteria 3883
390 Ga0207676_10080309 3300026095 Bacteria 2647
391 Ga0207676_10236393 3300026095 Bacteria 1636
392 Ga0207674_10009665 3300026116 Bacteria 10998
393 Ga0207674_10011898 3300026116 Bacteria 9755
394 Ga0207674_10056447 3300026116 Bacteria 3988
395 Ga0207674_10104640 3300026116 Bacteria 2808
396 Ga0207674_10177425 3300026116 Bacteria 2083
397 Ga0207674_10190988 3300026116 Bacteria 1998
398 Ga0207674_10238025 3300026116 Bacteria 1767
399 Ga0207674_10251290 3300026116 Bacteria 1715
400 Ga0207675_100000386 3300026118 Bacteria 42305
401 Ga0207675_100004947 3300026118 Bacteria 12841
402 Ga0207675_100026071 3300026118 Bacteria 5441
403 Ga0207675_100197679 3300026118 Bacteria 1930
404 Ga0207675_100607314 3300026118 Bacteria 1097
405 Ga0207683_10004600 3300026121 Bacteria 11887
406 Ga0207683_10043009 3300026121 Bacteria 3946
407 Ga0207683_10175522 3300026121 Bacteria 1942
408 Ga0207698_10029764 3300026142 Bacteria 3916
409 Ga0207698_10363857 3300026142 Bacteria 1371
410 Ga0268266_10000030 3300028379 Bacteria 417120
411 Ga0268266_10090250 3300028379 Bacteria 2685
412 Ga0268266_10109970 3300028379 Bacteria 2441
413 Ga0268265_10007727 3300028380 Bacteria 7257
414 Ga0268265_10301420 3300028380 Bacteria 1443
415 Ga0268264_10026772 3300028381 Bacteria 4711
416 Ga0268264_10028632 3300028381 Bacteria 4559
417 Ga0268264_10117124 3300028381 Bacteria 2343
418 Ga0268264_10170976 3300028381 Bacteria 1965
419 Ga0307515_10000039 3300028794 Bacteria 323229
420 Ga0307511_10000285 3300030521 Bacteria 53256
421 Ga0265327_10002164 3300031251 Bacteria 21638
422 Ga0307509_10144234 3300031507 Bacteria 2310
423 Ga0307508_10002192 3300031616 Bacteria 20875
424 Ga0316576_10083107 3300031727 Bacteria 2378
425 Ga0316578_10022348 3300031728 Bacteria 3525
426 Ga0307518_10208569 3300031838 Unclassified 1289
427 Ga0307414_10171056 3300032004 Bacteria 1737
428 Ga0307510_10000464 3300033180 Bacteria 39482
429 Ga0373955_0004405 3300035172 Bacteria 6234
430 Ga0373924_0017738 3300035410 Bacteria 2735
431 Ga0373937_0015276 3300036401 Bacteria 6788
432 Ga0316584_0042115 3300036712 Bacteria 3405
433 Ga0373925_0339194 3300037068 Bacteria 1219
434 Ga0395899_0000887 3300037312 Bacteria 28407
435 Ga0395899_0004043 3300037312 Bacteria 11569
436 Ga0395899_0119608 3300037312 Bacteria 1888
437 Ga0395900_0000143 3300037418 Bacteria 120234
438 Ga0395900_0003189 3300037418 Bacteria 17771
439 Ga0395900_0105430 3300037418 Bacteria 2896
440 Ga0395898_0004789 3300037466 Bacteria 14725
441 Ga0395898_0189005 3300037466 Bacteria 1968
442 Ga0395905_0000175 3300037471 Bacteria 104024
443 Ga0395905_0000981 3300037471 Bacteria 36581
444 Ga0395905_0227325 3300037471 Unclassified 1745
445 Ga0395901_0000313 3300038443 Bacteria 59766
446 Ga0395901_0009480 3300038443 Bacteria 9877
447 Ga0395901_0147293 3300038443 Bacteria 2474
448 Ga0436361_1115729 3300039447 Bacteria 13860
449 Ga0451837_0762534 3300041494 Unclassified 2619
450 Ga0451853_0081640 3300041512 Bacteria 1329
451 Ga0439457_023061 3300042014 Bacteria 1378
452 Ga0450898_015273 3300042134 Bacteria 1299
453 Ga0439434_0029289 3300042435 Bacteria 1669
454 Ga0451577_0088151 3300042876 Unclassified 2769
455 Ga0466969_0000182 3300044656 Bacteria 33828
456 Ga0466972_0000003 3300044658 Bacteria 391452
457 Ga0466972_0000013 3300044658 Bacteria 229345
458 Ga0466965_0198973 3300044683 Unclassified 1062
459 Ga0466966_0002356 3300044684 Bacteria 12337
460 Ga0466966_0071544 3300044684 Bacteria 2172
461 Ga0466961_0095976 3300044693 Bacteria 1870
462 Ga0466964_0016991 3300044706 Bacteria 2783
463 Ga0453684_0004060 3300044712 Bacteria 31814
464 Ga0453684_0005399 3300044712 Bacteria 25364
465 Ga0453684_0141745 3300044712 Bacteria 2869
466 Ga0453684_0230449 3300044712 Unclassified 2139
467 Ga0453684_0254329 3300044712 Bacteria 2016
468 Ga0466968_0153968 3300044735 Bacteria 1058
469 Ga0466970_0005282 3300044765 Bacteria 6398
470 Ga0466957_0001773 3300044842 Bacteria 11362
471 Ga0466957_0113787 3300044842 Bacteria 1718
472 Ga0466959_0000056 3300045049 Bacteria 78465
473 Ga0466959_0111453 3300045049 Bacteria 1952
474 Ga0451576_0000012 3300045051 Bacteria 674684
475 Ga0466958_0236806 3300045836 Bacteria 1166
476 Ga0495592_0140550 3300046454 Bacteria 1680
477 Ga0495664_0099743 3300046477 Bacteria 1749
478 Ga0495608_0141373 3300046511 Bacteria 1536
479 Ga0495628_0027799 3300046516 Bacteria 4597
480 Ga0495630_0013657 3300046517 Bacteria 5904
481 Ga0495652_0162406 3300046529 Bacteria 1733
482 Ga0495587_0042287 3300046536 Bacteria 2718
483 Ga0495621_0041787 3300046539 Bacteria 1611
484 Ga0495633_0000080 3300046558 Bacteria 127703
485 Ga0495668_0023884 3300046616 Bacteria 3481
486 Ga0495634_0072456 3300046642 Unclassified 2266
487 Ga0495625_0004040 3300046660 Bacteria 14024
488 Ga0495599_0288327 3300046678 Bacteria 993
489 Ga0495671_0124395 3300046692 Bacteria 1258
490 Ga0495649_0019673 3300046694 Bacteria 3792
491 Ga0495674_0093062 3300047319 Bacteria 2573
492 Ga0495674_0107419 3300047319 Bacteria 2369
493 Ga0495672_0018813 3300047320 Bacteria 4574
494 Ga0495687_004330 3300047443 Bacteria 9657
495 Ga0495675_0194676 3300047444 Bacteria 1236
496 Ga0495684_0094041 3300047471 Bacteria 2270
497 Ga0495686_0007656 3300047472 Bacteria 8063
498 Ga0495686_0011435 3300047472 Bacteria 6253
499 Ga0496114_0514427 3300048917 Bacteria 1059
500 Ga0496124_0047285 3300048927 Bacteria 3682
501 Ga0501031_0127387 3300049568 Unclassified 1663
502 Ga0501032_0005376 3300049569 Bacteria 9530
503 Ga0501032_0041615 3300049569 Bacteria 3119
504 Ga0501032_0042130 3300049569 Bacteria 3098
505 Ga0501033_0040428 3300049570 Bacteria 3481
506 Ga0501033_0287672 3300049570 Unclassified 1159
507 Ga0501034_0004706 3300049571 Bacteria 15108
508 Ga0501034_0018970 3300049571 Bacteria 7047
509 Ga0501034_0022065 3300049571 Bacteria 6486
