F467247

General Info

Members Datasets Scaffolds Average Seq Length
593 329 1186 544

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0005646|Ga0395905_0005646_6572_8338
Length 588
Sequence MSAIGIPTPVEEHPRPKTTNYLNVASSLKSWLGTGDHKRIAIMYLIAITCFFFLGASFAGAIRIELMSPAGVMFESETYNKIFSGHGIVMVFLFLVPAIPAILGNFLIPLMIGARDLAFPRLNLLSWYLYMIGGGFILVSFLAGGVDTGWTFYTPYSSLYSNSQVSLAIVGIFIAGFSSILTGINFIVTVHKMRAPGMTWFRLPLFVWSMYATSVVIVLGTPVVALTLLLVMLERVFRLPFFSPEIGGDPVLFQHMFWFYSHPAVYIMVLPGFAVISELIANFARKRIFGYHFVAFSSLGIAFLGFLLWGHHMFVSSMSMYQGLVFSLLSFLIAVPSAIKVFNWTLTLYKGNIRLQSPMLFALGFLGLFSIGGLTGLFLASAGTDMHITNTYFVVAHFHYVMVGGTLLAFLGGIHYWWPKMTGRMFNESSAKVSAVLVFIGFNVTFFPQFIVGWLGMPRRYHYYYFAPEYQVYNVMSTIGASVLAIGLILPAIYLTSSLFKGARAAANPWGAHGLEWETTSPPPTTNFLETPIVTDEVYDFDPVAEYEQQRATSEIVDPGHPYMRQTKDDVKLPPVPEAEIKPEKEND

Samples

Sample ID Description Type Environment
1 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
13 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
14 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
15 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
109 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
110 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
119 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
186 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
190 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
191 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
201 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
242 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
243 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
244 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
245 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
246 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
247 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
248 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
255 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
256 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
257 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
258 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
259 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
260 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
267 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
278 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
279 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
280 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
281 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
282 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
304 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
307 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
321 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
323 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
324 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
325 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
326 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
327 2919404418 Luteibacter sp. 3190 Isolate Unclassified
328 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
329 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0.34
Isolates 1.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0.17
Rhizoplane 4.22
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395905_0005646 3300037471 Bacteria 12726
2 LJNas_1000425 3300000546 Bacteria 7479
3 JGI24743J22301_10000472 3300001991 Bacteria 4644
4 JGI24749J21850_1000881 3300002076 Bacteria 4322
5 JGI25162J39368_1002980 3300002737 Bacteria 5613
6 JGI25157J39369_1002762 3300002741 Bacteria 4027
7 JGI25164J39214_1000173 3300002772 Bacteria 60197
8 Ga0006759J45824_1021183 3300003163 Bacteria 4458
9 JGI25165J46597_1000202 3300003214 Bacteria 87361
10 JGI25404J52841_10000845 3300003659 Bacteria 4916
11 Ga0032354_1048682 3300003693 Bacteria 4152
12 Ga0055539_1001767 3300003752 Bacteria 3729
13 Ga0055533_1001565 3300003756 Bacteria 5948
14 Ga0055527_1002653 3300003760 Bacteria 2928
15 Ga0055535_1001604 3300003761 Bacteria 10680
16 Ga0055535_1001961 3300003761 Bacteria 8543
17 Ga0055542_1000138 3300003762 Bacteria 92160
18 Ga0055542_1000159 3300003762 Bacteria 85591
19 Ga0055529_1000162 3300003763 Bacteria 92180
20 Ga0065165_1001431 3300005262 Bacteria 25880
21 Ga0065715_10091663 3300005293 Bacteria 5633
22 Ga0070658_10000148 3300005327 Bacteria 62109
23 Ga0070658_10002756 3300005327 Bacteria 14624
24 Ga0070658_10004119 3300005327 Bacteria 11919
25 Ga0070658_10025684 3300005327 Bacteria 4720
26 Ga0070658_10072156 3300005327 Bacteria 2829
27 Ga0070676_10002715 3300005328 Bacteria 9120
28 Ga0070676_10008769 3300005328 Bacteria 5456
29 Ga0070683_100000968 3300005329 Bacteria 21373
30 Ga0070683_100003788 3300005329 Bacteria 12348
31 Ga0070690_100009768 3300005330 Bacteria 5566
32 Ga0070690_100032859 3300005330 Bacteria 3243
33 Ga0070677_10000062 3300005333 Bacteria 33836
34 Ga0068869_100054786 3300005334 Bacteria 2905
35 Ga0070680_100050540 3300005336 Bacteria 3391
36 Ga0070682_100055519 3300005337 Bacteria 2488
37 Ga0070660_100002139 3300005339 Bacteria 13637
38 Ga0070660_100003576 3300005339 Bacteria 10727
39 Ga0070660_100023415 3300005339 Bacteria 4575
40 Ga0070660_100058648 3300005339 Bacteria 2984
41 Ga0070660_100063029 3300005339 Bacteria 2881
42 Ga0070660_100122379 3300005339 Bacteria 2077
43 Ga0070689_100000001 3300005340 Bacteria 1334580
44 Ga0070689_100000689 3300005340 Bacteria 20496
45 Ga0070661_100000623 3300005344 Bacteria 26346
46 Ga0070661_100074134 3300005344 Bacteria 2506
47 Ga0070692_10055008 3300005345 Bacteria 2080
48 Ga0070668_100001080 3300005347 Bacteria 19199
49 Ga0070668_100001118 3300005347 Bacteria 18921
50 Ga0070668_100046036 3300005347 Bacteria 3348
51 Ga0070669_100001497 3300005353 Bacteria 16891
52 Ga0070669_100003597 3300005353 Bacteria 11190
53 Ga0070671_100002476 3300005355 Bacteria 14278
54 Ga0070674_100011980 3300005356 Bacteria 5308
55 Ga0070673_100001203 3300005364 Bacteria 14925
