F467247
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 329 | 1186 | 544 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0005646|Ga0395905_0005646_6572_8338 |
| Length | 588 |
| Sequence | MSAIGIPTPVEEHPRPKTTNYLNVASSLKSWLGTGDHKRIAIMYLIAITCFFFLGASFAGAIRIELMSPAGVMFESETYNKIFSGHGIVMVFLFLVPAIPAILGNFLIPLMIGARDLAFPRLNLLSWYLYMIGGGFILVSFLAGGVDTGWTFYTPYSSLYSNSQVSLAIVGIFIAGFSSILTGINFIVTVHKMRAPGMTWFRLPLFVWSMYATSVVIVLGTPVVALTLLLVMLERVFRLPFFSPEIGGDPVLFQHMFWFYSHPAVYIMVLPGFAVISELIANFARKRIFGYHFVAFSSLGIAFLGFLLWGHHMFVSSMSMYQGLVFSLLSFLIAVPSAIKVFNWTLTLYKGNIRLQSPMLFALGFLGLFSIGGLTGLFLASAGTDMHITNTYFVVAHFHYVMVGGTLLAFLGGIHYWWPKMTGRMFNESSAKVSAVLVFIGFNVTFFPQFIVGWLGMPRRYHYYYFAPEYQVYNVMSTIGASVLAIGLILPAIYLTSSLFKGARAAANPWGAHGLEWETTSPPPTTNFLETPIVTDEVYDFDPVAEYEQQRATSEIVDPGHPYMRQTKDDVKLPPVPEAEIKPEKEND |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 15 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 26 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 109 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 110 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 119 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 120 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 122 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 182 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 186 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 187 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 188 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 189 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 191 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 192 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 193 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 194 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 202 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 213 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 227 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 228 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 229 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 230 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 278 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 281 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 282 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 286 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 287 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 288 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 307 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 308 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 321 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 322 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 323 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 324 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 325 | 2842918807 | Luteibacter sp. R-73110 | Isolate | Unclassified |
| 326 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 327 | 2919404418 | Luteibacter sp. 3190 | Isolate | Unclassified |
| 328 | 2953994433 | Luteibacter sp. W1I16 | Isolate | Rhizosphere |
| 329 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.48 |
| Metatranscriptomes | 0.34 |
| Isolates | 1.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.72 |
| Nodule | 0.17 |
| Rhizoplane | 4.22 |
| Rhizosphere | 87.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395905_0005646 | 3300037471 | Bacteria | 12726 |
| 2 | LJNas_1000425 | 3300000546 | Bacteria | 7479 |
| 3 | JGI24743J22301_10000472 | 3300001991 | Bacteria | 4644 |
| 4 | JGI24749J21850_1000881 | 3300002076 | Bacteria | 4322 |
| 5 | JGI25162J39368_1002980 | 3300002737 | Bacteria | 5613 |
| 6 | JGI25157J39369_1002762 | 3300002741 | Bacteria | 4027 |
| 7 | JGI25164J39214_1000173 | 3300002772 | Bacteria | 60197 |
| 8 | Ga0006759J45824_1021183 | 3300003163 | Bacteria | 4458 |
| 9 | JGI25165J46597_1000202 | 3300003214 | Bacteria | 87361 |
| 10 | JGI25404J52841_10000845 | 3300003659 | Bacteria | 4916 |
| 11 | Ga0032354_1048682 | 3300003693 | Bacteria | 4152 |
| 12 | Ga0055539_1001767 | 3300003752 | Bacteria | 3729 |
| 13 | Ga0055533_1001565 | 3300003756 | Bacteria | 5948 |
| 14 | Ga0055527_1002653 | 3300003760 | Bacteria | 2928 |
| 15 | Ga0055535_1001604 | 3300003761 | Bacteria | 10680 |
| 16 | Ga0055535_1001961 | 3300003761 | Bacteria | 8543 |
| 17 | Ga0055542_1000138 | 3300003762 | Bacteria | 92160 |
| 18 | Ga0055542_1000159 | 3300003762 | Bacteria | 85591 |
| 19 | Ga0055529_1000162 | 3300003763 | Bacteria | 92180 |
| 20 | Ga0065165_1001431 | 3300005262 | Bacteria | 25880 |
| 21 | Ga0065715_10091663 | 3300005293 | Bacteria | 5633 |
| 22 | Ga0070658_10000148 | 3300005327 | Bacteria | 62109 |
| 23 | Ga0070658_10002756 | 3300005327 | Bacteria | 14624 |
| 24 | Ga0070658_10004119 | 3300005327 | Bacteria | 11919 |
| 25 | Ga0070658_10025684 | 3300005327 | Bacteria | 4720 |
| 26 | Ga0070658_10072156 | 3300005327 | Bacteria | 2829 |
| 27 | Ga0070676_10002715 | 3300005328 | Bacteria | 9120 |
| 28 | Ga0070676_10008769 | 3300005328 | Bacteria | 5456 |
| 29 | Ga0070683_100000968 | 3300005329 | Bacteria | 21373 |
| 30 | Ga0070683_100003788 | 3300005329 | Bacteria | 12348 |
| 31 | Ga0070690_100009768 | 3300005330 | Bacteria | 5566 |
| 32 | Ga0070690_100032859 | 3300005330 | Bacteria | 3243 |
| 33 | Ga0070677_10000062 | 3300005333 | Bacteria | 33836 |
| 34 | Ga0068869_100054786 | 3300005334 | Bacteria | 2905 |
| 35 | Ga0070680_100050540 | 3300005336 | Bacteria | 3391 |
| 36 | Ga0070682_100055519 | 3300005337 | Bacteria | 2488 |
| 37 | Ga0070660_100002139 | 3300005339 | Bacteria | 13637 |
| 38 | Ga0070660_100003576 | 3300005339 | Bacteria | 10727 |
| 39 | Ga0070660_100023415 | 3300005339 | Bacteria | 4575 |
| 40 | Ga0070660_100058648 | 3300005339 | Bacteria | 2984 |
| 41 | Ga0070660_100063029 | 3300005339 | Bacteria | 2881 |