510 Ga0501034_0321090 3300049571 Bacteria 1481
511 Ga0501036_0002360 3300049572 Bacteria 14767
512 Ga0501036_0018399 3300049572 Bacteria 5853
513 Ga0501036_0188423 3300049572 Bacteria 1736
514 Ga0501037_0003684 3300049573 Bacteria 11123
515 Ga0501037_0014879 3300049573 Bacteria 5724
516 Ga0501037_0048933 3300049573 Bacteria 3096
517 Ga0501038_0012074 3300049574 Bacteria 7888
518 Ga0501038_0032386 3300049574 Bacteria 4612
519 Ga0501038_0097094 3300049574 Bacteria 2458
520 Ga0501039_0028824 3300049575 Bacteria 4275
521 Ga0501039_0042830 3300049575 Bacteria 3497
522 Ga0501039_0308670 3300049575 Bacteria 1243
523 Ga0501043_0004323 3300049579 Bacteria 11567
524 Ga0501043_0012478 3300049579 Bacteria 6647
525 Ga0501043_0014705 3300049579 Bacteria 6126
526 Ga0501046_0006183 3300049580 Bacteria 10632
527 Ga0501047_0007787 3300049581 Bacteria 10089
528 Ga0501047_0017174 3300049581 Bacteria 6926
529 Ga0501047_0083492 3300049581 Bacteria 3070
530 Ga0501047_0167800 3300049581 Bacteria 2065
531 Ga0501047_0400677 3300049581 Bacteria 1205
532 Ga0501048_0026224 3300049582 Bacteria 4243
533 Ga0501070_0019278 3300049586 Bacteria 5721
534 Ga0501073_0068425 3300049589 Bacteria 2474
535 Ga0501074_0000275 3300049590 Bacteria 29532
536 Ga0501243_003969 3300049675 Bacteria 2209
537 Ga0501257_011356 3300049686 Bacteria 2033
538 Ga0501080_0021404 3300049742 Bacteria 5985
539 Ga0501083_0002224 3300049744 Bacteria 13260
540 Ga0501241_000441 3300049758 Bacteria 9053
541 Ga0501035_0031508 3300049822 Bacteria 4828
542 Ga0501035_0035350 3300049822 Bacteria 4535
543 Ga0501035_0059764 3300049822 Bacteria 3395
544 Ga0501035_0381642 3300049822 Bacteria 1175
545 Ga0501044_0014310 3300049823 Bacteria 8564
546 Ga0501044_0025041 3300049823 Bacteria 6328
547 Ga0501044_0067462 3300049823 Bacteria 3645
548 Ga0501044_0141292 3300049823 Bacteria 2396
549 Ga0501044_0225128 3300049823 Bacteria 1825
550 Ga0501044_0579291 3300049823 Bacteria 1017
551 Ga0501044_0664285 3300049823 Bacteria 930
552 Ga0501284_00052 3300050005 Bacteria 43054
553 nmdc:mga0k408_15582_c1 3300050493 Bacteria 4204
554 nmdc:mga0k408_226674_c1 3300050493 Bacteria 1116
555 nmdc:mga0k408_78941_c1 3300050493 Bacteria 1926
556 nmdc:mga08y16_12116_c1 3300050511 Bacteria 9062
557 Ga0500635_0000819 3300053080 Bacteria 7670
558 Ga0500578_0000150 3300053086 Bacteria 83541
559 Ga0500578_0010134 3300053086 Bacteria 6111
560 Ga0500644_0000119 3300053088 Bacteria 49309
561 Ga0500644_0072621 3300053088 Bacteria 1244
562 Ga0500646_0015895 3300053090 Bacteria 1962
563 Ga0500583_0000144 3300053092 Bacteria 30151
564 Ga0500583_0016005 3300053092 Bacteria 2983
565 Ga0500651_0024279 3300053093 Bacteria 3800
566 Ga0500651_0156572 3300053093 Bacteria 1365
567 Ga0500650_0201721 3300053098 Bacteria 906
568 Ga0500555_016759 3300053103 Bacteria 2112
569 Ga0500562_000062 3300053108 Bacteria 53042
570 Ga0500569_000060 3300053109 Bacteria 19362
571 Ga0500568_0001093 3300053139 Bacteria 18245
572 Ga0500622_0000299 3300053156 Bacteria 50784
573 Ga0500622_0000337 3300053156 Bacteria 46048
574 Ga0500622_0061631 3300053156 Bacteria 1912
575 Ga0500633_0000661 3300053160 Bacteria 5758
576 Ga0500661_001888 3300055283 Bacteria 3958
577 Ga0500661_009181 3300055283 Bacteria 1814
578 Ga0466962_0061279 3300061719 Bacteria 1796

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025913 Ga0207695_10050039 Ga0207695_100500392 222
2 3300005366 Ga0070659_100328670 Ga0070659_1003286702 228
3 3300005539 Ga0068853_100062150 Ga0068853_1000621503 228
4 3300005548 Ga0070665_100000032 Ga0070665_100000032202 228
5 3300025932 Ga0207690_10418320 Ga0207690_104183201 228
6 3300026041 Ga0207639_10011707 Ga0207639_100117072 228
7 3300028379 Ga0268266_10000030 Ga0268266_10000030128 228
8 3300053098 Ga0500650_0201721 Ga0500650_0201721_29_751 228
9 3300005328 Ga0070676_10000729 Ga0070676_1000072916 230
10 3300005338 Ga0068868_100067489 Ga0068868_1000674892 230
11 3300006237 Ga0097621_100008782 Ga0097621_1000087825 230
12 3300006358 Ga0068871_100050991 Ga0068871_1000509913 230
13 3300017792 Ga0163161_10146495 Ga0163161_101464952 230
14 3300026023 Ga0207677_10035102 Ga0207677_100351022 230
15 3300046529 Ga0495652_0162406 Ga0495652_0162406_65_877 232
16 3300006163 Ga0070715_10091273 Ga0070715_100912732 237
17 3300003316 rootH1_10094382 rootH1_100943823 238
18 3300013307 Ga0157372_10568942 Ga0157372_105689422 238
19 3300046477 Ga0495664_0099743 Ga0495664_0099743_407_1372 238
20 3300005456 Ga0070678_100304090 Ga0070678_1003040902 239
21 3300005719 Ga0068861_100001813 Ga0068861_1000018132 239
22 3300013100 Ga0157373_10073880 Ga0157373_100738802 239
23 3300013308 Ga0157375_10656968 Ga0157375_106569681 239
24 3300026095 Ga0207676_10080309 Ga0207676_100803094 239
25 3300026121 Ga0207683_10175522 Ga0207683_101755222 239
26 3300046642 Ga0495634_0072456 Ga0495634_0072456_1094_2062 239
27 3300047319 Ga0495674_0093062 Ga0495674_0093062_266_1234 239
28 3300050493 nmdc:mga0k408_78941_c1 nmdc:mga0k408_78941_c1_267_1199 239
29 3300025903 Ga0207680_10091314 Ga0207680_100913141 240
30 3300025932 Ga0207690_10287066 Ga0207690_102870662 240
31 3300026089 Ga0207648_10197243 Ga0207648_101972431 240
32 3300005333 Ga0070677_10150272 Ga0070677_101502721 241
33 3300026089 Ga0207648_10354571 Ga0207648_103545711 241
34 3300037471 Ga0395905_0227325 Ga0395905_0227325_823_1716 241
35 3300003203 JGI25406J46586_10000164 JGI25406J46586_100001648 242
36 3300005563 Ga0068855_100028766 Ga0068855_1000287665 242
37 3300005614 Ga0068856_100050531 Ga0068856_1000505315 242
38 3300005985 Ga0081539_10000042 Ga0081539_10000042168 242
39 3300009174 Ga0105241_10037436 Ga0105241_100374364 242
40 3300009545 Ga0105237_10027370 Ga0105237_100273702 242
41 3300025914 Ga0207671_10201532 Ga0207671_102015322 242
42 3300025949 Ga0207667_10026481 Ga0207667_100264812 242