56 Ga0070673_100016660 3300005364 Bacteria 5204
57 Ga0070688_100002052 3300005365 Bacteria 10166
58 Ga0070659_100000559 3300005366 Bacteria 27167
59 Ga0070659_100000969 3300005366 Bacteria 21113
60 Ga0070659_100009726 3300005366 Bacteria 7062
61 Ga0070659_100010323 3300005366 Bacteria 6869
62 Ga0070709_10034271 3300005434 Bacteria 3077
63 Ga0070714_100000278 3300005435 Bacteria 39215
64 Ga0070714_100037931 3300005435 Bacteria 4052
65 Ga0070713_100218089 3300005436 Bacteria 1730
66 Ga0070711_100003769 3300005439 Bacteria 8891
67 Ga0070711_100011897 3300005439 Bacteria 5414
68 Ga0070705_100000235 3300005440 Bacteria 32814
69 Ga0070700_100008137 3300005441 Bacteria 5703
70 Ga0070663_100002397 3300005455 Bacteria 10539
71 Ga0070678_100003721 3300005456 Bacteria 8537
72 Ga0070662_100000177 3300005457 Bacteria 37092
73 Ga0070681_10000273 3300005458 Bacteria 41372
74 Ga0070681_10001513 3300005458 Bacteria 20594
75 Ga0068867_100001634 3300005459 Bacteria 15597
76 Ga0070685_10001035 3300005466 Bacteria 14925
77 Ga0070685_10033820 3300005466 Bacteria 2875
78 Ga0070698_100008595 3300005471 Bacteria 11010
79 Ga0070679_100001215 3300005530 Bacteria 22690
80 Ga0070679_100002855 3300005530 Bacteria 15697
81 Ga0070679_100003777 3300005530 Bacteria 13900
82 Ga0070684_100005017 3300005535 Bacteria 10113
83 Ga0070684_100038676 3300005535 Bacteria 4100
84 Ga0070697_100029007 3300005536 Bacteria 4434
85 Ga0070697_100106741 3300005536 Bacteria 2330
86 Ga0068853_100000047 3300005539 Bacteria 95191
87 Ga0068853_100002106 3300005539 Bacteria 14771
88 Ga0068853_100002354 3300005539 Bacteria 14138
89 Ga0070672_100000356 3300005543 Bacteria 26337
90 Ga0070686_100000081 3300005544 Bacteria 69623
91 Ga0070696_100000426 3300005546 Bacteria 26443
92 Ga0070696_100012881 3300005546 Bacteria 5613
93 Ga0070693_100002481 3300005547 Bacteria 8501
94 Ga0070665_100016870 3300005548 Bacteria 7322
95 Ga0070665_100020435 3300005548 Bacteria 6650
96 Ga0068855_100001006 3300005563 Bacteria 35160
97 Ga0068855_100001992 3300005563 Bacteria 25358
98 Ga0068855_100003377 3300005563 Bacteria 19556
99 Ga0068855_100071371 3300005563 Bacteria 4038
100 Ga0068855_100112411 3300005563 Bacteria 3125
101 Ga0068855_100114266 3300005563 Bacteria 3095
102 Ga0068855_100175317 3300005563 Bacteria 2426
103 Ga0070664_100004710 3300005564 Bacteria 10940
104 Ga0070664_100010749 3300005564 Bacteria 7421
105 Ga0068857_100000447 3300005577 Bacteria 29347
106 Ga0068857_100050193 3300005577 Bacteria 3702
107 Ga0068854_100000028 3300005578 Bacteria 116572
108 Ga0068854_100000195 3300005578 Bacteria 40820
109 Ga0068856_100005824 3300005614 Bacteria 12146
110 Ga0068856_100010662 3300005614 Bacteria 8929
111 Ga0068856_100024475 3300005614 Bacteria 5879
112 Ga0068856_100031292 3300005614 Bacteria 5205
113 Ga0068852_100000190 3300005616 Bacteria 41635
114 Ga0068852_100033012 3300005616 Bacteria 4293
115 Ga0068852_100050027 3300005616 Bacteria 3578
116 Ga0068859_100008059 3300005617 Bacteria 10681
117 Ga0068859_100010700 3300005617 Bacteria 9235
118 Ga0068864_100003151 3300005618 Bacteria 13633
119 Ga0068866_10000018 3300005718 Bacteria 65387
120 Ga0068861_100000047 3300005719 Bacteria 56183
121 Ga0068861_100029123 3300005719 Bacteria 4036
122 Ga0068861_100061717 3300005719 Bacteria 2877
123 Ga0068851_10001453 3300005834 Bacteria 10377
124 Ga0068870_10000185 3300005840 Bacteria 22278
125 Ga0068863_100001633 3300005841 Bacteria 22169
126 Ga0068858_100066266 3300005842 Bacteria 3343
127 Ga0068858_100128249 3300005842 Bacteria 2377
128 Ga0068860_100001275 3300005843 Bacteria 27401
129 Ga0068862_100000904 3300005844 Bacteria 28745
130 Ga0068862_100077046 3300005844 Bacteria 2887
131 Ga0081540_1000141 3300005983 Bacteria 75070
132 Ga0081540_1000258 3300005983 Bacteria 55927
133 Ga0081539_10001769 3300005985 Bacteria 34433
134 Ga0075369_10016040 3300006186 Bacteria 3016
135 Ga0068871_100002040 3300006358 Bacteria 13691
136 Ga0075433_10019163 3300006852 Bacteria 5694
137 Ga0097620_100008059 3300006931 Bacteria 10681
138 Ga0097620_100010700 3300006931 Bacteria 9235
139 Ga0105240_10002135 3300009093 Bacteria 32315
140 Ga0105240_10002211 3300009093 Bacteria 31723
141 Ga0105240_10002384 3300009093 Bacteria 30289
142 Ga0105240_10008587 3300009093 Bacteria 14601
143 Ga0105240_10009539 3300009093 Bacteria 13742
144 Ga0105240_10011435 3300009093 Bacteria 12363
145 Ga0105240_10016806 3300009093 Bacteria 9894
146 Ga0105240_10040285 3300009093 Bacteria 5976
147 Ga0105240_10103252 3300009093 Bacteria 3464
148 Ga0105240_10148128 3300009093 Bacteria 2799
149 Ga0111539_10020198 3300009094 Bacteria 8209
150 Ga0105245_10000390 3300009098 Bacteria 40849
151 Ga0105247_10000104 3300009101 Bacteria 90342
152 Ga0114129_10077597 3300009147 Bacteria 4620
153 Ga0114129_10335141 3300009147 Bacteria 2008
154 Ga0105243_10000752 3300009148 Bacteria 31053
155 Ga0105243_10057013 3300009148 Bacteria 3109
156 Ga0105241_10003660 3300009174 Bacteria 11414
157 Ga0105241_10010134 3300009174 Bacteria 6919
158 Ga0105241_10017433 3300009174 Bacteria 5280
159 Ga0105242_10021807 3300009176 Bacteria 5034
160 Ga0105248_10010779 3300009177 Bacteria 10091
161 Ga0105248_10025216 3300009177 Bacteria 6610
162 Ga0105237_10000003 3300009545 Bacteria 556908
163 Ga0105237_10000155 3300009545 Bacteria 96466
164 Ga0105237_10000477 3300009545 Bacteria 56910
165 Ga0105237_10060374 3300009545 Bacteria 3793
166 Ga0105237_10103394 3300009545 Bacteria 2840
167 Ga0105238_10001952 3300009551 Bacteria 20762
168 Ga0105238_10002273 3300009551 Bacteria 19359
169 Ga0105238_10004758 3300009551 Bacteria 13429
170 Ga0105238_10054978 3300009551 Bacteria 3997
171 Ga0105238_10108265 3300009551 Bacteria 2760
172 Ga0105249_10000480 3300009553 Bacteria 37106
173 Ga0105249_10000482 3300009553 Bacteria 37079
174 Ga0105239_10002042 3300010375 Bacteria 26177
175 Ga0105239_10082911 3300010375 Bacteria 3531
176 Ga0105239_10121542 3300010375 Bacteria 2900