| 42 | Ga0070660_100122379 | 3300005339 | Bacteria | 2077 |
| 43 | Ga0070689_100000001 | 3300005340 | Bacteria | 1334580 |
| 44 | Ga0070689_100000689 | 3300005340 | Bacteria | 20496 |
| 45 | Ga0070661_100000623 | 3300005344 | Bacteria | 26346 |
| 46 | Ga0070661_100074134 | 3300005344 | Bacteria | 2506 |
| 47 | Ga0070692_10055008 | 3300005345 | Bacteria | 2080 |
| 48 | Ga0070668_100001080 | 3300005347 | Bacteria | 19199 |
| 49 | Ga0070668_100001118 | 3300005347 | Bacteria | 18921 |
| 50 | Ga0070668_100046036 | 3300005347 | Bacteria | 3348 |
| 51 | Ga0070669_100001497 | 3300005353 | Bacteria | 16891 |
| 52 | Ga0070669_100003597 | 3300005353 | Bacteria | 11190 |
| 53 | Ga0070671_100002476 | 3300005355 | Bacteria | 14278 |
| 54 | Ga0070674_100011980 | 3300005356 | Bacteria | 5308 |
| 55 | Ga0070673_100001203 | 3300005364 | Bacteria | 14925 |
| 56 | Ga0070673_100016660 | 3300005364 | Bacteria | 5204 |
| 57 | Ga0070688_100002052 | 3300005365 | Bacteria | 10166 |
| 58 | Ga0070659_100000559 | 3300005366 | Bacteria | 27167 |
| 59 | Ga0070659_100000969 | 3300005366 | Bacteria | 21113 |
| 60 | Ga0070659_100009726 | 3300005366 | Bacteria | 7062 |
| 61 | Ga0070659_100010323 | 3300005366 | Bacteria | 6869 |
| 62 | Ga0070709_10034271 | 3300005434 | Bacteria | 3077 |
| 63 | Ga0070714_100000278 | 3300005435 | Bacteria | 39215 |
| 64 | Ga0070714_100037931 | 3300005435 | Bacteria | 4052 |
| 65 | Ga0070713_100218089 | 3300005436 | Bacteria | 1730 |
| 66 | Ga0070711_100003769 | 3300005439 | Bacteria | 8891 |
| 67 | Ga0070711_100011897 | 3300005439 | Bacteria | 5414 |
| 68 | Ga0070705_100000235 | 3300005440 | Bacteria | 32814 |
| 69 | Ga0070700_100008137 | 3300005441 | Bacteria | 5703 |
| 70 | Ga0070663_100002397 | 3300005455 | Bacteria | 10539 |
| 71 | Ga0070678_100003721 | 3300005456 | Bacteria | 8537 |
| 72 | Ga0070662_100000177 | 3300005457 | Bacteria | 37092 |
| 73 | Ga0070681_10000273 | 3300005458 | Bacteria | 41372 |
| 74 | Ga0070681_10001513 | 3300005458 | Bacteria | 20594 |
| 75 | Ga0068867_100001634 | 3300005459 | Bacteria | 15597 |
| 76 | Ga0070685_10001035 | 3300005466 | Bacteria | 14925 |
| 77 | Ga0070685_10033820 | 3300005466 | Bacteria | 2875 |
| 78 | Ga0070698_100008595 | 3300005471 | Bacteria | 11010 |
| 79 | Ga0070679_100001215 | 3300005530 | Bacteria | 22690 |
| 80 | Ga0070679_100002855 | 3300005530 | Bacteria | 15697 |
| 81 | Ga0070679_100003777 | 3300005530 | Bacteria | 13900 |
| 82 | Ga0070684_100005017 | 3300005535 | Bacteria | 10113 |
| 83 | Ga0070684_100038676 | 3300005535 | Bacteria | 4100 |
| 84 | Ga0070697_100029007 | 3300005536 | Bacteria | 4434 |
| 85 | Ga0070697_100106741 | 3300005536 | Bacteria | 2330 |
| 86 | Ga0068853_100000047 | 3300005539 | Bacteria | 95191 |
| 87 | Ga0068853_100002106 | 3300005539 | Bacteria | 14771 |
| 88 | Ga0068853_100002354 | 3300005539 | Bacteria | 14138 |
| 89 | Ga0070672_100000356 | 3300005543 | Bacteria | 26337 |
| 90 | Ga0070686_100000081 | 3300005544 | Bacteria | 69623 |
| 91 | Ga0070696_100000426 | 3300005546 | Bacteria | 26443 |
| 92 | Ga0070696_100012881 | 3300005546 | Bacteria | 5613 |
| 93 | Ga0070693_100002481 | 3300005547 | Bacteria | 8501 |
| 94 | Ga0070665_100016870 | 3300005548 | Bacteria | 7322 |
| 95 | Ga0070665_100020435 | 3300005548 | Bacteria | 6650 |
| 96 | Ga0068855_100001006 | 3300005563 | Bacteria | 35160 |
| 97 | Ga0068855_100001992 | 3300005563 | Bacteria | 25358 |
| 98 | Ga0068855_100003377 | 3300005563 | Bacteria | 19556 |
| 99 | Ga0068855_100071371 | 3300005563 | Bacteria | 4038 |
| 100 | Ga0068855_100112411 | 3300005563 | Bacteria | 3125 |
| 101 | Ga0068855_100114266 | 3300005563 | Bacteria | 3095 |
| 102 | Ga0068855_100175317 | 3300005563 | Bacteria | 2426 |
| 103 | Ga0070664_100004710 | 3300005564 | Bacteria | 10940 |
| 104 | Ga0070664_100010749 | 3300005564 | Bacteria | 7421 |
| 105 | Ga0068857_100000447 | 3300005577 | Bacteria | 29347 |
| 106 | Ga0068857_100050193 | 3300005577 | Bacteria | 3702 |
| 107 | Ga0068854_100000028 | 3300005578 | Bacteria | 116572 |
| 108 | Ga0068854_100000195 | 3300005578 | Bacteria | 40820 |
| 109 | Ga0068856_100005824 | 3300005614 | Bacteria | 12146 |
| 110 | Ga0068856_100010662 | 3300005614 | Bacteria | 8929 |
| 111 | Ga0068856_100024475 | 3300005614 | Bacteria | 5879 |
| 112 | Ga0068856_100031292 | 3300005614 | Bacteria | 5205 |
| 113 | Ga0068852_100000190 | 3300005616 | Bacteria | 41635 |
| 114 | Ga0068852_100033012 | 3300005616 | Bacteria | 4293 |
| 115 | Ga0068852_100050027 | 3300005616 | Bacteria | 3578 |
| 116 | Ga0068859_100008059 | 3300005617 | Bacteria | 10681 |
| 117 | Ga0068859_100010700 | 3300005617 | Bacteria | 9235 |
| 118 | Ga0068864_100003151 | 3300005618 | Bacteria | 13633 |
| 119 | Ga0068866_10000018 | 3300005718 | Bacteria | 65387 |
| 120 | Ga0068861_100000047 | 3300005719 | Bacteria | 56183 |
| 121 | Ga0068861_100029123 | 3300005719 | Bacteria | 4036 |
| 122 | Ga0068861_100061717 | 3300005719 | Bacteria | 2877 |
| 123 | Ga0068851_10001453 | 3300005834 | Bacteria | 10377 |
| 124 | Ga0068870_10000185 | 3300005840 | Bacteria | 22278 |
| 125 | Ga0068863_100001633 | 3300005841 | Bacteria | 22169 |
| 126 | Ga0068858_100066266 | 3300005842 | Bacteria | 3343 |
| 127 | Ga0068858_100128249 | 3300005842 | Bacteria | 2377 |
| 128 | Ga0068860_100001275 | 3300005843 | Bacteria | 27401 |
| 129 | Ga0068862_100000904 | 3300005844 | Bacteria | 28745 |
| 130 | Ga0068862_100077046 | 3300005844 | Bacteria | 2887 |
| 131 | Ga0081540_1000141 | 3300005983 | Bacteria | 75070 |
| 132 | Ga0081540_1000258 | 3300005983 | Bacteria | 55927 |
| 133 | Ga0081539_10001769 | 3300005985 | Bacteria | 34433 |
| 134 | Ga0075369_10016040 | 3300006186 | Bacteria | 3016 |
| 135 | Ga0068871_100002040 | 3300006358 | Bacteria | 13691 |
| 136 | Ga0075433_10019163 | 3300006852 | Bacteria | 5694 |
| 137 | Ga0097620_100008059 | 3300006931 | Bacteria | 10681 |