43 3300044656 Ga0466969_0000182 Ga0466969_0000182_23517_24443 242
44 3300044684 Ga0466966_0002356 Ga0466966_0002356_3671_4597 242
45 3300044706 Ga0466964_0016991 Ga0466964_0016991_775_1713 242
46 3300044735 Ga0466968_0153968 Ga0466968_0153968_91_1029 242
47 3300045049 Ga0466959_0000056 Ga0466959_0000056_39458_40384 242
48 3300005471 Ga0070698_100000219 Ga0070698_10000021952 243
49 3300009101 Ga0105247_10008343 Ga0105247_100083433 243
50 3300009545 Ga0105237_10007560 Ga0105237_1000756014 243
51 3300009553 Ga0105249_10022623 Ga0105249_100226237 243
52 3300010375 Ga0105239_10010863 Ga0105239_1001086310 243
53 3300010375 Ga0105239_10303668 Ga0105239_103036682 243
54 3300011119 Ga0105246_10009579 Ga0105246_100095792 243
55 3300013296 Ga0157374_10040762 Ga0157374_100407622 243
56 3300013296 Ga0157374_10222550 Ga0157374_102225503 243
57 3300013296 Ga0157374_10290149 Ga0157374_102901492 243
58 3300013307 Ga0157372_10177807 Ga0157372_101778074 243
59 3300005577 Ga0068857_100161398 Ga0068857_1001613983 244
60 3300013306 Ga0163162_10000525 Ga0163162_1000052533 244
61 3300026116 Ga0207674_10177425 Ga0207674_101774252 244
62 3300005329 Ga0070683_100002830 Ga0070683_10000283013 246
63 3300005344 Ga0070661_100035433 Ga0070661_1000354333 246
64 3300005354 Ga0070675_100159481 Ga0070675_1001594812 246
65 3300005366 Ga0070659_100032381 Ga0070659_1000323811 246
66 3300005471 Ga0070698_100009802 Ga0070698_1000098024 246
67 3300005535 Ga0070684_100029225 Ga0070684_1000292253 246
68 3300005539 Ga0068853_100012013 Ga0068853_1000120134 246
69 3300005564 Ga0070664_100006536 Ga0070664_1000065362 246
70 3300005577 Ga0068857_100005714 Ga0068857_10000571410 246
71 3300009174 Ga0105241_10454688 Ga0105241_104546881 246
72 3300013297 Ga0157378_10862054 Ga0157378_108620541 246
73 3300025920 Ga0207649_10017272 Ga0207649_100172723 246
74 3300025944 Ga0207661_10004033 Ga0207661_1000403310 246
75 3300025945 Ga0207679_10049931 Ga0207679_100499312 246
76 3300026116 Ga0207674_10009665 Ga0207674_1000966510 246
77 3300046692 Ga0495671_0124395 Ga0495671_0124395_201_1163 246
78 3300005841 Ga0068863_100020588 Ga0068863_1000205885 247
79 3300026088 Ga0207641_10003237 Ga0207641_100032372 247
80 3300049581 Ga0501047_0400677 Ga0501047_0400677_305_1195 247
81 3300003322 rootL2_10237994 rootL2_102379943 248
82 3300050493 nmdc:mga0k408_226674_c1 nmdc:mga0k408_226674_c1_24_986 248
83 3300046678 Ga0495599_0288327 Ga0495599_0288327_48_938 249
84 3300009101 Ga0105247_10003345 Ga0105247_1000334511 250
85 3300013297 Ga0157378_10045090 Ga0157378_100450904 250
86 3300014326 Ga0157380_10013322 Ga0157380_100133225 250
87 3300025900 Ga0207710_10004223 Ga0207710_100042237 250
88 3300026041 Ga0207639_10097313 Ga0207639_100973132 250
89 3300026118 Ga0207675_100197679 Ga0207675_1001976793 250
90 3300026121 Ga0207683_10043009 Ga0207683_100430092 250
91 3300053088 Ga0500644_0072621 Ga0500644_0072621_53_988 250
92 3300053103 Ga0500555_016759 Ga0500555_016759_270_1205 250
93 3300005548 Ga0070665_100135403 Ga0070665_1001354032 251
94 3300025907 Ga0207645_10024200 Ga0207645_100242003 251
95 3300028379 Ga0268266_10090250 Ga0268266_100902503 251
96 3300046660 Ga0495625_0004040 Ga0495625_0004040_12032_12895 251
97 3300049571 Ga0501034_0022065 Ga0501034_0022065_793_1740 251
98 3300005331 Ga0070670_100299459 Ga0070670_1002994591 252
99 3300014745 Ga0157377_10181738 Ga0157377_101817382 252
100 3300025945 Ga0207679_10011383 Ga0207679_100113835 252
101 3300049571 Ga0501034_0018970 Ga0501034_0018970_3818_4759 252
102 3300049822 Ga0501035_0059764 Ga0501035_0059764_905_1846 252
103 3300049823 Ga0501044_0067462 Ga0501044_0067462_411_1352 252
104 3300005331 Ga0070670_100410780 Ga0070670_1004107801 253
105 3300005618 Ga0068864_100121457 Ga0068864_1001214573 253
106 3300025925 Ga0207650_10008262 Ga0207650_100082625 253
107 3300025925 Ga0207650_10202388 Ga0207650_102023882 253
108 3300026095 Ga0207676_10033473 Ga0207676_100334732 253
109 3300053093 Ga0500651_0156572 Ga0500651_0156572_14_991 253
110 3300053139 Ga0500568_0001093 Ga0500568_0001093_1438_2424 253
111 3300005339 Ga0070660_100069527 Ga0070660_1000695273 254
112 3300009545 Ga0105237_10090081 Ga0105237_100900813 254
113 3300013102 Ga0157371_10315454 Ga0157371_103154541 254
114 3300013307 Ga0157372_10039319 Ga0157372_100393195 254
115 3300013307 Ga0157372_10114020 Ga0157372_101140204 255
116 3300025904 Ga0207647_10002403 Ga0207647_100024035 255
117 3300025932 Ga0207690_10020483 Ga0207690_100204835 255
118 3300028794 Ga0307515_10000039 Ga0307515_10000039147 255
119 3300045836 Ga0466958_0236806 Ga0466958_0236806_14_826 255
120 3300005335 Ga0070666_10074435 Ga0070666_100744352 256
121 3300005367 Ga0070667_100466602 Ga0070667_1004666021 256
122 3300005457 Ga0070662_100066471 Ga0070662_1000664713 256
123 3300005459 Ga0068867_100256346 Ga0068867_1002563462 256
124 3300005466 Ga0070685_10013580 Ga0070685_100135805 256
125 3300005548 Ga0070665_100141395 Ga0070665_1001413953 256
126 3300005564 Ga0070664_100036214 Ga0070664_1000362145 256
127 3300005617 Ga0068859_100026157 Ga0068859_1000261574 256
128 3300006237 Ga0097621_100028757 Ga0097621_1000287573 256
129 3300006931 Ga0097620_100026156 Ga0097620_1000261564 256
130 3300009553 Ga0105249_10002774 Ga0105249_100027746 256
131 3300009553 Ga0105249_10478935 Ga0105249_104789351 256
132 3300010375 Ga0105239_10000001 Ga0105239_10000001290 256
133 3300010375 Ga0105239_10066806 Ga0105239_100668063 256
134 3300013306 Ga0163162_10032203 Ga0163162_100322032 256
135 3300025933 Ga0207706_10095795 Ga0207706_100957951 256
136 3300025961 Ga0207712_10007009 Ga0207712_100070092 256
137 3300028379 Ga0268266_10109970 Ga0268266_101099703 256
138 3300050493 nmdc:mga0k408_15582_c1 nmdc:mga0k408_15582_c1_2414_3250 256