177 Ga0105239_10246161 3300010375 Bacteria 2007
178 Ga0157373_10001527 3300013100 Bacteria 17647
179 Ga0157371_10000392 3300013102 Bacteria 55061
180 Ga0157370_10004005 3300013104 Bacteria 17116
181 Ga0157370_10024199 3300013104 Bacteria 6017
182 Ga0157370_10034214 3300013104 Bacteria 4951
183 Ga0157369_10000538 3300013105 Bacteria 50087
184 Ga0157369_10008292 3300013105 Bacteria 11911
185 Ga0157369_10020640 3300013105 Bacteria 7367
186 Ga0157369_10026622 3300013105 Bacteria 6414
187 Ga0157369_10033938 3300013105 Bacteria 5604
188 Ga0157369_10039369 3300013105 Bacteria 5166
189 Ga0157369_10121746 3300013105 Bacteria 2768
190 Ga0157374_10000407 3300013296 Bacteria 39138
191 Ga0157374_10000557 3300013296 Bacteria 33126
192 Ga0157374_10019378 3300013296 Bacteria 6021
193 Ga0157378_10000974 3300013297 Bacteria 26210
194 Ga0157378_10001370 3300013297 Bacteria 21881
195 Ga0163162_10000477 3300013306 Bacteria 37086
196 Ga0163162_10000594 3300013306 Bacteria 33577
197 Ga0163162_10003163 3300013306 Bacteria 15734
198 Ga0163162_10088538 3300013306 Bacteria 3175
199 Ga0157372_10001450 3300013307 Bacteria 25669
200 Ga0157372_10022551 3300013307 Bacteria 6814
201 Ga0157372_10028052 3300013307 Bacteria 6140
202 Ga0157372_10035349 3300013307 Bacteria 5500
203 Ga0157372_10044676 3300013307 Bacteria 4910
204 Ga0157372_10060155 3300013307 Bacteria 4250
205 Ga0157375_10000315 3300013308 Bacteria 43356
206 Ga0157377_10000774 3300014745 Bacteria 13244
207 Ga0157379_10000098 3300014968 Bacteria 59060
208 Ga0157376_10003437 3300014969 Bacteria 10902
209 Ga0157376_10008204 3300014969 Bacteria 7516
210 Ga0157376_10141857 3300014969 Bacteria 2156
211 Ga0182006_1004912 3300015261 Bacteria 6477
212 Ga0183362_10002 3300015683 Bacteria 1432711
213 Ga0183369_1014 3300015685 Bacteria 194173
214 Ga0163161_10001681 3300017792 Bacteria 16233
215 Ga0213872_10004253 3300021361 Bacteria 7675
216 Ga0213872_10005267 3300021361 Bacteria 6686
217 Ga0213872_10006854 3300021361 Bacteria 5671
218 Ga0213876_10011967 3300021384 Bacteria 4622
219 Ga0209672_100045 3300025228 Bacteria 264926
220 Ga0209672_101754 3300025228 Bacteria 6823
221 Ga0207427_100036 3300025231 Bacteria 309540
222 Ga0209437_100210 3300025233 Bacteria 109261
223 Ga0209258_100035 3300025242 Bacteria 430864
224 Ga0209258_100125 3300025242 Bacteria 178709
225 Ga0209258_100889 3300025242 Bacteria 15583
226 Ga0209646_1000881 3300025246 Bacteria 9947
227 Ga0209026_1000579 3300025250 Bacteria 24109
228 Ga0209148_1000045 3300025254 Bacteria 448076
229 Ga0209148_1000048 3300025254 Bacteria 430913
230 Ga0209759_1000571 3300025256 Bacteria 37036
231 Ga0209233_1000101 3300025261 Bacteria 286063
232 Ga0209455_1000035 3300025272 Bacteria 479071
233 Ga0207697_10002671 3300025315 Bacteria 9127
234 Ga0207682_10000996 3300025893 Bacteria 13089
235 Ga0207710_10000328 3300025900 Bacteria 35933
236 Ga0207688_10000047 3300025901 Bacteria 42677
237 Ga0207680_10000080 3300025903 Bacteria 43434
238 Ga0207647_10000763 3300025904 Bacteria 25154
239 Ga0207647_10013124 3300025904 Bacteria 5756
240 Ga0207647_10061317 3300025904 Bacteria 2296
241 Ga0207645_10000257 3300025907 Bacteria 43847
242 Ga0207645_10011020 3300025907 Bacteria 6186
243 Ga0207643_10000002 3300025908 Bacteria 224909
244 Ga0207705_10004041 3300025909 Bacteria 11153
245 Ga0207705_10004454 3300025909 Bacteria 10580
246 Ga0207705_10005603 3300025909 Bacteria 9386
247 Ga0207705_10036376 3300025909 Bacteria 3524
248 Ga0207705_10055119 3300025909 Bacteria 2866
249 Ga0207705_10056444 3300025909 Bacteria 2831
250 Ga0207684_10128840 3300025910 Bacteria 2172
251 Ga0207654_10002132 3300025911 Bacteria 10130
252 Ga0207707_10000008 3300025912 Bacteria 330313
253 Ga0207695_10000001 3300025913 Bacteria 2888630
254 Ga0207695_10000341 3300025913 Bacteria 109857
255 Ga0207695_10002046 3300025913 Bacteria 30915
256 Ga0207695_10006216 3300025913 Bacteria 15547
257 Ga0207695_10017088 3300025913 Bacteria 8458
258 Ga0207695_10024652 3300025913 Bacteria 6757
259 Ga0207695_10027566 3300025913 Bacteria 6323
260 Ga0207695_10033443 3300025913 Bacteria 5606
261 Ga0207695_10060383 3300025913 Bacteria 3925
262 Ga0207695_10071696 3300025913 Bacteria 3538
263 Ga0207695_10175337 3300025913 Bacteria 2067
264 Ga0207671_10000012 3300025914 Bacteria 519494
265 Ga0207671_10000683 3300025914 Bacteria 44055
266 Ga0207671_10006018 3300025914 Bacteria 10960
267 Ga0207693_10001958 3300025915 Bacteria 18059
268 Ga0207663_10005871 3300025916 Bacteria 6227
269 Ga0207660_10001514 3300025917 Bacteria 15632
270 Ga0207660_10009761 3300025917 Bacteria 6213
271 Ga0207660_10049376 3300025917 Bacteria 2982
272 Ga0207662_10000011 3300025918 Bacteria 90777
273 Ga0207662_10003044 3300025918 Bacteria 8558
274 Ga0207662_10010529 3300025918 Bacteria 5110
275 Ga0207657_10000323 3300025919 Bacteria 50878
276 Ga0207657_10001624 3300025919 Bacteria 24210
277 Ga0207657_10004100 3300025919 Bacteria 15473
278 Ga0207657_10017475 3300025919 Bacteria 6874
279 Ga0207657_10128034 3300025919 Bacteria 2083
280 Ga0207649_10000683 3300025920 Bacteria 22530
281 Ga0207649_10003768 3300025920 Bacteria 8269
282 Ga0207649_10018949 3300025920 Bacteria 3926
283 Ga0207652_10000065 3300025921 Bacteria 111252
284 Ga0207652_10002226 3300025921 Bacteria 16546
285 Ga0207652_10005711 3300025921 Bacteria 10101
286 Ga0207652_10016472 3300025921 Bacteria 6036
287 Ga0207652_10020661 3300025921 Bacteria 5426
288 Ga0207681_10001307 3300025923 Bacteria 16051
289 Ga0207681_10001444 3300025923 Bacteria 15287
290 Ga0207694_10002039 3300025924 Bacteria 16728
291 Ga0207694_10003498 3300025924 Bacteria 12484
292 Ga0207694_10003671 3300025924 Bacteria 12148
293 Ga0207694_10007539 3300025924 Bacteria 8246
294 Ga0207650_10000356 3300025925 Bacteria 44083
295 Ga0207659_10000104 3300025926 Bacteria 50387
296 Ga0207687_10006539 3300025927 Bacteria 7699
297 Ga0207700_10142434 3300025928 Bacteria 1971
298 Ga0207664_10000053 3300025929 Bacteria 128647
299 Ga0207690_10001767 3300025932 Bacteria 13287