| 138 | Ga0097620_100010700 | 3300006931 | Bacteria | 9235 |
| 139 | Ga0105240_10002135 | 3300009093 | Bacteria | 32315 |
| 140 | Ga0105240_10002211 | 3300009093 | Bacteria | 31723 |
| 141 | Ga0105240_10002384 | 3300009093 | Bacteria | 30289 |
| 142 | Ga0105240_10008587 | 3300009093 | Bacteria | 14601 |
| 143 | Ga0105240_10009539 | 3300009093 | Bacteria | 13742 |
| 144 | Ga0105240_10011435 | 3300009093 | Bacteria | 12363 |
| 145 | Ga0105240_10016806 | 3300009093 | Bacteria | 9894 |
| 146 | Ga0105240_10040285 | 3300009093 | Bacteria | 5976 |
| 147 | Ga0105240_10103252 | 3300009093 | Bacteria | 3464 |
| 148 | Ga0105240_10148128 | 3300009093 | Bacteria | 2799 |
| 149 | Ga0111539_10020198 | 3300009094 | Bacteria | 8209 |
| 150 | Ga0105245_10000390 | 3300009098 | Bacteria | 40849 |
| 151 | Ga0105247_10000104 | 3300009101 | Bacteria | 90342 |
| 152 | Ga0114129_10077597 | 3300009147 | Bacteria | 4620 |
| 153 | Ga0114129_10335141 | 3300009147 | Bacteria | 2008 |
| 154 | Ga0105243_10000752 | 3300009148 | Bacteria | 31053 |
| 155 | Ga0105243_10057013 | 3300009148 | Bacteria | 3109 |
| 156 | Ga0105241_10003660 | 3300009174 | Bacteria | 11414 |
| 157 | Ga0105241_10010134 | 3300009174 | Bacteria | 6919 |
| 158 | Ga0105241_10017433 | 3300009174 | Bacteria | 5280 |
| 159 | Ga0105242_10021807 | 3300009176 | Bacteria | 5034 |
| 160 | Ga0105248_10010779 | 3300009177 | Bacteria | 10091 |
| 161 | Ga0105248_10025216 | 3300009177 | Bacteria | 6610 |
| 162 | Ga0105237_10000003 | 3300009545 | Bacteria | 556908 |
| 163 | Ga0105237_10000155 | 3300009545 | Bacteria | 96466 |
| 164 | Ga0105237_10000477 | 3300009545 | Bacteria | 56910 |
| 165 | Ga0105237_10060374 | 3300009545 | Bacteria | 3793 |
| 166 | Ga0105237_10103394 | 3300009545 | Bacteria | 2840 |
| 167 | Ga0105238_10001952 | 3300009551 | Bacteria | 20762 |
| 168 | Ga0105238_10002273 | 3300009551 | Bacteria | 19359 |
| 169 | Ga0105238_10004758 | 3300009551 | Bacteria | 13429 |
| 170 | Ga0105238_10054978 | 3300009551 | Bacteria | 3997 |
| 171 | Ga0105238_10108265 | 3300009551 | Bacteria | 2760 |
| 172 | Ga0105249_10000480 | 3300009553 | Bacteria | 37106 |
| 173 | Ga0105249_10000482 | 3300009553 | Bacteria | 37079 |
| 174 | Ga0105239_10002042 | 3300010375 | Bacteria | 26177 |
| 175 | Ga0105239_10082911 | 3300010375 | Bacteria | 3531 |
| 176 | Ga0105239_10121542 | 3300010375 | Bacteria | 2900 |
| 177 | Ga0105239_10246161 | 3300010375 | Bacteria | 2007 |
| 178 | Ga0157373_10001527 | 3300013100 | Bacteria | 17647 |
| 179 | Ga0157371_10000392 | 3300013102 | Bacteria | 55061 |
| 180 | Ga0157370_10004005 | 3300013104 | Bacteria | 17116 |
| 181 | Ga0157370_10024199 | 3300013104 | Bacteria | 6017 |
| 182 | Ga0157370_10034214 | 3300013104 | Bacteria | 4951 |
| 183 | Ga0157369_10000538 | 3300013105 | Bacteria | 50087 |
| 184 | Ga0157369_10008292 | 3300013105 | Bacteria | 11911 |
| 185 | Ga0157369_10020640 | 3300013105 | Bacteria | 7367 |
| 186 | Ga0157369_10026622 | 3300013105 | Bacteria | 6414 |
| 187 | Ga0157369_10033938 | 3300013105 | Bacteria | 5604 |
| 188 | Ga0157369_10039369 | 3300013105 | Bacteria | 5166 |
| 189 | Ga0157369_10121746 | 3300013105 | Bacteria | 2768 |
| 190 | Ga0157374_10000407 | 3300013296 | Bacteria | 39138 |
| 191 | Ga0157374_10000557 | 3300013296 | Bacteria | 33126 |
| 192 | Ga0157374_10019378 | 3300013296 | Bacteria | 6021 |
| 193 | Ga0157378_10000974 | 3300013297 | Bacteria | 26210 |
| 194 | Ga0157378_10001370 | 3300013297 | Bacteria | 21881 |
| 195 | Ga0163162_10000477 | 3300013306 | Bacteria | 37086 |
| 196 | Ga0163162_10000594 | 3300013306 | Bacteria | 33577 |
| 197 | Ga0163162_10003163 | 3300013306 | Bacteria | 15734 |
| 198 | Ga0163162_10088538 | 3300013306 | Bacteria | 3175 |
| 199 | Ga0157372_10001450 | 3300013307 | Bacteria | 25669 |
| 200 | Ga0157372_10022551 | 3300013307 | Bacteria | 6814 |
| 201 | Ga0157372_10028052 | 3300013307 | Bacteria | 6140 |
| 202 | Ga0157372_10035349 | 3300013307 | Bacteria | 5500 |
| 203 | Ga0157372_10044676 | 3300013307 | Bacteria | 4910 |
| 204 | Ga0157372_10060155 | 3300013307 | Bacteria | 4250 |
| 205 | Ga0157375_10000315 | 3300013308 | Bacteria | 43356 |
| 206 | Ga0157377_10000774 | 3300014745 | Bacteria | 13244 |
| 207 | Ga0157379_10000098 | 3300014968 | Bacteria | 59060 |
| 208 | Ga0157376_10003437 | 3300014969 | Bacteria | 10902 |
| 209 | Ga0157376_10008204 | 3300014969 | Bacteria | 7516 |
| 210 | Ga0157376_10141857 | 3300014969 | Bacteria | 2156 |
| 211 | Ga0182006_1004912 | 3300015261 | Bacteria | 6477 |
| 212 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 213 | Ga0183369_1014 | 3300015685 | Bacteria | 194173 |
| 214 | Ga0163161_10001681 | 3300017792 | Bacteria | 16233 |
| 215 | Ga0213872_10004253 | 3300021361 | Bacteria | 7675 |
| 216 | Ga0213872_10005267 | 3300021361 | Bacteria | 6686 |
| 217 | Ga0213872_10006854 | 3300021361 | Bacteria | 5671 |
| 218 | Ga0213876_10011967 | 3300021384 | Bacteria | 4622 |
| 219 | Ga0209672_100045 | 3300025228 | Bacteria | 264926 |
| 220 | Ga0209672_101754 | 3300025228 | Bacteria | 6823 |
| 221 | Ga0207427_100036 | 3300025231 | Bacteria | 309540 |
| 222 | Ga0209437_100210 | 3300025233 | Bacteria | 109261 |
| 223 | Ga0209258_100035 | 3300025242 | Bacteria | 430864 |
| 224 | Ga0209258_100125 | 3300025242 | Bacteria | 178709 |
| 225 | Ga0209258_100889 | 3300025242 | Bacteria | 15583 |
| 226 | Ga0209646_1000881 | 3300025246 | Bacteria | 9947 |
| 227 | Ga0209026_1000579 | 3300025250 | Bacteria | 24109 |
| 228 | Ga0209148_1000045 | 3300025254 | Bacteria | 448076 |
| 229 | Ga0209148_1000048 | 3300025254 | Bacteria | 430913 |
| 230 | Ga0209759_1000571 | 3300025256 | Bacteria | 37036 |
| 231 | Ga0209233_1000101 | 3300025261 | Bacteria | 286063 |
| 232 | Ga0209455_1000035 | 3300025272 | Bacteria | 479071 |
| 233 | Ga0207697_10002671 | 3300025315 | Bacteria | 9127 |
| 234 | Ga0207682_10000996 | 3300025893 | Bacteria | 13089 |