139 3300005331 Ga0070670_100251970 Ga0070670_1002519702 257
140 3300003322 rootL2_10189602 rootL2_101896023 258
141 3300005367 Ga0070667_100024432 Ga0070667_1000244322 258
142 3300005843 Ga0068860_100020290 Ga0068860_1000202906 258
143 3300006358 Ga0068871_100017736 Ga0068871_1000177364 258
144 3300009176 Ga0105242_10025765 Ga0105242_100257652 258
145 3300026067 Ga0207678_10237726 Ga0207678_102377262 258
146 3300028381 Ga0268264_10028632 Ga0268264_100286324 258
147 3300033180 Ga0307510_10000464 Ga0307510_1000046435 258
148 3300044712 Ga0453684_0004060 Ga0453684_0004060_17968_18837 258
149 iso_pu_bacteria 2738541278 2738726443 258
150 iso_pu_bacteria 2914759650 2914760332 258
151 3300003323 rootH1_10005105 rootH1_100051058 259
152 3300005328 Ga0070676_10012764 Ga0070676_100127642 259
153 3300005330 Ga0070690_100144798 Ga0070690_1001447981 259
154 3300005334 Ga0068869_100009985 Ga0068869_1000099858 259
155 3300005335 Ga0070666_10000028 Ga0070666_1000002836 259
156 3300005340 Ga0070689_100145605 Ga0070689_1001456053 259
157 3300005343 Ga0070687_100034067 Ga0070687_1000340672 259
158 3300005347 Ga0070668_100107943 Ga0070668_1001079432 259
159 3300005354 Ga0070675_100040800 Ga0070675_1000408006 259
160 3300005441 Ga0070700_100105214 Ga0070700_1001052143 259
161 3300005459 Ga0068867_100022159 Ga0068867_1000221594 259
162 3300005535 Ga0070684_100014418 Ga0070684_1000144182 259
163 3300005543 Ga0070672_100053708 Ga0070672_1000537084 259
164 3300005543 Ga0070672_100064678 Ga0070672_1000646781 259
165 3300005563 Ga0068855_100000630 Ga0068855_10000063022 259
166 3300005564 Ga0070664_100411541 Ga0070664_1004115411 259
167 3300005616 Ga0068852_100004976 Ga0068852_1000049762 259
168 3300005617 Ga0068859_100000012 Ga0068859_100000012218 259
169 3300005617 Ga0068859_100091356 Ga0068859_1000913562 259
170 3300005618 Ga0068864_100020745 Ga0068864_1000207454 259
171 3300005841 Ga0068863_100001512 Ga0068863_10000151221 259
172 3300005841 Ga0068863_100002125 Ga0068863_1000021259 259
173 3300005843 Ga0068860_100090144 Ga0068860_1000901443 259
174 3300005843 Ga0068860_100091816 Ga0068860_1000918163 259
175 3300006237 Ga0097621_100196360 Ga0097621_1001963603 259
176 3300006358 Ga0068871_100043176 Ga0068871_1000431762 259
177 3300006358 Ga0068871_100081188 Ga0068871_1000811882 259
178 3300006931 Ga0097620_100000012 Ga0097620_100000012218 259
179 3300006931 Ga0097620_100091346 Ga0097620_1000913463 259
180 3300009174 Ga0105241_10000619 Ga0105241_1000061913 259
181 3300010375 Ga0105239_10405650 Ga0105239_104056502 259
182 3300011119 Ga0105246_10230982 Ga0105246_102309822 259
183 3300013105 Ga0157369_10095010 Ga0157369_100950103 259
184 3300013297 Ga0157378_10247280 Ga0157378_102472803 259
185 3300013306 Ga0163162_10000634 Ga0163162_100006346 259
186 3300013307 Ga0157372_10029574 Ga0157372_100295744 259
187 3300013307 Ga0157372_10357251 Ga0157372_103572512 259
188 3300014325 Ga0163163_10160409 Ga0163163_101604092 259
189 3300025246 Ga0209646_1005513 Ga0209646_10055131 259
190 3300025321 Ga0207656_10061901 Ga0207656_100619012 259
191 3300025900 Ga0207710_10004222 Ga0207710_100042223 259
192 3300025903 Ga0207680_10000181 Ga0207680_1000018123 259
193 3300025907 Ga0207645_10011492 Ga0207645_100114926 259
194 3300025911 Ga0207654_10000479 Ga0207654_1000047912 259
195 3300025913 Ga0207695_10000110 Ga0207695_10000110188 259
196 3300025914 Ga0207671_10005924 Ga0207671_100059241 259
197 3300025918 Ga0207662_10106590 Ga0207662_101065902 259
198 3300025931 Ga0207644_10075505 Ga0207644_100755051 259
199 3300025931 Ga0207644_10088835 Ga0207644_100888351 259
200 3300025940 Ga0207691_10065091 Ga0207691_100650911 259
201 3300025942 Ga0207689_10001630 Ga0207689_1000163012 259
202 3300025942 Ga0207689_10099714 Ga0207689_100997142 259
203 3300025942 Ga0207689_10325186 Ga0207689_103251861 259
204 3300025949 Ga0207667_10000700 Ga0207667_1000070013 259
205 3300025960 Ga0207651_10189585 Ga0207651_101895852 259
206 3300025961 Ga0207712_10010175 Ga0207712_100101757 259
207 3300025961 Ga0207712_10014418 Ga0207712_100144183 259
208 3300025986 Ga0207658_10161954 Ga0207658_101619542 259
209 3300026035 Ga0207703_10110480 Ga0207703_101104802 259
210 3300026075 Ga0207708_10123788 Ga0207708_101237883 259
211 3300026088 Ga0207641_10000152 Ga0207641_1000015221 259
212 3300026088 Ga0207641_10008689 Ga0207641_100086894 259
213 3300026089 Ga0207648_10027693 Ga0207648_100276934 259
214 3300026089 Ga0207648_10144184 Ga0207648_101441843 259
215 3300026095 Ga0207676_10236393 Ga0207676_102363933 259
216 3300026142 Ga0207698_10029764 Ga0207698_100297642 259
217 3300028381 Ga0268264_10026772 Ga0268264_100267725 259
218 3300028381 Ga0268264_10170976 Ga0268264_101709763 259
219 3300031507 Ga0307509_10144234 Ga0307509_101442342 259
220 3300031616 Ga0307508_10002192 Ga0307508_100021928 259
221 3300031727 Ga0316576_10083107 Ga0316576_100831072 259
222 3300031728 Ga0316578_10022348 Ga0316578_100223482 259
223 3300031838 Ga0307518_10208569 Ga0307518_102085692 259
224 3300036712 Ga0316584_0042115 Ga0316584_0042115_2153_3037 259
225 3300044658 Ga0466972_0000013 Ga0466972_0000013_6498_7457 259
226 3300049569 Ga0501032_0041615 Ga0501032_0041615_1536_2438 259
227 3300049570 Ga0501033_0040428 Ga0501033_0040428_2342_3244 259
228 3300049571 Ga0501034_0321090 Ga0501034_0321090_246_1148 259
229 3300049572 Ga0501036_0188423 Ga0501036_0188423_429_1331 259
230 3300049573 Ga0501037_0048933 Ga0501037_0048933_318_1220 259
231 3300049574 Ga0501038_0012074 Ga0501038_0012074_866_1768 259
232 3300049575 Ga0501039_0308670 Ga0501039_0308670_172_1074 259
233 3300049579 Ga0501043_0004323 Ga0501043_0004323_490_1392 259
234 3300049581 Ga0501047_0083492 Ga0501047_0083492_1988_3007 259
235 3300049581 Ga0501047_0167800 Ga0501047_0167800_1020_1922 259
236 3300049822 Ga0501035_0031508 Ga0501035_0031508_141_1043 259