300 Ga0207690_10002631 3300025932 Bacteria 10812
301 Ga0207706_10000078 3300025933 Bacteria 100847
302 Ga0207686_10017096 3300025934 Bacteria 4081
303 Ga0207709_10036430 3300025935 Bacteria 2915
304 Ga0207670_10000002 3300025936 Bacteria 783058
305 Ga0207670_10000399 3300025936 Bacteria 25002
306 Ga0207669_10001368 3300025937 Bacteria 10378
307 Ga0207704_10000264 3300025938 Bacteria 25198
308 Ga0207691_10000396 3300025940 Bacteria 43675
309 Ga0207691_10012657 3300025940 Bacteria 8081
310 Ga0207711_10000261 3300025941 Bacteria 57333
311 Ga0207689_10000346 3300025942 Bacteria 43356
312 Ga0207689_10022129 3300025942 Bacteria 5346
313 Ga0207661_10003364 3300025944 Bacteria 11111
314 Ga0207661_10167233 3300025944 Bacteria 1912
315 Ga0207679_10000445 3300025945 Bacteria 29158
316 Ga0207679_10000545 3300025945 Bacteria 25290
317 Ga0207679_10014587 3300025945 Bacteria 5170
318 Ga0207667_10001100 3300025949 Bacteria 34289
319 Ga0207667_10003445 3300025949 Bacteria 19521
320 Ga0207667_10006862 3300025949 Bacteria 13755
321 Ga0207667_10011261 3300025949 Bacteria 10405
322 Ga0207667_10064365 3300025949 Bacteria 3829
323 Ga0207667_10143595 3300025949 Bacteria 2457
324 Ga0207667_10152108 3300025949 Bacteria 2381
325 Ga0207667_10244701 3300025949 Bacteria 1835
326 Ga0207651_10000020 3300025960 Bacteria 83049
327 Ga0207651_10021823 3300025960 Bacteria 3900
328 Ga0207651_10165299 3300025960 Bacteria 1739
329 Ga0207712_10000164 3300025961 Bacteria 68361
330 Ga0207712_10000611 3300025961 Bacteria 28386
331 Ga0207712_10170325 3300025961 Bacteria 1701
332 Ga0207668_10000692 3300025972 Bacteria 20664
333 Ga0207668_10067206 3300025972 Bacteria 2544
334 Ga0207640_10000011 3300025981 Bacteria 252283
335 Ga0207640_10000302 3300025981 Bacteria 32782
336 Ga0207658_10000372 3300025986 Bacteria 44124
337 Ga0207677_10000079 3300026023 Bacteria 79753
338 Ga0207677_10073407 3300026023 Bacteria 2423
339 Ga0207703_10000148 3300026035 Bacteria 81341
340 Ga0207703_10000236 3300026035 Bacteria 62877
341 Ga0207703_10058800 3300026035 Bacteria 3139
342 Ga0207639_10000025 3300026041 Bacteria 207451
343 Ga0207639_10001005 3300026041 Bacteria 19187
344 Ga0207639_10009973 3300026041 Bacteria 6566
345 Ga0207639_10030937 3300026041 Bacteria 3931
346 Ga0207678_10002030 3300026067 Bacteria 18379
347 Ga0207678_10040085 3300026067 Bacteria 4062
348 Ga0207708_10000459 3300026075 Bacteria 31665
349 Ga0207708_10007615 3300026075 Bacteria 8015
350 Ga0207702_10013465 3300026078 Bacteria 6798
351 Ga0207702_10014773 3300026078 Bacteria 6477
352 Ga0207702_10020798 3300026078 Bacteria 5427
353 Ga0207702_10227865 3300026078 Bacteria 1740
354 Ga0207648_10000378 3300026089 Bacteria 49045
355 Ga0207648_10014975 3300026089 Bacteria 7144
356 Ga0207676_10000341 3300026095 Bacteria 40111
357 Ga0207674_10006281 3300026116 Bacteria 14005
358 Ga0207675_100000006 3300026118 Bacteria 189749
359 Ga0207675_100002900 3300026118 Bacteria 16867
360 Ga0207675_100071494 3300026118 Bacteria 3244
361 Ga0207698_10004730 3300026142 Bacteria 8327
362 Ga0207698_10005013 3300026142 Bacteria 8123
363 Ga0207698_10008267 3300026142 Bacteria 6570
364 Ga0207698_10015426 3300026142 Bacteria 5115
365 Ga0207698_10036368 3300026142 Bacteria 3614
366 Ga0207698_10101622 3300026142 Bacteria 2385
367 Ga0207428_10022849 3300027907 Bacteria 5271
368 Ga0268266_10000723 3300028379 Bacteria 44339
369 Ga0268266_10043407 3300028379 Bacteria 3842
370 Ga0268266_10079199 3300028379 Bacteria 2860
371 Ga0268265_10000340 3300028380 Bacteria 50814
372 Ga0268264_10000995 3300028381 Bacteria 28888
373 Ga0265319_1010564 3300028563 Bacteria 3844
374 Ga0265318_10000050 3300028577 Bacteria 118340
375 Ga0307515_10000008 3300028794 Bacteria 663660
376 Ga0307515_10105508 3300028794 Bacteria 3354
377 Ga0265338_10000097 3300028800 Bacteria 161237
378 Ga0265330_10000009 3300031235 Bacteria 190785
379 Ga0265330_10001153 3300031235 Bacteria 15761
380 Ga0265328_10001547 3300031239 Bacteria 10608
381 Ga0265320_10000006 3300031240 Bacteria 333442
382 Ga0265329_10003498 3300031242 Bacteria 6819
383 Ga0265339_10005376 3300031249 Bacteria 8530
384 Ga0265331_10000004 3300031250 Bacteria 476985
385 Ga0265316_10085839 3300031344 Bacteria 2407
386 Ga0265313_10001612 3300031595 Bacteria 20955
387 Ga0265313_10030672 3300031595 Bacteria 2764
388 Ga0265314_10000014 3300031711 Bacteria 400363
389 Ga0265314_10002587 3300031711 Bacteria 18310
390 Ga0265314_10011629 3300031711 Bacteria 7245
391 Ga0265342_10000404 3300031712 Bacteria 47716
392 Ga0307412_10001844 3300031911 Bacteria 11747
393 Ga0373950_0000005 3300034818 Bacteria 404272
394 Ga0373950_0000061 3300034818 Bacteria 67878
395 Ga0373954_0017278 3300035118 Bacteria 3238
396 Ga0373957_0030788 3300035120 Bacteria 1968
397 Ga0373927_0005550 3300035695 Bacteria 8677
398 Ga0373933_0001652 3300035724 Bacteria 12975
399 Ga0373937_0017744 3300036401 Bacteria 6348
400 Ga0373937_0164785 3300036401 Bacteria 2078
401 Ga0373925_0014340 3300037068 Bacteria 5734
402 Ga0373925_0028864 3300037068 Bacteria 4067
403 Ga0373925_0063820 3300037068 Bacteria 2772
404 Ga0395899_0060574 3300037312 Bacteria 2789
405 Ga0395900_0000013 3300037418 Bacteria 388765
406 Ga0395900_0000617 3300037418 Bacteria 48154
407 Ga0395900_0092338 3300037418 Unclassified 3110
408 Ga0395900_0106729 3300037418 Bacteria 2877
409 Ga0395898_0000303 3300037466 Bacteria 117164
410 Ga0395898_0002048 3300037466 Bacteria 25191
411 Ga0395905_0046398 3300037471 Bacteria 4074
412 Ga0436364_0133609 3300037853 Bacteria 22529
413 Ga0436365_1252353 3300039437 Bacteria 3225
414 Ga0436365_1480745 3300039437 Bacteria 4734
415 Ga0436360_0390756 3300039438 Bacteria 4970
416 Ga0436361_0141304 3300039447 Bacteria 2723
417 Ga0436361_0164894 3300039447 Bacteria 9539
418 Ga0436361_1114110 3300039447 Bacteria 15913
419 Ga0436361_1140677 3300039447 Bacteria 7485
420 Ga0436363_0017557 3300039450 Bacteria 3854
421 Ga0436362_0694326 3300039453 Bacteria 4389