| 235 | Ga0207710_10000328 | 3300025900 | Bacteria | 35933 |
| 236 | Ga0207688_10000047 | 3300025901 | Bacteria | 42677 |
| 237 | Ga0207680_10000080 | 3300025903 | Bacteria | 43434 |
| 238 | Ga0207647_10000763 | 3300025904 | Bacteria | 25154 |
| 239 | Ga0207647_10013124 | 3300025904 | Bacteria | 5756 |
| 240 | Ga0207647_10061317 | 3300025904 | Bacteria | 2296 |
| 241 | Ga0207645_10000257 | 3300025907 | Bacteria | 43847 |
| 242 | Ga0207645_10011020 | 3300025907 | Bacteria | 6186 |
| 243 | Ga0207643_10000002 | 3300025908 | Bacteria | 224909 |
| 244 | Ga0207705_10004041 | 3300025909 | Bacteria | 11153 |
| 245 | Ga0207705_10004454 | 3300025909 | Bacteria | 10580 |
| 246 | Ga0207705_10005603 | 3300025909 | Bacteria | 9386 |
| 247 | Ga0207705_10036376 | 3300025909 | Bacteria | 3524 |
| 248 | Ga0207705_10055119 | 3300025909 | Bacteria | 2866 |
| 249 | Ga0207705_10056444 | 3300025909 | Bacteria | 2831 |
| 250 | Ga0207684_10128840 | 3300025910 | Bacteria | 2172 |
| 251 | Ga0207654_10002132 | 3300025911 | Bacteria | 10130 |
| 252 | Ga0207707_10000008 | 3300025912 | Bacteria | 330313 |
| 253 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 254 | Ga0207695_10000341 | 3300025913 | Bacteria | 109857 |
| 255 | Ga0207695_10002046 | 3300025913 | Bacteria | 30915 |
| 256 | Ga0207695_10006216 | 3300025913 | Bacteria | 15547 |
| 257 | Ga0207695_10017088 | 3300025913 | Bacteria | 8458 |
| 258 | Ga0207695_10024652 | 3300025913 | Bacteria | 6757 |
| 259 | Ga0207695_10027566 | 3300025913 | Bacteria | 6323 |
| 260 | Ga0207695_10033443 | 3300025913 | Bacteria | 5606 |
| 261 | Ga0207695_10060383 | 3300025913 | Bacteria | 3925 |
| 262 | Ga0207695_10071696 | 3300025913 | Bacteria | 3538 |
| 263 | Ga0207695_10175337 | 3300025913 | Bacteria | 2067 |
| 264 | Ga0207671_10000012 | 3300025914 | Bacteria | 519494 |
| 265 | Ga0207671_10000683 | 3300025914 | Bacteria | 44055 |
| 266 | Ga0207671_10006018 | 3300025914 | Bacteria | 10960 |
| 267 | Ga0207693_10001958 | 3300025915 | Bacteria | 18059 |
| 268 | Ga0207663_10005871 | 3300025916 | Bacteria | 6227 |
| 269 | Ga0207660_10001514 | 3300025917 | Bacteria | 15632 |
| 270 | Ga0207660_10009761 | 3300025917 | Bacteria | 6213 |
| 271 | Ga0207660_10049376 | 3300025917 | Bacteria | 2982 |
| 272 | Ga0207662_10000011 | 3300025918 | Bacteria | 90777 |
| 273 | Ga0207662_10003044 | 3300025918 | Bacteria | 8558 |
| 274 | Ga0207662_10010529 | 3300025918 | Bacteria | 5110 |
| 275 | Ga0207657_10000323 | 3300025919 | Bacteria | 50878 |
| 276 | Ga0207657_10001624 | 3300025919 | Bacteria | 24210 |
| 277 | Ga0207657_10004100 | 3300025919 | Bacteria | 15473 |
| 278 | Ga0207657_10017475 | 3300025919 | Bacteria | 6874 |
| 279 | Ga0207657_10128034 | 3300025919 | Bacteria | 2083 |
| 280 | Ga0207649_10000683 | 3300025920 | Bacteria | 22530 |
| 281 | Ga0207649_10003768 | 3300025920 | Bacteria | 8269 |
| 282 | Ga0207649_10018949 | 3300025920 | Bacteria | 3926 |
| 283 | Ga0207652_10000065 | 3300025921 | Bacteria | 111252 |
| 284 | Ga0207652_10002226 | 3300025921 | Bacteria | 16546 |
| 285 | Ga0207652_10005711 | 3300025921 | Bacteria | 10101 |
| 286 | Ga0207652_10016472 | 3300025921 | Bacteria | 6036 |
| 287 | Ga0207652_10020661 | 3300025921 | Bacteria | 5426 |
| 288 | Ga0207681_10001307 | 3300025923 | Bacteria | 16051 |
| 289 | Ga0207681_10001444 | 3300025923 | Bacteria | 15287 |
| 290 | Ga0207694_10002039 | 3300025924 | Bacteria | 16728 |
| 291 | Ga0207694_10003498 | 3300025924 | Bacteria | 12484 |
| 292 | Ga0207694_10003671 | 3300025924 | Bacteria | 12148 |
| 293 | Ga0207694_10007539 | 3300025924 | Bacteria | 8246 |
| 294 | Ga0207650_10000356 | 3300025925 | Bacteria | 44083 |
| 295 | Ga0207659_10000104 | 3300025926 | Bacteria | 50387 |
| 296 | Ga0207687_10006539 | 3300025927 | Bacteria | 7699 |
| 297 | Ga0207700_10142434 | 3300025928 | Bacteria | 1971 |
| 298 | Ga0207664_10000053 | 3300025929 | Bacteria | 128647 |
| 299 | Ga0207690_10001767 | 3300025932 | Bacteria | 13287 |
| 300 | Ga0207690_10002631 | 3300025932 | Bacteria | 10812 |
| 301 | Ga0207706_10000078 | 3300025933 | Bacteria | 100847 |
| 302 | Ga0207686_10017096 | 3300025934 | Bacteria | 4081 |
| 303 | Ga0207709_10036430 | 3300025935 | Bacteria | 2915 |
| 304 | Ga0207670_10000002 | 3300025936 | Bacteria | 783058 |
| 305 | Ga0207670_10000399 | 3300025936 | Bacteria | 25002 |
| 306 | Ga0207669_10001368 | 3300025937 | Bacteria | 10378 |
| 307 | Ga0207704_10000264 | 3300025938 | Bacteria | 25198 |
| 308 | Ga0207691_10000396 | 3300025940 | Bacteria | 43675 |
| 309 | Ga0207691_10012657 | 3300025940 | Bacteria | 8081 |
| 310 | Ga0207711_10000261 | 3300025941 | Bacteria | 57333 |
| 311 | Ga0207689_10000346 | 3300025942 | Bacteria | 43356 |
| 312 | Ga0207689_10022129 | 3300025942 | Bacteria | 5346 |
| 313 | Ga0207661_10003364 | 3300025944 | Bacteria | 11111 |
| 314 | Ga0207661_10167233 | 3300025944 | Bacteria | 1912 |
| 315 | Ga0207679_10000445 | 3300025945 | Bacteria | 29158 |
| 316 | Ga0207679_10000545 | 3300025945 | Bacteria | 25290 |
| 317 | Ga0207679_10014587 | 3300025945 | Bacteria | 5170 |
| 318 | Ga0207667_10001100 | 3300025949 | Bacteria | 34289 |
| 319 | Ga0207667_10003445 | 3300025949 | Bacteria | 19521 |
| 320 | Ga0207667_10006862 | 3300025949 | Bacteria | 13755 |
| 321 | Ga0207667_10011261 | 3300025949 | Bacteria | 10405 |
| 322 | Ga0207667_10064365 | 3300025949 | Bacteria | 3829 |
| 323 | Ga0207667_10143595 | 3300025949 | Bacteria | 2457 |
| 324 | Ga0207667_10152108 | 3300025949 | Bacteria | 2381 |
| 325 | Ga0207667_10244701 | 3300025949 | Bacteria | 1835 |
| 326 | Ga0207651_10000020 | 3300025960 | Bacteria | 83049 |
| 327 | Ga0207651_10021823 | 3300025960 | Bacteria | 3900 |
| 328 | Ga0207651_10165299 | 3300025960 | Bacteria | 1739 |
| 329 | Ga0207712_10000164 | 3300025961 | Bacteria | 68361 |
| 330 | Ga0207712_10000611 | 3300025961 | Bacteria | 28386 |