237 3300049823 Ga0501044_0025041 Ga0501044_0025041_1420_2439 259
238 3300049823 Ga0501044_0141292 Ga0501044_0141292_402_1304 259
239 3300049823 Ga0501044_0579291 Ga0501044_0579291_28_987 259
240 3300049823 Ga0501044_0664285 Ga0501044_0664285_15_881 259
241 3300053086 Ga0500578_0000150 Ga0500578_0000150_63189_64139 259
242 3300053086 Ga0500578_0010134 Ga0500578_0010134_350_1309 259
243 3300005335 Ga0070666_10059242 Ga0070666_100592423 260
244 3300005364 Ga0070673_100049130 Ga0070673_1000491304 260
245 3300005841 Ga0068863_100325515 Ga0068863_1003255152 260
246 3300006881 Ga0068865_100135461 Ga0068865_1001354613 260
247 3300014326 Ga0157380_10166679 Ga0157380_101666791 260
248 3300014969 Ga0157376_10054634 Ga0157376_100546343 260
249 3300025938 Ga0207704_10142524 Ga0207704_101425242 260
250 3300025942 Ga0207689_10016741 Ga0207689_100167415 260
251 3300025960 Ga0207651_10050980 Ga0207651_100509803 260
252 3300026088 Ga0207641_10149241 Ga0207641_101492412 260
253 3300026089 Ga0207648_10000404 Ga0207648_1000040447 260
254 3300026121 Ga0207683_10004600 Ga0207683_100046004 260
255 3300037068 Ga0373925_0339194 Ga0373925_0339194_49_981 260
256 3300005328 Ga0070676_10009111 Ga0070676_100091113 261
257 3300005334 Ga0068869_100022928 Ga0068869_1000229281 261
258 3300005338 Ga0068868_100010912 Ga0068868_1000109122 261
259 3300005347 Ga0070668_100032760 Ga0070668_1000327604 261
260 3300005353 Ga0070669_100026149 Ga0070669_1000261492 261
261 3300005367 Ga0070667_100438707 Ga0070667_1004387071 261
262 3300005456 Ga0070678_100059675 Ga0070678_1000596752 261
263 3300005548 Ga0070665_100081886 Ga0070665_1000818861 261
264 3300005564 Ga0070664_100325814 Ga0070664_1003258142 261
265 3300005617 Ga0068859_100127529 Ga0068859_1001275293 261
266 3300005843 Ga0068860_100078259 Ga0068860_1000782593 261
267 3300006881 Ga0068865_100047650 Ga0068865_1000476504 261
268 3300006931 Ga0097620_100127525 Ga0097620_1001275253 261
269 3300009094 Ga0111539_10512566 Ga0111539_105125662 261
270 3300009553 Ga0105249_10049007 Ga0105249_100490074 261
271 3300013297 Ga0157378_10111593 Ga0157378_101115933 261
272 3300025903 Ga0207680_10103510 Ga0207680_101035101 261
273 3300025925 Ga0207650_10177608 Ga0207650_101776082 261
274 3300025937 Ga0207669_10057787 Ga0207669_100577872 261
275 3300025938 Ga0207704_10046645 Ga0207704_100466452 261
276 3300025942 Ga0207689_10017184 Ga0207689_100171847 261
277 3300025961 Ga0207712_10028607 Ga0207712_100286073 261
278 3300026023 Ga0207677_10090880 Ga0207677_100908803 261
279 3300026041 Ga0207639_10151736 Ga0207639_101517361 261
280 3300026118 Ga0207675_100026071 Ga0207675_1000260714 261
281 3300046616 Ga0495668_0023884 Ga0495668_0023884_1705_2634 261
282 3300050005 Ga0501284_00052 Ga0501284_00052_23818_24711 261
283 3300005290 Ga0065712_10077630 Ga0065712_100776305 262
284 3300005290 Ga0065712_10080611 Ga0065712_100806112 262
285 3300005331 Ga0070670_100116859 Ga0070670_1001168593 262
286 3300005334 Ga0068869_100202084 Ga0068869_1002020841 262
287 3300005338 Ga0068868_100134398 Ga0068868_1001343983 262
288 3300005340 Ga0070689_100001483 Ga0070689_1000014833 262
289 3300005340 Ga0070689_100023519 Ga0070689_1000235194 262
290 3300005343 Ga0070687_100232966 Ga0070687_1002329661 262
291 3300005347 Ga0070668_100055191 Ga0070668_1000551913 262
292 3300005353 Ga0070669_100000458 Ga0070669_10000045815 262
293 3300005354 Ga0070675_100006330 Ga0070675_1000063303 262
294 3300005356 Ga0070674_100046398 Ga0070674_1000463982 262
295 3300005364 Ga0070673_100006930 Ga0070673_1000069305 262
296 3300005364 Ga0070673_100062586 Ga0070673_1000625864 262
297 3300005365 Ga0070688_100000687 Ga0070688_1000006875 262
298 3300005438 Ga0070701_10090655 Ga0070701_100906552 262
299 3300005457 Ga0070662_100052770 Ga0070662_1000527702 262
300 3300005466 Ga0070685_10004614 Ga0070685_100046144 262
301 3300005543 Ga0070672_100031816 Ga0070672_1000318162 262
302 3300005577 Ga0068857_100089405 Ga0068857_1000894052 262
303 3300005617 Ga0068859_100010347 Ga0068859_1000103475 262
304 3300005719 Ga0068861_100011572 Ga0068861_1000115724 262
305 3300005841 Ga0068863_100089381 Ga0068863_1000893813 262
306 3300005844 Ga0068862_100003547 Ga0068862_1000035476 262
307 3300005844 Ga0068862_100107535 Ga0068862_1001075351 262
308 3300006931 Ga0097620_100010347 Ga0097620_1000103475 262
309 3300009094 Ga0111539_10006834 Ga0111539_1000683416 262
310 3300009553 Ga0105249_10002929 Ga0105249_100029293 262
311 3300009553 Ga0105249_10040052 Ga0105249_100400524 262
312 3300009553 Ga0105249_10190631 Ga0105249_101906311 262
313 3300010375 Ga0105239_10008174 Ga0105239_1000817413 262
314 3300013297 Ga0157378_10010275 Ga0157378_100102755 262
315 3300013306 Ga0163162_10081200 Ga0163162_100812001 262
316 3300013306 Ga0163162_10083522 Ga0163162_100835224 262
317 3300013307 Ga0157372_10373763 Ga0157372_103737631 262
318 3300013308 Ga0157375_10034238 Ga0157375_100342385 262
319 3300014326 Ga0157380_10000252 Ga0157380_1000025224 262
320 3300014326 Ga0157380_10108658 Ga0157380_101086583 262
321 3300017792 Ga0163161_10011562 Ga0163161_100115624 262
322 3300025250 Ga0209026_1000430 Ga0209026_100043016 262
323 3300025315 Ga0207697_10010930 Ga0207697_100109303 262
324 3300025908 Ga0207643_10034582 Ga0207643_100345823 262
325 3300025914 Ga0207671_10004878 Ga0207671_1000487816 262
326 3300025923 Ga0207681_10002677 Ga0207681_1000267710 262
327 3300025925 Ga0207650_10061252 Ga0207650_100612521 262
328 3300025926 Ga0207659_10152396 Ga0207659_101523962 262
329 3300025933 Ga0207706_10019199 Ga0207706_100191994 262
330 3300025936 Ga0207670_10014700 Ga0207670_100147004 262
331 3300025942 Ga0207689_10200020 Ga0207689_102000202 262
332 3300025960 Ga0207651_10020767 Ga0207651_100207673 262
333 3300025961 Ga0207712_10001140 Ga0207712_1000114012 262