422 Ga0439465_0001943 3300041413 Bacteria 6777
423 Ga0466969_0002366 3300044656 Bacteria 10081
424 Ga0466969_0022828 3300044656 Bacteria 3226
425 Ga0466982_0000043 3300044672 Bacteria 39281
426 Ga0466965_0018118 3300044683 Bacteria 3371
427 Ga0466966_0059900 3300044684 Bacteria 2404
428 Ga0466966_0109360 3300044684 Bacteria 1705
429 Ga0466961_0002165 3300044693 Bacteria 12220
430 Ga0466961_0048258 3300044693 Bacteria 2721
431 Ga0466963_0003421 3300044694 Bacteria 9083
432 Ga0466964_0000794 3300044706 Bacteria 10278
433 Ga0453684_0099140 3300044712 Bacteria 3570
434 Ga0466970_0006491 3300044765 Bacteria 5846
435 Ga0466959_0099658 3300045049 Bacteria 2080
436 Ga0451576_0021954 3300045051 Bacteria 6930
437 Ga0466958_0016276 3300045836 Bacteria 4278
438 Ga0466958_0051338 3300045836 Bacteria 2497
439 Ga0466967_0007648 3300045976 Bacteria 7822
440 Ga0466967_0139167 3300045976 Bacteria 2260
441 Ga0495603_0002099 3300046455 Bacteria 11727
442 Ga0495629_0010888 3300046459 Bacteria 6614
443 Ga0495651_0047873 3300046462 Bacteria 3303
444 Ga0495651_0158544 3300046462 Bacteria 1624
445 Ga0495653_0025086 3300046463 Bacteria 4796
446 Ga0495580_0000482 3300046472 Bacteria 33274
447 Ga0495580_0034150 3300046472 Bacteria 3662
448 Ga0495639_0003287 3300046475 Bacteria 7012
449 Ga0495662_0001834 3300046476 Bacteria 10644
450 Ga0495664_0001233 3300046477 Bacteria 13391
451 Ga0495584_0002523 3300046491 Bacteria 10362
452 Ga0495585_0003101 3300046492 Bacteria 11413
453 Ga0495594_0000656 3300046499 Bacteria 17880
454 Ga0495594_0009135 3300046499 Bacteria 5116
455 Ga0495594_0024980 3300046499 Bacteria 3210
456 Ga0495620_0001797 3300046515 Bacteria 12614
457 Ga0495630_0007224 3300046517 Bacteria 7923
458 Ga0495630_0058688 3300046517 Bacteria 2885
459 Ga0495632_0000016 3300046519 Bacteria 232022
460 Ga0495644_0000011 3300046523 Bacteria 97543
461 Ga0495648_0004872 3300046524 Bacteria 11305
462 Ga0495652_0093008 3300046529 Bacteria 2463
463 Ga0495665_0028838 3300046531 Bacteria 2974
464 Ga0495640_0014308 3300046533 Bacteria 6008
465 Ga0495586_0008307 3300046535 Bacteria 5527
466 Ga0495645_0005967 3300046543 Bacteria 8423
467 Ga0495645_0019236 3300046543 Bacteria 4916
468 Ga0495645_0030128 3300046543 Bacteria 3952
469 Ga0495622_0013202 3300046557 Bacteria 3834
470 Ga0495667_0079665 3300046559 Bacteria 2129
471 Ga0495634_0002173 3300046642 Bacteria 16473
472 Ga0495634_0029880 3300046642 Bacteria 3768
473 Ga0495625_0004582 3300046660 Bacteria 13000
474 Ga0495625_0014217 3300046660 Bacteria 6364
475 Ga0495635_0016521 3300046663 Bacteria 5156
476 Ga0495659_0017916 3300046664 Bacteria 2354
477 Ga0495623_0035256 3300046679 Bacteria 3207
478 Ga0495646_0013801 3300046680 Bacteria 5137
479 Ga0495613_0014611 3300046689 Bacteria 5825
480 Ga0495613_0018611 3300046689 Bacteria 5178
481 Ga0495600_0004359 3300046809 Bacteria 8470
482 Ga0495581_0000504 3300047315 Bacteria 19958
483 Ga0495604_0007012 3300047317 Bacteria 8933
484 Ga0495674_0001339 3300047319 Bacteria 24024
485 Ga0495674_0018901 3300047319 Bacteria 6408
486 Ga0495680_0012546 3300047322 Bacteria 7450
487 Ga0495683_0004359 3300047323 Bacteria 8057
488 Ga0495675_0002972 3300047444 Bacteria 10175
489 Ga0495675_0024803 3300047444 Bacteria 3825
490 Ga0495673_0000018 3300047469 Bacteria 569190
491 Ga0495684_0020385 3300047471 Bacteria 5109
492 Ga0495686_0000009 3300047472 Bacteria 661643
493 Ga0495686_0000204 3300047472 Bacteria 110504
494 Ga0495686_0020931 3300047472 Bacteria 4355
495 Ga0495602_0049899 3300048088 Bacteria 3744
496 Ga0495614_0000176 3300048089 Bacteria 23701
497 Ga0496100_0007942 3300048903 Bacteria 5894
498 Ga0496101_0016442 3300048904 Bacteria 4998
499 Ga0496102_0000960 3300048905 Bacteria 27134
500 Ga0496102_0004947 3300048905 Bacteria 11292
501 Ga0496103_0018220 3300048906 Bacteria 4211
502 Ga0496103_0028216 3300048906 Bacteria 3405
503 Ga0496104_0004038 3300048907 Bacteria 12725
504 Ga0496104_0084415 3300048907 Bacteria 3030
505 Ga0496104_0127314 3300048907 Bacteria 2446
506 Ga0496106_0098926 3300048909 Bacteria 2260
507 Ga0496108_0006006 3300048911 Bacteria 9834
508 Ga0496108_0020699 3300048911 Bacteria 5407
509 Ga0496108_0032569 3300048911 Bacteria 4330
510 Ga0496109_0036098 3300048912 Bacteria 4461
511 Ga0496109_0062855 3300048912 Bacteria 3396
512 Ga0496110_0122219 3300048913 Bacteria 2347
513 Ga0496111_0023938 3300048914 Bacteria 4293
514 Ga0496112_0009377 3300048915 Bacteria 8814
515 Ga0496112_0036305 3300048915 Bacteria 4807
516 Ga0496114_0000065 3300048917 Bacteria 77292
517 Ga0496114_0014141 3300048917 Bacteria 6400
518 Ga0496114_0078124 3300048917 Bacteria 2792
519 Ga0496115_0011623 3300048918 Bacteria 6606
520 Ga0496115_0088091 3300048918 Bacteria 2534
521 Ga0496121_0026216 3300048924 Bacteria 5501
522 Ga0496126_0001516 3300048929 Bacteria 35870
523 Ga0501299_001753 3300049522 Bacteria 2879
524 Ga0501032_0039671 3300049569 Bacteria 3202
525 Ga0501032_0087678 3300049569 Bacteria 2066
526 Ga0501033_0038064 3300049570 Bacteria 3598
527 Ga0501033_0038468 3300049570 Bacteria 3575
528 Ga0501033_0071594 3300049570 Bacteria 2546
529 Ga0501034_0000963 3300049571 Bacteria 41529
530 Ga0501036_0033905 3300049572 Bacteria 4318
531 Ga0501036_0094923 3300049572 Bacteria 2521
532 Ga0501036_0130327 3300049572 Bacteria 2123
533 Ga0501038_0069120 3300049574 Bacteria 3001
534 Ga0501039_0065514 3300049575 Bacteria 2818
535 Ga0501040_0073516 3300049576 Bacteria 2362
536 Ga0501042_0090860 3300049578 Bacteria 2191
537 Ga0501043_0000305 3300049579 Bacteria 44560
538 Ga0501043_0002542 3300049579 Bacteria 15421
539 Ga0501046_0000009 3300049580 Bacteria 335813
540 Ga0501046_0000385 3300049580 Bacteria 44283
541 Ga0501046_0004854 3300049580 Bacteria 12115
542 Ga0501046_0006733 3300049580 Bacteria 10151
543 Ga0501047_0000004 3300049581 Bacteria 463872
544 Ga0501047_0000365 3300049581 Bacteria 51203
545 Ga0501047_0015948 3300049581 Bacteria 7163
546 Ga0501048_0001146 3300049582 Bacteria 19894