| 331 | Ga0207712_10170325 | 3300025961 | Bacteria | 1701 |
| 332 | Ga0207668_10000692 | 3300025972 | Bacteria | 20664 |
| 333 | Ga0207668_10067206 | 3300025972 | Bacteria | 2544 |
| 334 | Ga0207640_10000011 | 3300025981 | Bacteria | 252283 |
| 335 | Ga0207640_10000302 | 3300025981 | Bacteria | 32782 |
| 336 | Ga0207658_10000372 | 3300025986 | Bacteria | 44124 |
| 337 | Ga0207677_10000079 | 3300026023 | Bacteria | 79753 |
| 338 | Ga0207677_10073407 | 3300026023 | Bacteria | 2423 |
| 339 | Ga0207703_10000148 | 3300026035 | Bacteria | 81341 |
| 340 | Ga0207703_10000236 | 3300026035 | Bacteria | 62877 |
| 341 | Ga0207703_10058800 | 3300026035 | Bacteria | 3139 |
| 342 | Ga0207639_10000025 | 3300026041 | Bacteria | 207451 |
| 343 | Ga0207639_10001005 | 3300026041 | Bacteria | 19187 |
| 344 | Ga0207639_10009973 | 3300026041 | Bacteria | 6566 |
| 345 | Ga0207639_10030937 | 3300026041 | Bacteria | 3931 |
| 346 | Ga0207678_10002030 | 3300026067 | Bacteria | 18379 |
| 347 | Ga0207678_10040085 | 3300026067 | Bacteria | 4062 |
| 348 | Ga0207708_10000459 | 3300026075 | Bacteria | 31665 |
| 349 | Ga0207708_10007615 | 3300026075 | Bacteria | 8015 |
| 350 | Ga0207702_10013465 | 3300026078 | Bacteria | 6798 |
| 351 | Ga0207702_10014773 | 3300026078 | Bacteria | 6477 |
| 352 | Ga0207702_10020798 | 3300026078 | Bacteria | 5427 |
| 353 | Ga0207702_10227865 | 3300026078 | Bacteria | 1740 |
| 354 | Ga0207648_10000378 | 3300026089 | Bacteria | 49045 |
| 355 | Ga0207648_10014975 | 3300026089 | Bacteria | 7144 |
| 356 | Ga0207676_10000341 | 3300026095 | Bacteria | 40111 |
| 357 | Ga0207674_10006281 | 3300026116 | Bacteria | 14005 |
| 358 | Ga0207675_100000006 | 3300026118 | Bacteria | 189749 |
| 359 | Ga0207675_100002900 | 3300026118 | Bacteria | 16867 |
| 360 | Ga0207675_100071494 | 3300026118 | Bacteria | 3244 |
| 361 | Ga0207698_10004730 | 3300026142 | Bacteria | 8327 |
| 362 | Ga0207698_10005013 | 3300026142 | Bacteria | 8123 |
| 363 | Ga0207698_10008267 | 3300026142 | Bacteria | 6570 |
| 364 | Ga0207698_10015426 | 3300026142 | Bacteria | 5115 |
| 365 | Ga0207698_10036368 | 3300026142 | Bacteria | 3614 |
| 366 | Ga0207698_10101622 | 3300026142 | Bacteria | 2385 |
| 367 | Ga0207428_10022849 | 3300027907 | Bacteria | 5271 |
| 368 | Ga0268266_10000723 | 3300028379 | Bacteria | 44339 |
| 369 | Ga0268266_10043407 | 3300028379 | Bacteria | 3842 |
| 370 | Ga0268266_10079199 | 3300028379 | Bacteria | 2860 |
| 371 | Ga0268265_10000340 | 3300028380 | Bacteria | 50814 |
| 372 | Ga0268264_10000995 | 3300028381 | Bacteria | 28888 |
| 373 | Ga0265319_1010564 | 3300028563 | Bacteria | 3844 |
| 374 | Ga0265318_10000050 | 3300028577 | Bacteria | 118340 |
| 375 | Ga0307515_10000008 | 3300028794 | Bacteria | 663660 |
| 376 | Ga0307515_10105508 | 3300028794 | Bacteria | 3354 |
| 377 | Ga0265338_10000097 | 3300028800 | Bacteria | 161237 |
| 378 | Ga0265330_10000009 | 3300031235 | Bacteria | 190785 |
| 379 | Ga0265330_10001153 | 3300031235 | Bacteria | 15761 |
| 380 | Ga0265328_10001547 | 3300031239 | Bacteria | 10608 |
| 381 | Ga0265320_10000006 | 3300031240 | Bacteria | 333442 |
| 382 | Ga0265329_10003498 | 3300031242 | Bacteria | 6819 |
| 383 | Ga0265339_10005376 | 3300031249 | Bacteria | 8530 |
| 384 | Ga0265331_10000004 | 3300031250 | Bacteria | 476985 |
| 385 | Ga0265316_10085839 | 3300031344 | Bacteria | 2407 |
| 386 | Ga0265313_10001612 | 3300031595 | Bacteria | 20955 |
| 387 | Ga0265313_10030672 | 3300031595 | Bacteria | 2764 |
| 388 | Ga0265314_10000014 | 3300031711 | Bacteria | 400363 |
| 389 | Ga0265314_10002587 | 3300031711 | Bacteria | 18310 |
| 390 | Ga0265314_10011629 | 3300031711 | Bacteria | 7245 |
| 391 | Ga0265342_10000404 | 3300031712 | Bacteria | 47716 |
| 392 | Ga0307412_10001844 | 3300031911 | Bacteria | 11747 |
| 393 | Ga0373950_0000005 | 3300034818 | Bacteria | 404272 |
| 394 | Ga0373950_0000061 | 3300034818 | Bacteria | 67878 |
| 395 | Ga0373954_0017278 | 3300035118 | Bacteria | 3238 |
| 396 | Ga0373957_0030788 | 3300035120 | Bacteria | 1968 |
| 397 | Ga0373927_0005550 | 3300035695 | Bacteria | 8677 |
| 398 | Ga0373933_0001652 | 3300035724 | Bacteria | 12975 |
| 399 | Ga0373937_0017744 | 3300036401 | Bacteria | 6348 |
| 400 | Ga0373937_0164785 | 3300036401 | Bacteria | 2078 |
| 401 | Ga0373925_0014340 | 3300037068 | Bacteria | 5734 |
| 402 | Ga0373925_0028864 | 3300037068 | Bacteria | 4067 |
| 403 | Ga0373925_0063820 | 3300037068 | Bacteria | 2772 |
| 404 | Ga0395899_0060574 | 3300037312 | Bacteria | 2789 |
| 405 | Ga0395900_0000013 | 3300037418 | Bacteria | 388765 |
| 406 | Ga0395900_0000617 | 3300037418 | Bacteria | 48154 |
| 407 | Ga0395900_0092338 | 3300037418 | Unclassified | 3110 |
| 408 | Ga0395900_0106729 | 3300037418 | Bacteria | 2877 |
| 409 | Ga0395898_0000303 | 3300037466 | Bacteria | 117164 |
| 410 | Ga0395898_0002048 | 3300037466 | Bacteria | 25191 |
| 411 | Ga0395905_0046398 | 3300037471 | Bacteria | 4074 |
| 412 | Ga0436364_0133609 | 3300037853 | Bacteria | 22529 |
| 413 | Ga0436365_1252353 | 3300039437 | Bacteria | 3225 |
| 414 | Ga0436365_1480745 | 3300039437 | Bacteria | 4734 |
| 415 | Ga0436360_0390756 | 3300039438 | Bacteria | 4970 |
| 416 | Ga0436361_0141304 | 3300039447 | Bacteria | 2723 |
| 417 | Ga0436361_0164894 | 3300039447 | Bacteria | 9539 |
| 418 | Ga0436361_1114110 | 3300039447 | Bacteria | 15913 |
| 419 | Ga0436361_1140677 | 3300039447 | Bacteria | 7485 |
| 420 | Ga0436363_0017557 | 3300039450 | Bacteria | 3854 |
| 421 | Ga0436362_0694326 | 3300039453 | Bacteria | 4389 |
| 422 | Ga0439465_0001943 | 3300041413 | Bacteria | 6777 |
| 423 | Ga0466969_0002366 | 3300044656 | Bacteria | 10081 |
| 424 | Ga0466969_0022828 | 3300044656 | Bacteria | 3226 |
| 425 | Ga0466982_0000043 | 3300044672 | Bacteria | 39281 |
| 426 | Ga0466965_0018118 | 3300044683 | Bacteria | 3371 |
| 427 | Ga0466966_0059900 | 3300044684 | Bacteria | 2404 |