334 3300025961 Ga0207712_10094060 Ga0207712_100940603 262
335 3300025972 Ga0207668_10038829 Ga0207668_100388293 262
336 3300026023 Ga0207677_10088731 Ga0207677_100887313 262
337 3300026088 Ga0207641_10155323 Ga0207641_101553232 262
338 3300026116 Ga0207674_10011898 Ga0207674_100118983 262
339 3300026118 Ga0207675_100000386 Ga0207675_1000003864 262
340 3300026118 Ga0207675_100607314 Ga0207675_1006073141 262
341 3300028380 Ga0268265_10007727 Ga0268265_100077274 262
342 3300028380 Ga0268265_10301420 Ga0268265_103014202 262
343 3300030521 Ga0307511_10000285 Ga0307511_100002858 262
344 3300041512 Ga0451853_0081640 Ga0451853_0081640_107_1027 262
345 3300044842 Ga0466957_0001773 Ga0466957_0001773_9759_10691 262
346 3300049675 Ga0501243_003969 Ga0501243_003969_364_1278 262
347 3300050511 nmdc:mga08y16_12116_c1 nmdc:mga08y16_12116_c1_838_1755 262
348 3300053092 Ga0500583_0000144 Ga0500583_0000144_6301_7269 262
349 3300053092 Ga0500583_0016005 Ga0500583_0016005_828_1760 262
350 3300053156 Ga0500622_0061631 Ga0500622_0061631_246_1166 262
351 3300061719 Ga0466962_0061279 Ga0466962_0061279_516_1448 262
352 3300005347 Ga0070668_100123676 Ga0070668_1001236761 263
353 3300005577 Ga0068857_100143953 Ga0068857_1001439533 263
354 3300005719 Ga0068861_100041855 Ga0068861_1000418553 263
355 3300006881 Ga0068865_100063048 Ga0068865_1000630483 263
356 3300009093 Ga0105240_10002716 Ga0105240_1000271615 263
357 3300009093 Ga0105240_10002823 Ga0105240_1000282314 263
358 3300013307 Ga0157372_10278540 Ga0157372_102785404 263
359 3300025899 Ga0207642_10188108 Ga0207642_101881082 263
360 3300025913 Ga0207695_10000023 Ga0207695_1000002323 263
361 3300025913 Ga0207695_10000229 Ga0207695_10000229118 263
362 3300025972 Ga0207668_10198597 Ga0207668_101985971 263
363 3300026116 Ga0207674_10104640 Ga0207674_101046402 263
364 3300026118 Ga0207675_100004947 Ga0207675_1000049478 263
365 3300028381 Ga0268264_10117124 Ga0268264_101171243 263
366 3300042435 Ga0439434_0029289 Ga0439434_0029289_423_1367 263
367 3300042876 Ga0451577_0088151 Ga0451577_0088151_1022_1942 263
368 3300047320 Ga0495672_0018813 Ga0495672_0018813_1601_2590 263
369 3300047472 Ga0495686_0011435 Ga0495686_0011435_2120_3082 263
370 3300049568 Ga0501031_0127387 Ga0501031_0127387_98_1012 263
371 3300049569 Ga0501032_0005376 Ga0501032_0005376_279_1154 263
372 3300049569 Ga0501032_0042130 Ga0501032_0042130_1069_2016 263
373 3300049571 Ga0501034_0004706 Ga0501034_0004706_8517_9392 263
374 3300049572 Ga0501036_0002360 Ga0501036_0002360_9118_9993 263
375 3300049572 Ga0501036_0018399 Ga0501036_0018399_1462_2409 263
376 3300049573 Ga0501037_0003684 Ga0501037_0003684_6953_7828 263
377 3300049573 Ga0501037_0014879 Ga0501037_0014879_3200_4147 263
378 3300049574 Ga0501038_0032386 Ga0501038_0032386_1937_2884 263
379 3300049574 Ga0501038_0097094 Ga0501038_0097094_1335_2210 263
380 3300049575 Ga0501039_0028824 Ga0501039_0028824_53_928 263
381 3300049575 Ga0501039_0042830 Ga0501039_0042830_2178_3125 263
382 3300049579 Ga0501043_0012478 Ga0501043_0012478_1890_2837 263
383 3300049579 Ga0501043_0014705 Ga0501043_0014705_5077_5952 263
384 3300049580 Ga0501046_0006183 Ga0501046_0006183_6576_7451 263
385 3300049581 Ga0501047_0007787 Ga0501047_0007787_3265_4140 263
386 3300049582 Ga0501048_0026224 Ga0501048_0026224_1835_2710 263
387 3300049586 Ga0501070_0019278 Ga0501070_0019278_187_1062 263
388 3300049589 Ga0501073_0068425 Ga0501073_0068425_228_1103 263
389 3300049590 Ga0501074_0000275 Ga0501074_0000275_6301_7176 263
390 3300049686 Ga0501257_011356 Ga0501257_011356_923_1870 263
391 3300049742 Ga0501080_0021404 Ga0501080_0021404_625_1500 263
392 3300049744 Ga0501083_0002224 Ga0501083_0002224_9305_10180 263
393 3300049822 Ga0501035_0035350 Ga0501035_0035350_3332_4279 263
394 3300049823 Ga0501044_0014310 Ga0501044_0014310_4268_5215 263
395 3300005841 Ga0068863_100008194 Ga0068863_1000081946 264
396 3300026088 Ga0207641_10023563 Ga0207641_100235632 264
397 3300042134 Ga0450898_015273 Ga0450898_015273_167_1195 264
398 3300035172 Ga0373955_0004405 Ga0373955_0004405_2456_3403 265
399 3300035410 Ga0373924_0017738 Ga0373924_0017738_839_1786 265
400 3300036401 Ga0373937_0015276 Ga0373937_0015276_3034_3981 265
401 3300044712 Ga0453684_0005399 Ga0453684_0005399_14040_14912 265
402 3300046454 Ga0495592_0140550 Ga0495592_0140550_636_1583 265
403 3300046511 Ga0495608_0141373 Ga0495608_0141373_257_1204 265
404 3300046516 Ga0495628_0027799 Ga0495628_0027799_2262_3209 265
405 3300046517 Ga0495630_0013657 Ga0495630_0013657_4487_5434 265
406 3300046536 Ga0495587_0042287 Ga0495587_0042287_572_1519 265
407 3300047319 Ga0495674_0107419 Ga0495674_0107419_1361_2308 265
408 3300047444 Ga0495675_0194676 Ga0495675_0194676_269_1216 265
409 3300047471 Ga0495684_0094041 Ga0495684_0094041_257_1204 265
410 3300053156 Ga0500622_0000299 Ga0500622_0000299_28725_29591 265
411 3300005459 Ga0068867_100055539 Ga0068867_1000555393 266
412 3300005577 Ga0068857_100215645 Ga0068857_1002156452 266
413 3300006881 Ga0068865_100376380 Ga0068865_1003763801 266
414 3300009176 Ga0105242_10008063 Ga0105242_100080632 266
415 3300009176 Ga0105242_10500477 Ga0105242_105004772 266
416 3300013102 Ga0157371_10005024 Ga0157371_1000502410 266
417 3300013104 Ga0157370_10033991 Ga0157370_100339913 266
418 3300013105 Ga0157369_10007184 Ga0157369_100071842 266
419 3300013307 Ga0157372_10000073 Ga0157372_1000007313 266
420 3300014969 Ga0157376_10793494 Ga0157376_107934941 266
421 3300025938 Ga0207704_10300724 Ga0207704_103007241 266
422 3300025972 Ga0207668_10133857 Ga0207668_101338573 266
423 3300026089 Ga0207648_10066807 Ga0207648_100668073 266
424 3300026116 Ga0207674_10238025 Ga0207674_102380252 266
425 3300037312 Ga0395899_0004043 Ga0395899_0004043_3212_4072 266