547 Ga0501048_0003237 3300049582 Bacteria 12406
548 Ga0501067_0000391 3300049583 Bacteria 23873
549 Ga0501067_0002692 3300049583 Bacteria 9805
550 Ga0501067_0020311 3300049583 Bacteria 3676
551 Ga0501068_0045057 3300049584 Bacteria 2657
552 Ga0501068_0058479 3300049584 Bacteria 2339
553 Ga0501070_0000211 3300049586 Bacteria 55080
554 Ga0501070_0000928 3300049586 Bacteria 26425
555 Ga0501070_0025212 3300049586 Bacteria 4986
556 Ga0501070_0059447 3300049586 Bacteria 3169
557 Ga0501072_0000012 3300049588 Bacteria 180739
558 Ga0501073_0001323 3300049589 Bacteria 18248
559 Ga0501073_0002572 3300049589 Bacteria 13565
560 Ga0501073_0009197 3300049589 Bacteria 7288
561 Ga0501074_0002782 3300049590 Bacteria 12234
562 Ga0501074_0019112 3300049590 Bacteria 4974
563 Ga0501074_0035579 3300049590 Bacteria 3608
564 Ga0501074_0060629 3300049590 Bacteria 2726
565 Ga0501250_001008 3300049680 Bacteria 2164
566 Ga0501225_0003440 3300049705 Bacteria 4796
567 Ga0501080_0034111 3300049742 Bacteria 4750
568 Ga0501080_0088960 3300049742 Bacteria 2868
569 Ga0501080_0129262 3300049742 Bacteria 2338
570 Ga0501083_0051833 3300049744 Bacteria 2759
571 Ga0501083_0052976 3300049744 Bacteria 2724
572 Ga0501083_0075344 3300049744 Bacteria 2241
573 Ga0501044_0040095 3300049823 Bacteria 4883
574 nmdc:mga05p37_8895_c1 3300050507 Bacteria 10128
575 nmdc:mga08y16_4270_c1 3300050511 Bacteria 14915
576 nmdc:mga08x19_39410_c1 3300050514 Bacteria 3003
577 nmdc:mga0a205_19009_c1 3300050515 Bacteria 6473
578 nmdc:mga0sz30_43148_c1 3300050516 Bacteria 1898
579 Ga0495601_0008167 3300053077 Bacteria 6173
580 Ga0495601_0040481 3300053077 Bacteria 2918
581 Ga0500616_0000020 3300053153 Bacteria 530404
582 Ga0500633_0007410 3300053160 Bacteria 2761
583 Ga0501084_0000038 3300054114 Bacteria 108058
584 Ga0500661_002056 3300055283 Bacteria 3800
585 Ga0501082_0025677 3300060353 Bacteria 5076
586 Ga0530510_0071747 3300061734 Bacteria 2514
587 2671118295 2667528175 Bacteria 7532676
588 2842916665 2842914999 Bacteria 4419378
589 2842919149 2842918807 Bacteria 4289178
590 2881413417 2881412998 Bacteria 6492157
591 2919406239 2919404418 Bacteria 4232372
592 2953994575 2953994433 Bacteria 4303959
593 641645923 641522639 Bacteria 7737025
594 Ga0395905_0005646
595 LJNas_1000425
596 JGI24743J22301_10000472
597 JGI24749J21850_1000881
598 JGI25162J39368_1002980
599 JGI25157J39369_1002762
600 JGI25164J39214_1000173
601 Ga0006759J45824_1021183
602 JGI25165J46597_1000202
603 JGI25404J52841_10000845
604 Ga0032354_1048682
605 Ga0055539_1001767
606 Ga0055533_1001565
607 Ga0055527_1002653
608 Ga0055535_1001604
609 Ga0055535_1001961
610 Ga0055542_1000138
611 Ga0055542_1000159
612 Ga0055529_1000162
613 Ga0065165_1001431
614 Ga0065715_10091663
615 Ga0070658_10000148
616 Ga0070658_10002756
617 Ga0070658_10004119
618 Ga0070658_10025684
619 Ga0070658_10072156
620 Ga0070676_10002715
621 Ga0070676_10008769
622 Ga0070683_100000968
623 Ga0070683_100003788
624 Ga0070690_100009768
625 Ga0070690_100032859
626 Ga0070677_10000062
627 Ga0068869_100054786
628 Ga0070680_100050540
629 Ga0070682_100055519
630 Ga0070660_100002139
631 Ga0070660_100003576
632 Ga0070660_100023415
633 Ga0070660_100058648
634 Ga0070660_100063029
635 Ga0070660_100122379
636 Ga0070689_100000001
637 Ga0070689_100000689
638 Ga0070661_100000623
639 Ga0070661_100074134
640 Ga0070692_10055008
641 Ga0070668_100001080
642 Ga0070668_100001118
643 Ga0070668_100046036
644 Ga0070669_100001497
645 Ga0070669_100003597
646 Ga0070671_100002476
647 Ga0070674_100011980
648 Ga0070673_100001203
649 Ga0070673_100016660
650 Ga0070688_100002052
651 Ga0070659_100000559
652 Ga0070659_100000969
653 Ga0070659_100009726
654 Ga0070659_100010323
655 Ga0070709_10034271
656 Ga0070714_100000278
657 Ga0070714_100037931
658 Ga0070713_100218089
659 Ga0070711_100003769
660 Ga0070711_100011897
661 Ga0070705_100000235
662 Ga0070700_100008137
663 Ga0070663_100002397
664 Ga0070678_100003721
665 Ga0070662_100000177
666 Ga0070681_10000273
667 Ga0070681_10001513
668 Ga0068867_100001634
669 Ga0070685_10001035
670 Ga0070685_10033820
671 Ga0070698_100008595
672 Ga0070679_100001215
673 Ga0070679_100002855
674 Ga0070679_100003777
675 Ga0070684_100005017
676 Ga0070684_100038676
677 Ga0070697_100029007
678 Ga0070697_100106741
679 Ga0068853_100000047
680 Ga0068853_100002106
681 Ga0068853_100002354
682 Ga0070672_100000356
683 Ga0070686_100000081
684 Ga0070696_100000426
685 Ga0070696_100012881
686 Ga0070693_100002481
687 Ga0070665_100016870
688 Ga0070665_100020435
689 Ga0068855_100001006
690 Ga0068855_100001992
691 Ga0068855_100003377
692 Ga0068855_100071371
693 Ga0068855_100112411
694 Ga0068855_100114266
695 Ga0068855_100175317
696 Ga0070664_100004710
697 Ga0070664_100010749
698 Ga0068857_100000447
699 Ga0068857_100050193
700 Ga0068854_100000028
701 Ga0068854_100000195
702 Ga0068856_100005824
703 Ga0068856_100010662
704 Ga0068856_100024475
705 Ga0068856_100031292
706 Ga0068852_100000190
707 Ga0068852_100033012
708 Ga0068852_100050027
709 Ga0068859_100008059
710 Ga0068859_100010700
711 Ga0068864_100003151
712 Ga0068866_10000018
713 Ga0068861_100000047
714 Ga0068861_100029123
715 Ga0068861_100061717
716 Ga0068851_10001453
717 Ga0068870_10000185
718 Ga0068863_100001633
719 Ga0068858_100066266
720 Ga0068858_100128249
721 Ga0068860_100001275
722 Ga0068862_100000904
723 Ga0068862_100077046
724 Ga0081540_1000141
725 Ga0081540_1000258
726 Ga0081539_10001769
727 Ga0075369_10016040
728 Ga0068871_100002040
729 Ga0075433_10019163
730 Ga0097620_100008059
731 Ga0097620_100010700
732 Ga0105240_10002135
733 Ga0105240_10002211
734 Ga0105240_10002384
735 Ga0105240_10008587
736 Ga0105240_10009539
737 Ga0105240_10011435
738 Ga0105240_10016806
739 Ga0105240_10040285
740 Ga0105240_10103252
741 Ga0105240_10148128
742 Ga0111539_10020198
743 Ga0105245_10000390
744 Ga0105247_10000104
745 Ga0114129_10077597
746 Ga0114129_10335141
747 Ga0105243_10000752
748 Ga0105243_10057013
749 Ga0105241_10003660