| 428 | Ga0466966_0109360 | 3300044684 | Bacteria | 1705 |
| 429 | Ga0466961_0002165 | 3300044693 | Bacteria | 12220 |
| 430 | Ga0466961_0048258 | 3300044693 | Bacteria | 2721 |
| 431 | Ga0466963_0003421 | 3300044694 | Bacteria | 9083 |
| 432 | Ga0466964_0000794 | 3300044706 | Bacteria | 10278 |
| 433 | Ga0453684_0099140 | 3300044712 | Bacteria | 3570 |
| 434 | Ga0466970_0006491 | 3300044765 | Bacteria | 5846 |
| 435 | Ga0466959_0099658 | 3300045049 | Bacteria | 2080 |
| 436 | Ga0451576_0021954 | 3300045051 | Bacteria | 6930 |
| 437 | Ga0466958_0016276 | 3300045836 | Bacteria | 4278 |
| 438 | Ga0466958_0051338 | 3300045836 | Bacteria | 2497 |
| 439 | Ga0466967_0007648 | 3300045976 | Bacteria | 7822 |
| 440 | Ga0466967_0139167 | 3300045976 | Bacteria | 2260 |
| 441 | Ga0495603_0002099 | 3300046455 | Bacteria | 11727 |
| 442 | Ga0495629_0010888 | 3300046459 | Bacteria | 6614 |
| 443 | Ga0495651_0047873 | 3300046462 | Bacteria | 3303 |
| 444 | Ga0495651_0158544 | 3300046462 | Bacteria | 1624 |
| 445 | Ga0495653_0025086 | 3300046463 | Bacteria | 4796 |
| 446 | Ga0495580_0000482 | 3300046472 | Bacteria | 33274 |
| 447 | Ga0495580_0034150 | 3300046472 | Bacteria | 3662 |
| 448 | Ga0495639_0003287 | 3300046475 | Bacteria | 7012 |
| 449 | Ga0495662_0001834 | 3300046476 | Bacteria | 10644 |
| 450 | Ga0495664_0001233 | 3300046477 | Bacteria | 13391 |
| 451 | Ga0495584_0002523 | 3300046491 | Bacteria | 10362 |
| 452 | Ga0495585_0003101 | 3300046492 | Bacteria | 11413 |
| 453 | Ga0495594_0000656 | 3300046499 | Bacteria | 17880 |
| 454 | Ga0495594_0009135 | 3300046499 | Bacteria | 5116 |
| 455 | Ga0495594_0024980 | 3300046499 | Bacteria | 3210 |
| 456 | Ga0495620_0001797 | 3300046515 | Bacteria | 12614 |
| 457 | Ga0495630_0007224 | 3300046517 | Bacteria | 7923 |
| 458 | Ga0495630_0058688 | 3300046517 | Bacteria | 2885 |
| 459 | Ga0495632_0000016 | 3300046519 | Bacteria | 232022 |
| 460 | Ga0495644_0000011 | 3300046523 | Bacteria | 97543 |
| 461 | Ga0495648_0004872 | 3300046524 | Bacteria | 11305 |
| 462 | Ga0495652_0093008 | 3300046529 | Bacteria | 2463 |
| 463 | Ga0495665_0028838 | 3300046531 | Bacteria | 2974 |
| 464 | Ga0495640_0014308 | 3300046533 | Bacteria | 6008 |
| 465 | Ga0495586_0008307 | 3300046535 | Bacteria | 5527 |
| 466 | Ga0495645_0005967 | 3300046543 | Bacteria | 8423 |
| 467 | Ga0495645_0019236 | 3300046543 | Bacteria | 4916 |
| 468 | Ga0495645_0030128 | 3300046543 | Bacteria | 3952 |
| 469 | Ga0495622_0013202 | 3300046557 | Bacteria | 3834 |
| 470 | Ga0495667_0079665 | 3300046559 | Bacteria | 2129 |
| 471 | Ga0495634_0002173 | 3300046642 | Bacteria | 16473 |
| 472 | Ga0495634_0029880 | 3300046642 | Bacteria | 3768 |
| 473 | Ga0495625_0004582 | 3300046660 | Bacteria | 13000 |
| 474 | Ga0495625_0014217 | 3300046660 | Bacteria | 6364 |
| 475 | Ga0495635_0016521 | 3300046663 | Bacteria | 5156 |
| 476 | Ga0495659_0017916 | 3300046664 | Bacteria | 2354 |
| 477 | Ga0495623_0035256 | 3300046679 | Bacteria | 3207 |
| 478 | Ga0495646_0013801 | 3300046680 | Bacteria | 5137 |
| 479 | Ga0495613_0014611 | 3300046689 | Bacteria | 5825 |
| 480 | Ga0495613_0018611 | 3300046689 | Bacteria | 5178 |
| 481 | Ga0495600_0004359 | 3300046809 | Bacteria | 8470 |
| 482 | Ga0495581_0000504 | 3300047315 | Bacteria | 19958 |
| 483 | Ga0495604_0007012 | 3300047317 | Bacteria | 8933 |
| 484 | Ga0495674_0001339 | 3300047319 | Bacteria | 24024 |
| 485 | Ga0495674_0018901 | 3300047319 | Bacteria | 6408 |
| 486 | Ga0495680_0012546 | 3300047322 | Bacteria | 7450 |
| 487 | Ga0495683_0004359 | 3300047323 | Bacteria | 8057 |
| 488 | Ga0495675_0002972 | 3300047444 | Bacteria | 10175 |
| 489 | Ga0495675_0024803 | 3300047444 | Bacteria | 3825 |
| 490 | Ga0495673_0000018 | 3300047469 | Bacteria | 569190 |
| 491 | Ga0495684_0020385 | 3300047471 | Bacteria | 5109 |
| 492 | Ga0495686_0000009 | 3300047472 | Bacteria | 661643 |
| 493 | Ga0495686_0000204 | 3300047472 | Bacteria | 110504 |
| 494 | Ga0495686_0020931 | 3300047472 | Bacteria | 4355 |
| 495 | Ga0495602_0049899 | 3300048088 | Bacteria | 3744 |
| 496 | Ga0495614_0000176 | 3300048089 | Bacteria | 23701 |
| 497 | Ga0496100_0007942 | 3300048903 | Bacteria | 5894 |
| 498 | Ga0496101_0016442 | 3300048904 | Bacteria | 4998 |
| 499 | Ga0496102_0000960 | 3300048905 | Bacteria | 27134 |
| 500 | Ga0496102_0004947 | 3300048905 | Bacteria | 11292 |
| 501 | Ga0496103_0018220 | 3300048906 | Bacteria | 4211 |
| 502 | Ga0496103_0028216 | 3300048906 | Bacteria | 3405 |
| 503 | Ga0496104_0004038 | 3300048907 | Bacteria | 12725 |
| 504 | Ga0496104_0084415 | 3300048907 | Bacteria | 3030 |
| 505 | Ga0496104_0127314 | 3300048907 | Bacteria | 2446 |
| 506 | Ga0496106_0098926 | 3300048909 | Bacteria | 2260 |
| 507 | Ga0496108_0006006 | 3300048911 | Bacteria | 9834 |
| 508 | Ga0496108_0020699 | 3300048911 | Bacteria | 5407 |
| 509 | Ga0496108_0032569 | 3300048911 | Bacteria | 4330 |
| 510 | Ga0496109_0036098 | 3300048912 | Bacteria | 4461 |
| 511 | Ga0496109_0062855 | 3300048912 | Bacteria | 3396 |
| 512 | Ga0496110_0122219 | 3300048913 | Bacteria | 2347 |
| 513 | Ga0496111_0023938 | 3300048914 | Bacteria | 4293 |
| 514 | Ga0496112_0009377 | 3300048915 | Bacteria | 8814 |
| 515 | Ga0496112_0036305 | 3300048915 | Bacteria | 4807 |
| 516 | Ga0496114_0000065 | 3300048917 | Bacteria | 77292 |
| 517 | Ga0496114_0014141 | 3300048917 | Bacteria | 6400 |
| 518 | Ga0496114_0078124 | 3300048917 | Bacteria | 2792 |
| 519 | Ga0496115_0011623 | 3300048918 | Bacteria | 6606 |
| 520 | Ga0496115_0088091 | 3300048918 | Bacteria | 2534 |
| 521 | Ga0496121_0026216 | 3300048924 | Bacteria | 5501 |
| 522 | Ga0496126_0001516 | 3300048929 | Bacteria | 35870 |
| 523 | Ga0501299_001753 | 3300049522 | Bacteria | 2879 |
| 524 | Ga0501032_0039671 | 3300049569 | Bacteria | 3202 |
| 525 | Ga0501032_0087678 | 3300049569 | Bacteria | 2066 |