426 3300044712 Ga0453684_0141745 Ga0453684_0141745_1904_2830 266
427 3300053080 Ga0500635_0000819 Ga0500635_0000819_1880_2761 266
428 iso_pu_bacteria 2818991444 2819590779 266
429 iso_pu_bacteria 2929154850 2929157811 266
430 3300001979 JGI24740J21852_10047170 JGI24740J21852_100471702 267
431 3300003316 rootH1_10146021 rootH1_101460212 267
432 3300003354 JGI25160J50197_1000890 JGI25160J50197_10008909 267
433 3300005614 Ga0068856_100161078 Ga0068856_1001610783 267
434 3300006195 Ga0075366_10115672 Ga0075366_101156722 267
435 3300009174 Ga0105241_10360114 Ga0105241_103601142 267
436 3300009545 Ga0105237_10009852 Ga0105237_100098526 267
437 3300010375 Ga0105239_10015270 Ga0105239_100152706 267
438 3300013307 Ga0157372_10130862 Ga0157372_101308622 267
439 3300025302 Ga0207426_1000192 Ga0207426_100019296 267
440 3300025921 Ga0207652_10071364 Ga0207652_100713643 267
441 3300026116 Ga0207674_10190988 Ga0207674_101909882 267
442 3300031251 Ga0265327_10002164 Ga0265327_1000216417 267
443 3300038443 Ga0395901_0147293 Ga0395901_0147293_779_1642 267
444 3300044658 Ga0466972_0000003 Ga0466972_0000003_184222_185133 267
445 3300044712 Ga0453684_0230449 Ga0453684_0230449_1062_1937 267
446 3300044765 Ga0466970_0005282 Ga0466970_0005282_1782_2693 267
447 3300044842 Ga0466957_0113787 Ga0466957_0113787_100_1011 267
448 3300048917 Ga0496114_0514427 Ga0496114_0514427_109_1020 267
449 3300048927 Ga0496124_0047285 Ga0496124_0047285_1693_2649 267
450 3300053108 Ga0500562_000062 Ga0500562_000062_41206_42162 267
451 3300053156 Ga0500622_0000337 Ga0500622_0000337_31007_31981 267
452 3300055283 Ga0500661_009181 Ga0500661_009181_614_1570 267
453 3300009098 Ga0105245_10638670 Ga0105245_106386702 268
454 3300014969 Ga0157376_10466205 Ga0157376_104662052 268
455 iso_pu_bacteria 2842903701 2842908805 268
456 iso_pu_bacteria 2852623160 2852625042 268
457 iso_pu_bacteria 2884933994 2884934059 268
458 iso_pu_bacteria 2977232053 2977236051 268
459 iso_pu_bacteria 8055588893 8055589097 268
460 3300005616 Ga0068852_100132110 Ga0068852_1001321102 269
461 3300026142 Ga0207698_10363857 Ga0207698_103638572 269
462 3300045051 Ga0451576_0000012 Ga0451576_0000012_36099_36974 269
463 3300001989 JGI24739J22299_10001623 JGI24739J22299_100016235 270
464 3300002738 JGI25154J39366_1000854 JGI25154J39366_10008544 270
465 3300003215 JGI25153J46596_10014282 JGI25153J46596_100142822 270
466 3300003323 rootH1_10084867 rootH1_1008486711 270
467 3300003323 rootH1_10331010 rootH1_103310102 270
468 3300003354 JGI25160J50197_1007865 JGI25160J50197_10078652 270
469 3300003790 Ga0055528_1002738 Ga0055528_10027386 270
470 3300005262 Ga0065165_1000102 Ga0065165_100010298 270
471 3300005577 Ga0068857_100231430 Ga0068857_1002314302 270
472 3300013102 Ga0157371_10132026 Ga0157371_101320262 270
473 3300025242 Ga0209258_100293 Ga0209258_10029317 270
474 3300025246 Ga0209646_1000002 Ga0209646_1000002605 270
475 3300025254 Ga0209148_1000278 Ga0209148_100027859 270
476 3300025273 Ga0209673_1000530 Ga0209673_10005306 270
477 3300025297 Ga0209758_1000722 Ga0209758_10007227 270
478 3300025297 Ga0209758_1025593 Ga0209758_10255933 270
479 3300025298 Ga0209050_1000134 Ga0209050_100013453 270
480 3300025302 Ga0207426_1000051 Ga0207426_1000051258 270
481 3300025302 Ga0207426_1000357 Ga0207426_100035724 270
482 3300025302 Ga0207426_1001446 Ga0207426_100144612 270
483 3300025304 Ga0209257_1008115 Ga0209257_10081156 270
484 3300025923 Ga0207681_10061421 Ga0207681_100614212 270
485 3300026116 Ga0207674_10251290 Ga0207674_102512902 270
486 3300032004 Ga0307414_10171056 Ga0307414_101710562 270
487 3300042014 Ga0439457_023061 Ga0439457_023061_231_1097 270
488 3300044683 Ga0466965_0198973 Ga0466965_0198973_29_895 270
489 3300046558 Ga0495633_0000080 Ga0495633_0000080_102178_103044 270
490 3300049581 Ga0501047_0017174 Ga0501047_0017174_3901_4767 270
491 3300049758 Ga0501241_000441 Ga0501241_000441_6649_7515 270
492 3300049822 Ga0501035_0381642 Ga0501035_0381642_35_901 270
493 3300049823 Ga0501044_0225128 Ga0501044_0225128_417_1283 270
494 3300053088 Ga0500644_0000119 Ga0500644_0000119_45394_46260 270
495 3300053090 Ga0500646_0015895 Ga0500646_0015895_640_1506 270
496 3300053093 Ga0500651_0024279 Ga0500651_0024279_182_1048 270
497 3300053109 Ga0500569_000060 Ga0500569_000060_742_1608 270
498 3300053160 Ga0500633_0000661 Ga0500633_0000661_2827_3693 270
499 3300055283 Ga0500661_001888 Ga0500661_001888_936_1802 270
500 iso_pu_bacteria 2818991460 2819680799 270
501 iso_pu_bacteria 2929177148 2929178876 270
502 iso_pu_bacteria 2929921140 2929923329 270
503 iso_pu_bacteria 2945977869 2945981279 270
504 iso_pu_bacteria 2946013367 2946019317 270
505 iso_pu_bacteria 8003151029 8003152204 270
506 3300005834 Ga0068851_10000228 Ga0068851_1000022827 271
507 3300009553 Ga0105249_10355923 Ga0105249_103559232 271
508 3300013102 Ga0157371_10028051 Ga0157371_100280514 271
509 3300013307 Ga0157372_10044826 Ga0157372_100448263 271
510 3300014326 Ga0157380_10000135 Ga0157380_1000013512 271
511 3300021384 Ga0213876_10079875 Ga0213876_100798751 271
512 3300025321 Ga0207656_10000115 Ga0207656_1000011518 271
513 3300041494 Ga0451837_0762534 Ga0451837_0762534_414_1277 271
514 3300044684 Ga0466966_0071544 Ga0466966_0071544_1053_1913 271
515 3300044693 Ga0466961_0095976 Ga0466961_0095976_699_1559 271
516 3300044712 Ga0453684_0254329 Ga0453684_0254329_39_902 271
517 3300045049 Ga0466959_0111453 Ga0466959_0111453_1046_1906 271
518 3300046539 Ga0495621_0041787 Ga0495621_0041787_480_1343 271
519 3300002772 JGI25164J39214_1001693 JGI25164J39214_10016932 272
520 3300003214 JGI25165J46597_1000157 JGI25165J46597_100015724 272
521 3300003323 rootH1_10005851 rootH1_1000585186 272
522 3300005327 Ga0070658_10000028 Ga0070658_1000002873 272
523 3300005329 Ga0070683_100015680 Ga0070683_1000156806 272