750 Ga0105241_10010134
751 Ga0105241_10017433
752 Ga0105242_10021807
753 Ga0105248_10010779
754 Ga0105248_10025216
755 Ga0105237_10000003
756 Ga0105237_10000155
757 Ga0105237_10000477
758 Ga0105237_10060374
759 Ga0105237_10103394
760 Ga0105238_10001952
761 Ga0105238_10002273
762 Ga0105238_10004758
763 Ga0105238_10054978
764 Ga0105238_10108265
765 Ga0105249_10000480
766 Ga0105249_10000482
767 Ga0105239_10002042
768 Ga0105239_10082911
769 Ga0105239_10121542
770 Ga0105239_10246161
771 Ga0157373_10001527
772 Ga0157371_10000392
773 Ga0157370_10004005
774 Ga0157370_10024199
775 Ga0157370_10034214
776 Ga0157369_10000538
777 Ga0157369_10008292
778 Ga0157369_10020640
779 Ga0157369_10026622
780 Ga0157369_10033938
781 Ga0157369_10039369
782 Ga0157369_10121746
783 Ga0157374_10000407
784 Ga0157374_10000557
785 Ga0157374_10019378
786 Ga0157378_10000974
787 Ga0157378_10001370
788 Ga0163162_10000477
789 Ga0163162_10000594
790 Ga0163162_10003163
791 Ga0163162_10088538
792 Ga0157372_10001450
793 Ga0157372_10022551
794 Ga0157372_10028052
795 Ga0157372_10035349
796 Ga0157372_10044676
797 Ga0157372_10060155
798 Ga0157375_10000315
799 Ga0157377_10000774
800 Ga0157379_10000098
801 Ga0157376_10003437
802 Ga0157376_10008204
803 Ga0157376_10141857
804 Ga0182006_1004912
805 Ga0183362_10002
806 Ga0183369_1014
807 Ga0163161_10001681
808 Ga0213872_10004253
809 Ga0213872_10005267
810 Ga0213872_10006854
811 Ga0213876_10011967
812 Ga0209672_100045
813 Ga0209672_101754
814 Ga0207427_100036
815 Ga0209437_100210
816 Ga0209258_100035
817 Ga0209258_100125
818 Ga0209258_100889
819 Ga0209646_1000881
820 Ga0209026_1000579
821 Ga0209148_1000045
822 Ga0209148_1000048
823 Ga0209759_1000571
824 Ga0209233_1000101
825 Ga0209455_1000035
826 Ga0207697_10002671
827 Ga0207682_10000996
828 Ga0207710_10000328
829 Ga0207688_10000047
830 Ga0207680_10000080
831 Ga0207647_10000763
832 Ga0207647_10013124
833 Ga0207647_10061317
834 Ga0207645_10000257
835 Ga0207645_10011020
836 Ga0207643_10000002
837 Ga0207705_10004041
838 Ga0207705_10004454
839 Ga0207705_10005603
840 Ga0207705_10036376
841 Ga0207705_10055119
842 Ga0207705_10056444
843 Ga0207684_10128840
844 Ga0207654_10002132
845 Ga0207707_10000008
846 Ga0207695_10000001
847 Ga0207695_10000341
848 Ga0207695_10002046
849 Ga0207695_10006216
850 Ga0207695_10017088
851 Ga0207695_10024652
852 Ga0207695_10027566
853 Ga0207695_10033443
854 Ga0207695_10060383
855 Ga0207695_10071696
856 Ga0207695_10175337
857 Ga0207671_10000012
858 Ga0207671_10000683
859 Ga0207671_10006018
860 Ga0207693_10001958
861 Ga0207663_10005871
862 Ga0207660_10001514
863 Ga0207660_10009761
864 Ga0207660_10049376
865 Ga0207662_10000011
866 Ga0207662_10003044
867 Ga0207662_10010529
868 Ga0207657_10000323
869 Ga0207657_10001624
870 Ga0207657_10004100
871 Ga0207657_10017475
872 Ga0207657_10128034
873 Ga0207649_10000683
874 Ga0207649_10003768
875 Ga0207649_10018949
876 Ga0207652_10000065
877 Ga0207652_10002226
878 Ga0207652_10005711
879 Ga0207652_10016472
880 Ga0207652_10020661
881 Ga0207681_10001307
882 Ga0207681_10001444
883 Ga0207694_10002039
884 Ga0207694_10003498
885 Ga0207694_10003671
886 Ga0207694_10007539
887 Ga0207650_10000356
888 Ga0207659_10000104
889 Ga0207687_10006539
890 Ga0207700_10142434
891 Ga0207664_10000053
892 Ga0207690_10001767
893 Ga0207690_10002631
894 Ga0207706_10000078
895 Ga0207686_10017096
896 Ga0207709_10036430
897 Ga0207670_10000002
898 Ga0207670_10000399
899 Ga0207669_10001368
900 Ga0207704_10000264
901 Ga0207691_10000396
902 Ga0207691_10012657
903 Ga0207711_10000261
904 Ga0207689_10000346
905 Ga0207689_10022129
906 Ga0207661_10003364
907 Ga0207661_10167233
908 Ga0207679_10000445
909 Ga0207679_10000545
910 Ga0207679_10014587
911 Ga0207667_10001100
912 Ga0207667_10003445
913 Ga0207667_10006862
914 Ga0207667_10011261
915 Ga0207667_10064365
916 Ga0207667_10143595
917 Ga0207667_10152108
918 Ga0207667_10244701
919 Ga0207651_10000020
920 Ga0207651_10021823
921 Ga0207651_10165299
922 Ga0207712_10000164
923 Ga0207712_10000611
924 Ga0207712_10170325
925 Ga0207668_10000692
926 Ga0207668_10067206
927 Ga0207640_10000011
928 Ga0207640_10000302
929 Ga0207658_10000372
930 Ga0207677_10000079
931 Ga0207677_10073407
932 Ga0207703_10000148
933 Ga0207703_10000236
934 Ga0207703_10058800
935 Ga0207639_10000025
936 Ga0207639_10001005
937 Ga0207639_10009973
938 Ga0207639_10030937
939 Ga0207678_10002030
940 Ga0207678_10040085
941 Ga0207708_10000459
942 Ga0207708_10007615
943 Ga0207702_10013465
944 Ga0207702_10014773
945 Ga0207702_10020798
946 Ga0207702_10227865
947 Ga0207648_10000378
948 Ga0207648_10014975
949 Ga0207676_10000341
950 Ga0207674_10006281
951 Ga0207675_100000006
952 Ga0207675_100002900
953 Ga0207675_100071494
954 Ga0207698_10004730
955 Ga0207698_10005013
956 Ga0207698_10008267
957 Ga0207698_10015426
958 Ga0207698_10036368
959 Ga0207698_10101622
960 Ga0207428_10022849
961 Ga0268266_10000723
962 Ga0268266_10043407
963 Ga0268266_10079199
964 Ga0268265_10000340
965 Ga0268264_10000995
966 Ga0265319_1010564
967 Ga0265318_10000050
968 Ga0307515_10000008
969 Ga0307515_10105508
970 Ga0265338_10000097
971 Ga0265330_10000009
972 Ga0265330_10001153
973 Ga0265328_10001547
974 Ga0265320_10000006
975 Ga0265329_10003498
976 Ga0265339_10005376
977 Ga0265331_10000004
978 Ga0265316_10085839
979 Ga0265313_10001612
980 Ga0265313_10030672
981 Ga0265314_10000014
982 Ga0265314_10002587
983 Ga0265314_10011629
984 Ga0265342_10000404
985 Ga0307412_10001844
986 Ga0373950_0000005
987 Ga0373950_0000061
988 Ga0373954_0017278
989 Ga0373957_0030788
990 Ga0373927_0005550
991 Ga0373933_0001652
992 Ga0373937_0017744
993 Ga0373937_0164785
994 Ga0373925_0014340
995 Ga0373925_0028864
996 Ga0373925_0063820
997 Ga0395899_0060574
998 Ga0395900_0000013
999 Ga0395900_0000617
1000 Ga0395900_0092338
1001 Ga0395900_0106729
1002 Ga0395898_0000303
1003 Ga0395898_0002048
1004 Ga0395905_0046398
1005 Ga0436364_0133609
1006 Ga0436365_1252353
1007 Ga0436365_1480745
1008 Ga0436360_0390756
1009 Ga0436361_0141304