| 526 | Ga0501033_0038064 | 3300049570 | Bacteria | 3598 |
| 527 | Ga0501033_0038468 | 3300049570 | Bacteria | 3575 |
| 528 | Ga0501033_0071594 | 3300049570 | Bacteria | 2546 |
| 529 | Ga0501034_0000963 | 3300049571 | Bacteria | 41529 |
| 530 | Ga0501036_0033905 | 3300049572 | Bacteria | 4318 |
| 531 | Ga0501036_0094923 | 3300049572 | Bacteria | 2521 |
| 532 | Ga0501036_0130327 | 3300049572 | Bacteria | 2123 |
| 533 | Ga0501038_0069120 | 3300049574 | Bacteria | 3001 |
| 534 | Ga0501039_0065514 | 3300049575 | Bacteria | 2818 |
| 535 | Ga0501040_0073516 | 3300049576 | Bacteria | 2362 |
| 536 | Ga0501042_0090860 | 3300049578 | Bacteria | 2191 |
| 537 | Ga0501043_0000305 | 3300049579 | Bacteria | 44560 |
| 538 | Ga0501043_0002542 | 3300049579 | Bacteria | 15421 |
| 539 | Ga0501046_0000009 | 3300049580 | Bacteria | 335813 |
| 540 | Ga0501046_0000385 | 3300049580 | Bacteria | 44283 |
| 541 | Ga0501046_0004854 | 3300049580 | Bacteria | 12115 |
| 542 | Ga0501046_0006733 | 3300049580 | Bacteria | 10151 |
| 543 | Ga0501047_0000004 | 3300049581 | Bacteria | 463872 |
| 544 | Ga0501047_0000365 | 3300049581 | Bacteria | 51203 |
| 545 | Ga0501047_0015948 | 3300049581 | Bacteria | 7163 |
| 546 | Ga0501048_0001146 | 3300049582 | Bacteria | 19894 |
| 547 | Ga0501048_0003237 | 3300049582 | Bacteria | 12406 |
| 548 | Ga0501067_0000391 | 3300049583 | Bacteria | 23873 |
| 549 | Ga0501067_0002692 | 3300049583 | Bacteria | 9805 |
| 550 | Ga0501067_0020311 | 3300049583 | Bacteria | 3676 |
| 551 | Ga0501068_0045057 | 3300049584 | Bacteria | 2657 |
| 552 | Ga0501068_0058479 | 3300049584 | Bacteria | 2339 |
| 553 | Ga0501070_0000211 | 3300049586 | Bacteria | 55080 |
| 554 | Ga0501070_0000928 | 3300049586 | Bacteria | 26425 |
| 555 | Ga0501070_0025212 | 3300049586 | Bacteria | 4986 |
| 556 | Ga0501070_0059447 | 3300049586 | Bacteria | 3169 |
| 557 | Ga0501072_0000012 | 3300049588 | Bacteria | 180739 |
| 558 | Ga0501073_0001323 | 3300049589 | Bacteria | 18248 |
| 559 | Ga0501073_0002572 | 3300049589 | Bacteria | 13565 |
| 560 | Ga0501073_0009197 | 3300049589 | Bacteria | 7288 |
| 561 | Ga0501074_0002782 | 3300049590 | Bacteria | 12234 |
| 562 | Ga0501074_0019112 | 3300049590 | Bacteria | 4974 |
| 563 | Ga0501074_0035579 | 3300049590 | Bacteria | 3608 |
| 564 | Ga0501074_0060629 | 3300049590 | Bacteria | 2726 |
| 565 | Ga0501250_001008 | 3300049680 | Bacteria | 2164 |
| 566 | Ga0501225_0003440 | 3300049705 | Bacteria | 4796 |
| 567 | Ga0501080_0034111 | 3300049742 | Bacteria | 4750 |
| 568 | Ga0501080_0088960 | 3300049742 | Bacteria | 2868 |
| 569 | Ga0501080_0129262 | 3300049742 | Bacteria | 2338 |
| 570 | Ga0501083_0051833 | 3300049744 | Bacteria | 2759 |
| 571 | Ga0501083_0052976 | 3300049744 | Bacteria | 2724 |
| 572 | Ga0501083_0075344 | 3300049744 | Bacteria | 2241 |
| 573 | Ga0501044_0040095 | 3300049823 | Bacteria | 4883 |
| 574 | nmdc:mga05p37_8895_c1 | 3300050507 | Bacteria | 10128 |
| 575 | nmdc:mga08y16_4270_c1 | 3300050511 | Bacteria | 14915 |
| 576 | nmdc:mga08x19_39410_c1 | 3300050514 | Bacteria | 3003 |
| 577 | nmdc:mga0a205_19009_c1 | 3300050515 | Bacteria | 6473 |
| 578 | nmdc:mga0sz30_43148_c1 | 3300050516 | Bacteria | 1898 |
| 579 | Ga0495601_0008167 | 3300053077 | Bacteria | 6173 |
| 580 | Ga0495601_0040481 | 3300053077 | Bacteria | 2918 |
| 581 | Ga0500616_0000020 | 3300053153 | Bacteria | 530404 |
| 582 | Ga0500633_0007410 | 3300053160 | Bacteria | 2761 |
| 583 | Ga0501084_0000038 | 3300054114 | Bacteria | 108058 |
| 584 | Ga0500661_002056 | 3300055283 | Bacteria | 3800 |
| 585 | Ga0501082_0025677 | 3300060353 | Bacteria | 5076 |
| 586 | Ga0530510_0071747 | 3300061734 | Bacteria | 2514 |
| 587 | 2671118295 | 2667528175 | Bacteria | 7532676 |
| 588 | 2842916665 | 2842914999 | Bacteria | 4419378 |
| 589 | 2842919149 | 2842918807 | Bacteria | 4289178 |
| 590 | 2881413417 | 2881412998 | Bacteria | 6492157 |
| 591 | 2919406239 | 2919404418 | Bacteria | 4232372 |
| 592 | 2953994575 | 2953994433 | Bacteria | 4303959 |
| 593 | 641645923 | 641522639 | Bacteria | 7737025 |
| 594 | Ga0395905_0005646 | |||
| 595 | LJNas_1000425 | |||
| 596 | JGI24743J22301_10000472 | |||
| 597 | JGI24749J21850_1000881 | |||
| 598 | JGI25162J39368_1002980 | |||
| 599 | JGI25157J39369_1002762 | |||
| 600 | JGI25164J39214_1000173 | |||
| 601 | Ga0006759J45824_1021183 | |||
| 602 | JGI25165J46597_1000202 | |||
| 603 | JGI25404J52841_10000845 | |||
| 604 | Ga0032354_1048682 | |||
| 605 | Ga0055539_1001767 | |||
| 606 | Ga0055533_1001565 | |||
| 607 | Ga0055527_1002653 | |||
| 608 | Ga0055535_1001604 | |||
| 609 | Ga0055535_1001961 | |||
| 610 | Ga0055542_1000138 | |||
| 611 | Ga0055542_1000159 | |||
| 612 | Ga0055529_1000162 | |||
| 613 | Ga0065165_1001431 | |||
| 614 | Ga0065715_10091663 | |||
| 615 | Ga0070658_10000148 | |||
| 616 | Ga0070658_10002756 | |||
| 617 | Ga0070658_10004119 | |||
| 618 | Ga0070658_10025684 | |||
| 619 | Ga0070658_10072156 | |||
| 620 | Ga0070676_10002715 | |||
| 621 | Ga0070676_10008769 | |||
| 622 | Ga0070683_100000968 | |||
| 623 | Ga0070683_100003788 | |||
| 624 | Ga0070690_100009768 | |||
| 625 | Ga0070690_100032859 | |||
| 626 | Ga0070677_10000062 | |||
| 627 | Ga0068869_100054786 | |||
| 628 | Ga0070680_100050540 | |||
| 629 | Ga0070682_100055519 | |||
| 630 | Ga0070660_100002139 | |||
| 631 | Ga0070660_100003576 | |||
| 632 | Ga0070660_100023415 | |||
| 633 | Ga0070660_100058648 | |||
| 634 | Ga0070660_100063029 | |||
| 635 | Ga0070660_100122379 | |||
| 636 | Ga0070689_100000001 | |||
| 637 | Ga0070689_100000689 | |||
| 638 | Ga0070661_100000623 | |||
| 639 | Ga0070661_100074134 | |||
| 640 | Ga0070692_10055008 | |||
| 641 | Ga0070668_100001080 | |||
| 642 | Ga0070668_100001118 | |||
| 643 | Ga0070668_100046036 | |||
| 644 | Ga0070669_100001497 | |||
| 645 | Ga0070669_100003597 | |||
| 646 | Ga0070671_100002476 | |||
| 647 | Ga0070674_100011980 | |||