524 3300005339 Ga0070660_100037380 Ga0070660_1000373804 272
525 3300005355 Ga0070671_100040707 Ga0070671_1000407075 272
526 3300005535 Ga0070684_100073194 Ga0070684_1000731943 272
527 3300005563 Ga0068855_100032903 Ga0068855_1000329032 272
528 3300005563 Ga0068855_100155847 Ga0068855_1001558473 272
529 3300005577 Ga0068857_100036767 Ga0068857_1000367671 272
530 3300005614 Ga0068856_100060738 Ga0068856_1000607382 272
531 3300006195 Ga0075366_10016453 Ga0075366_100164532 272
532 3300006881 Ga0068865_100002711 Ga0068865_10000271113 272
533 3300009545 Ga0105237_10025455 Ga0105237_100254556 272
534 3300010375 Ga0105239_10000007 Ga0105239_10000007156 272
535 3300013100 Ga0157373_10000245 Ga0157373_1000024521 272
536 3300013100 Ga0157373_10003820 Ga0157373_100038206 272
537 3300013102 Ga0157371_10002946 Ga0157371_1000294614 272
538 3300013105 Ga0157369_10154347 Ga0157369_101543473 272
539 3300013307 Ga0157372_10000173 Ga0157372_1000017330 272
540 3300013307 Ga0157372_10002062 Ga0157372_1000206213 272
541 3300013307 Ga0157372_10375431 Ga0157372_103754312 272
542 3300013308 Ga0157375_10006292 Ga0157375_1000629213 272
543 3300025230 Ga0209563_109961 Ga0209563_1099612 272
544 3300025231 Ga0207427_100025 Ga0207427_100025118 272
545 3300025233 Ga0209437_100010 Ga0209437_100010380 272
546 3300025261 Ga0209233_1000017 Ga0209233_1000017393 272
547 3300025261 Ga0209233_1005361 Ga0209233_10053614 272
548 3300025904 Ga0207647_10013369 Ga0207647_100133696 272
549 3300025909 Ga0207705_10000045 Ga0207705_1000004573 272
550 3300025914 Ga0207671_10008745 Ga0207671_100087452 272
551 3300025919 Ga0207657_10009277 Ga0207657_1000927711 272
552 3300025921 Ga0207652_10276461 Ga0207652_102764612 272
553 3300025931 Ga0207644_10036049 Ga0207644_100360495 272
554 3300025935 Ga0207709_10096299 Ga0207709_100962992 272
555 3300025938 Ga0207704_10000266 Ga0207704_1000026612 272
556 3300025944 Ga0207661_10014406 Ga0207661_100144064 272
557 3300025949 Ga0207667_10002856 Ga0207667_100028561 272
558 3300025949 Ga0207667_10060807 Ga0207667_100608074 272
559 3300025949 Ga0207667_10329976 Ga0207667_103299762 272
560 3300026078 Ga0207702_10042340 Ga0207702_100423404 272
561 3300026089 Ga0207648_10014266 Ga0207648_100142664 272
562 3300026116 Ga0207674_10056447 Ga0207674_100564473 272
563 3300037312 Ga0395899_0000887 Ga0395899_0000887_7831_8685 272
564 3300037312 Ga0395899_0119608 Ga0395899_0119608_204_1058 272
565 3300037418 Ga0395900_0000143 Ga0395900_0000143_8999_9853 272
566 3300037418 Ga0395900_0003189 Ga0395900_0003189_12534_13388 272
567 3300037418 Ga0395900_0105430 Ga0395900_0105430_823_1677 272
568 3300037466 Ga0395898_0004789 Ga0395898_0004789_4234_5088 272
569 3300037466 Ga0395898_0189005 Ga0395898_0189005_469_1323 272
570 3300037471 Ga0395905_0000175 Ga0395905_0000175_22828_23682 272
571 3300037471 Ga0395905_0000981 Ga0395905_0000981_853_1707 272
572 3300038443 Ga0395901_0000313 Ga0395901_0000313_19712_20566 272
573 3300038443 Ga0395901_0009480 Ga0395901_0009480_821_1675 272
574 3300046694 Ga0495649_0019673 Ga0495649_0019673_1269_2123 272
575 3300047443 Ga0495687_004330 Ga0495687_004330_8660_9514 272
576 3300047472 Ga0495686_0007656 Ga0495686_0007656_1221_2075 272
577 3300049570 Ga0501033_0287672 Ga0501033_0287672_148_1005 272
578 3300001979 JGI24740J21852_10012057 JGI24740J21852_100120571 274
579 3300005338 Ga0068868_100273784 Ga0068868_1002737841 274
580 3300005455 Ga0070663_100073442 Ga0070663_1000734423 274
581 3300005457 Ga0070662_100000014 Ga0070662_10000001452 274
582 3300009093 Ga0105240_10018922 Ga0105240_100189222 274
583 3300009093 Ga0105240_10302673 Ga0105240_103026731 274
584 3300009174 Ga0105241_10002362 Ga0105241_100023627 274
585 3300011119 Ga0105246_10035275 Ga0105246_100352752 274
586 3300013100 Ga0157373_10030765 Ga0157373_100307654 274
587 3300013306 Ga0163162_10000010 Ga0163162_10000010260 274
588 3300013307 Ga0157372_10023318 Ga0157372_100233185 274
589 3300021361 Ga0213872_10009259 Ga0213872_100092593 274
590 3300025904 Ga0207647_10000680 Ga0207647_1000068013 274
591 3300025911 Ga0207654_10001057 Ga0207654_1000105711 274
592 3300025933 Ga0207706_10000057 Ga0207706_1000005784 274
593 3300039447 Ga0436361_1115729 Ga0436361_1115729_9521_10381 274

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01040

UbiA

UbiA prenyltransferase family

88

326

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8794 8 269
4od4-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8399 8 269
4tq3-assembly1.cif.gz_A structure of a ubia homolog from archaeoglobus fulgidus bound to gpp and mg2+ 0.7844 3 265
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.7679 3 272
4tq4-assembly3.cif.gz_C structure of a ubia homolog from archaeoglobus fulgidus bound to dmapp and mg2+ 0.7557 3 272
ID Description Score Start End Superfamily
4od5A01 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8971 7 158 1.10.357.140
af_K7LGE3_127_240_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8855 46 127 1.10.357.140
af_Q54JB3_152_315_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8783 8 170 1.10.357.140
af_F1LVF4_158_307_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8749 8 158 1.10.357.140
af_Q12887_160_330_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8721 8 180 1.10.357.140
ID Description Score Start End GO Terms
AF-A0A4Q3BCU5-F1-model_v4 deleted 0.9878 1 204
AF-A0A0M3C795-F1-model_v4 deleted 0.9861 18 238
AF-A0A3M1BGH9-F1-model_v4 4-hydroxybenzoate octaprenyltransferase 0.9826 1 189 GO:0005886
GO:0006744
GO:0016765
AF-A0A4Q3BCU5-F1-model_v4 deleted 0.9783 1 204
AF-M3EJU6-F1-model_v4 4-hydroxybenzoate polyprenyltransferase-like protein 0.9742 35 200 GO:0005886
GO:0006744
GO:0016765

Feature Viewer

pLDDT pTM Quality
82.28 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map