1010 Ga0436361_0164894
1011 Ga0436361_1114110
1012 Ga0436361_1140677
1013 Ga0436363_0017557
1014 Ga0436362_0694326
1015 Ga0439465_0001943
1016 Ga0466969_0002366
1017 Ga0466969_0022828
1018 Ga0466982_0000043
1019 Ga0466965_0018118
1020 Ga0466966_0059900
1021 Ga0466966_0109360
1022 Ga0466961_0002165
1023 Ga0466961_0048258
1024 Ga0466963_0003421
1025 Ga0466964_0000794
1026 Ga0453684_0099140
1027 Ga0466970_0006491
1028 Ga0466959_0099658
1029 Ga0451576_0021954
1030 Ga0466958_0016276
1031 Ga0466958_0051338
1032 Ga0466967_0007648
1033 Ga0466967_0139167
1034 Ga0495603_0002099
1035 Ga0495629_0010888
1036 Ga0495651_0047873
1037 Ga0495651_0158544
1038 Ga0495653_0025086
1039 Ga0495580_0000482
1040 Ga0495580_0034150
1041 Ga0495639_0003287
1042 Ga0495662_0001834
1043 Ga0495664_0001233
1044 Ga0495584_0002523
1045 Ga0495585_0003101
1046 Ga0495594_0000656
1047 Ga0495594_0009135
1048 Ga0495594_0024980
1049 Ga0495620_0001797
1050 Ga0495630_0007224
1051 Ga0495630_0058688
1052 Ga0495632_0000016
1053 Ga0495644_0000011
1054 Ga0495648_0004872
1055 Ga0495652_0093008
1056 Ga0495665_0028838
1057 Ga0495640_0014308
1058 Ga0495586_0008307
1059 Ga0495645_0005967
1060 Ga0495645_0019236
1061 Ga0495645_0030128
1062 Ga0495622_0013202
1063 Ga0495667_0079665
1064 Ga0495634_0002173
1065 Ga0495634_0029880
1066 Ga0495625_0004582
1067 Ga0495625_0014217
1068 Ga0495635_0016521
1069 Ga0495659_0017916
1070 Ga0495623_0035256
1071 Ga0495646_0013801
1072 Ga0495613_0014611
1073 Ga0495613_0018611
1074 Ga0495600_0004359
1075 Ga0495581_0000504
1076 Ga0495604_0007012
1077 Ga0495674_0001339
1078 Ga0495674_0018901
1079 Ga0495680_0012546
1080 Ga0495683_0004359
1081 Ga0495675_0002972
1082 Ga0495675_0024803
1083 Ga0495673_0000018
1084 Ga0495684_0020385
1085 Ga0495686_0000009
1086 Ga0495686_0000204
1087 Ga0495686_0020931
1088 Ga0495602_0049899
1089 Ga0495614_0000176
1090 Ga0496100_0007942
1091 Ga0496101_0016442
1092 Ga0496102_0000960
1093 Ga0496102_0004947
1094 Ga0496103_0018220
1095 Ga0496103_0028216
1096 Ga0496104_0004038
1097 Ga0496104_0084415
1098 Ga0496104_0127314
1099 Ga0496106_0098926
1100 Ga0496108_0006006
1101 Ga0496108_0020699
1102 Ga0496108_0032569
1103 Ga0496109_0036098
1104 Ga0496109_0062855
1105 Ga0496110_0122219
1106 Ga0496111_0023938
1107 Ga0496112_0009377
1108 Ga0496112_0036305
1109 Ga0496114_0000065
1110 Ga0496114_0014141
1111 Ga0496114_0078124
1112 Ga0496115_0011623
1113 Ga0496115_0088091
1114 Ga0496121_0026216
1115 Ga0496126_0001516
1116 Ga0501299_001753
1117 Ga0501032_0039671
1118 Ga0501032_0087678
1119 Ga0501033_0038064
1120 Ga0501033_0038468
1121 Ga0501033_0071594
1122 Ga0501034_0000963
1123 Ga0501036_0033905
1124 Ga0501036_0094923
1125 Ga0501036_0130327
1126 Ga0501038_0069120
1127 Ga0501039_0065514
1128 Ga0501040_0073516
1129 Ga0501042_0090860
1130 Ga0501043_0000305
1131 Ga0501043_0002542
1132 Ga0501046_0000009
1133 Ga0501046_0000385
1134 Ga0501046_0004854
1135 Ga0501046_0006733
1136 Ga0501047_0000004
1137 Ga0501047_0000365
1138 Ga0501047_0015948
1139 Ga0501048_0001146
1140 Ga0501048_0003237
1141 Ga0501067_0000391
1142 Ga0501067_0002692
1143 Ga0501067_0020311
1144 Ga0501068_0045057
1145 Ga0501068_0058479
1146 Ga0501070_0000211
1147 Ga0501070_0000928
1148 Ga0501070_0025212
1149 Ga0501070_0059447
1150 Ga0501072_0000012
1151 Ga0501073_0001323
1152 Ga0501073_0002572
1153 Ga0501073_0009197
1154 Ga0501074_0002782
1155 Ga0501074_0019112
1156 Ga0501074_0035579
1157 Ga0501074_0060629
1158 Ga0501250_001008
1159 Ga0501225_0003440
1160 Ga0501080_0034111
1161 Ga0501080_0088960
1162 Ga0501080_0129262
1163 Ga0501083_0051833
1164 Ga0501083_0052976
1165 Ga0501083_0075344
1166 Ga0501044_0040095
1167 nmdc:mga05p37_8895_c1
1168 nmdc:mga08y16_4270_c1
1169 nmdc:mga08x19_39410_c1
1170 nmdc:mga0a205_19009_c1
1171 nmdc:mga0sz30_43148_c1
1172 Ga0495601_0008167
1173 Ga0495601_0040481
1174 Ga0500616_0000020
1175 Ga0500633_0007410
1176 Ga0501084_0000038
1177 Ga0500661_002056
1178 Ga0501082_0025677
1179 Ga0530510_0071747
1180 2671118295
1181 2842916665
1182 2842919149
1183 2881413417
1184 2919406239
1185 2953994575
1186 641645923

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00115

COX1

Cytochrome C and Quinol oxidase polypeptide I

39

483

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3abk-assembly1.cif.gz_A bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k) 0.9693 30 532
3omi-assembly2.cif.gz_C catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation 0.9688 30 521
8d4t-assembly1.cif.gz_N mammalian civ with gdn bound 0.9687 30 532
3oma-assembly2.cif.gz_C catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation 0.9677 30 521
6pw1-assembly2.cif.gz_C cytochrome c oxidase delta 16 0.9677 29 523
ID Description Score Start End Superfamily
af_O21042_10_509_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9676 29 494 1.20.210.10
af_Q7HP04_41_512_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9674 27 487 1.20.210.10
2yevD01 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9637 28 540 1.20.210.10
af_Q9ZZX1_1_342_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9633 26 351 1.20.210.10
af_P03878_1_258_1.20.210.10 Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain 0.9588 26 270 1.20.210.10
ID Description Score Start End GO Terms
AF-A0A2V9YPN7-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9831 22 539 GO:0004129
GO:0005886
GO:0006119
GO:0015990
GO:0020037
GO:0022904
GO:0046872
AF-A0A0A0D6Y6-F1-model_v4 Cytochrome C oxidase subunit I 0.983 24 538 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-A0A534UJA3-F1-model_v4 Cytochrome c oxidase subunit 1 (EC 7.1.1.9) 0.9829 18 543 GO:0004129
GO:0005886
GO:0006119
GO:0015990
GO:0020037
GO:0022904
GO:0046872
AF-A0A2V6KF27-F1-model_v4 Cytochrome c oxidase subunit I 0.9826 15 538 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904
AF-A0A7Y6PLJ8-F1-model_v4 Cytochrome c oxidase subunit I 0.9826 19 539 GO:0004129
GO:0009060
GO:0015990
GO:0016020
GO:0020037
GO:0022904

Map