| 648 | Ga0070673_100001203 | |||
| 649 | Ga0070673_100016660 | |||
| 650 | Ga0070688_100002052 | |||
| 651 | Ga0070659_100000559 | |||
| 652 | Ga0070659_100000969 | |||
| 653 | Ga0070659_100009726 | |||
| 654 | Ga0070659_100010323 | |||
| 655 | Ga0070709_10034271 | |||
| 656 | Ga0070714_100000278 | |||
| 657 | Ga0070714_100037931 | |||
| 658 | Ga0070713_100218089 | |||
| 659 | Ga0070711_100003769 | |||
| 660 | Ga0070711_100011897 | |||
| 661 | Ga0070705_100000235 | |||
| 662 | Ga0070700_100008137 | |||
| 663 | Ga0070663_100002397 | |||
| 664 | Ga0070678_100003721 | |||
| 665 | Ga0070662_100000177 | |||
| 666 | Ga0070681_10000273 | |||
| 667 | Ga0070681_10001513 | |||
| 668 | Ga0068867_100001634 | |||
| 669 | Ga0070685_10001035 | |||
| 670 | Ga0070685_10033820 | |||
| 671 | Ga0070698_100008595 | |||
| 672 | Ga0070679_100001215 | |||
| 673 | Ga0070679_100002855 | |||
| 674 | Ga0070679_100003777 | |||
| 675 | Ga0070684_100005017 | |||
| 676 | Ga0070684_100038676 | |||
| 677 | Ga0070697_100029007 | |||
| 678 | Ga0070697_100106741 | |||
| 679 | Ga0068853_100000047 | |||
| 680 | Ga0068853_100002106 | |||
| 681 | Ga0068853_100002354 | |||
| 682 | Ga0070672_100000356 | |||
| 683 | Ga0070686_100000081 | |||
| 684 | Ga0070696_100000426 | |||
| 685 | Ga0070696_100012881 | |||
| 686 | Ga0070693_100002481 | |||
| 687 | Ga0070665_100016870 | |||
| 688 | Ga0070665_100020435 | |||
| 689 | Ga0068855_100001006 | |||
| 690 | Ga0068855_100001992 | |||
| 691 | Ga0068855_100003377 | |||
| 692 | Ga0068855_100071371 | |||
| 693 | Ga0068855_100112411 | |||
| 694 | Ga0068855_100114266 | |||
| 695 | Ga0068855_100175317 | |||
| 696 | Ga0070664_100004710 | |||
| 697 | Ga0070664_100010749 | |||
| 698 | Ga0068857_100000447 | |||
| 699 | Ga0068857_100050193 | |||
| 700 | Ga0068854_100000028 | |||
| 701 | Ga0068854_100000195 | |||
| 702 | Ga0068856_100005824 | |||
| 703 | Ga0068856_100010662 | |||
| 704 | Ga0068856_100024475 | |||
| 705 | Ga0068856_100031292 | |||
| 706 | Ga0068852_100000190 | |||
| 707 | Ga0068852_100033012 | |||
| 708 | Ga0068852_100050027 | |||
| 709 | Ga0068859_100008059 | |||
| 710 | Ga0068859_100010700 | |||
| 711 | Ga0068864_100003151 | |||
| 712 | Ga0068866_10000018 | |||
| 713 | Ga0068861_100000047 | |||
| 714 | Ga0068861_100029123 | |||
| 715 | Ga0068861_100061717 | |||
| 716 | Ga0068851_10001453 | |||
| 717 | Ga0068870_10000185 | |||
| 718 | Ga0068863_100001633 | |||
| 719 | Ga0068858_100066266 | |||
| 720 | Ga0068858_100128249 | |||
| 721 | Ga0068860_100001275 | |||
| 722 | Ga0068862_100000904 | |||
| 723 | Ga0068862_100077046 | |||
| 724 | Ga0081540_1000141 | |||
| 725 | Ga0081540_1000258 | |||
| 726 | Ga0081539_10001769 | |||
| 727 | Ga0075369_10016040 | |||
| 728 | Ga0068871_100002040 | |||
| 729 | Ga0075433_10019163 | |||
| 730 | Ga0097620_100008059 | |||
| 731 | Ga0097620_100010700 | |||
| 732 | Ga0105240_10002135 | |||
| 733 | Ga0105240_10002211 | |||
| 734 | Ga0105240_10002384 | |||
| 735 | Ga0105240_10008587 | |||
| 736 | Ga0105240_10009539 | |||
| 737 | Ga0105240_10011435 | |||
| 738 | Ga0105240_10016806 | |||
| 739 | Ga0105240_10040285 | |||
| 740 | Ga0105240_10103252 | |||
| 741 | Ga0105240_10148128 | |||
| 742 | Ga0111539_10020198 | |||
| 743 | Ga0105245_10000390 | |||
| 744 | Ga0105247_10000104 | |||
| 745 | Ga0114129_10077597 | |||
| 746 | Ga0114129_10335141 | |||
| 747 | Ga0105243_10000752 | |||
| 748 | Ga0105243_10057013 | |||
| 749 | Ga0105241_10003660 | |||
| 750 | Ga0105241_10010134 | |||
| 751 | Ga0105241_10017433 | |||
| 752 | Ga0105242_10021807 | |||
| 753 | Ga0105248_10010779 | |||
| 754 | Ga0105248_10025216 | |||
| 755 | Ga0105237_10000003 | |||
| 756 | Ga0105237_10000155 | |||
| 757 | Ga0105237_10000477 | |||
| 758 | Ga0105237_10060374 | |||
| 759 | Ga0105237_10103394 | |||
| 760 | Ga0105238_10001952 | |||
| 761 | Ga0105238_10002273 | |||
| 762 | Ga0105238_10004758 | |||
| 763 | Ga0105238_10054978 | |||
| 764 | Ga0105238_10108265 | |||
| 765 | Ga0105249_10000480 | |||
| 766 | Ga0105249_10000482 | |||
| 767 | Ga0105239_10002042 | |||
| 768 | Ga0105239_10082911 | |||
| 769 | Ga0105239_10121542 | |||
| 770 | Ga0105239_10246161 | |||
| 771 | Ga0157373_10001527 | |||
| 772 | Ga0157371_10000392 | |||
| 773 | Ga0157370_10004005 | |||
| 774 | Ga0157370_10024199 | |||
| 775 | Ga0157370_10034214 | |||
| 776 | Ga0157369_10000538 | |||
| 777 | Ga0157369_10008292 | |||
| 778 | Ga0157369_10020640 | |||
| 779 | Ga0157369_10026622 | |||
| 780 | Ga0157369_10033938 | |||
| 781 | Ga0157369_10039369 | |||
| 782 | Ga0157369_10121746 | |||
| 783 | Ga0157374_10000407 | |||
| 784 | Ga0157374_10000557 | |||
| 785 | Ga0157374_10019378 | |||
| 786 | Ga0157378_10000974 | |||
| 787 | Ga0157378_10001370 | |||
| 788 | Ga0163162_10000477 | |||
| 789 | Ga0163162_10000594 | |||
| 790 | Ga0163162_10003163 | |||
| 791 | Ga0163162_10088538 | |||
| 792 | Ga0157372_10001450 | |||
| 793 | Ga0157372_10022551 | |||
| 794 | Ga0157372_10028052 | |||
| 795 | Ga0157372_10035349 | |||
| 796 | Ga0157372_10044676 | |||
| 797 | Ga0157372_10060155 | |||
| 798 | Ga0157375_10000315 | |||
| 799 | Ga0157377_10000774 | |||
| 800 | Ga0157379_10000098 | |||
| 801 | Ga0157376_10003437 | |||
| 802 | Ga0157376_10008204 | |||
| 803 | Ga0157376_10141857 | |||
| 804 | Ga0182006_1004912 | |||
| 805 | Ga0183362_10002 | |||
| 806 | Ga0183369_1014 | |||
| 807 | Ga0163161_10001681 | |||
| 808 | Ga0213872_10004253 | |||
| 809 | Ga0213872_10005267 | |||
| 810 | Ga0213872_10006854 | |||
| 811 | Ga0213876_10011967 | |||
| 812 | Ga0209672_100045 | |||
| 813 | Ga0209672_101754 | |||
| 814 | Ga0207427_100036 | |||
| 815 | Ga0209437_100210 | |||
| 816 | Ga0209258_100035 | |||
| 817 | Ga0209258_100125 | |||
| 818 | Ga0209258_100889 | |||
| 819 | Ga0209646_1000881 | |||
| 820 | Ga0209026_1000579 | |||
| 821 | Ga0209148_1000045 | |||
| 822 | Ga0209148_1000048 | |||
| 823 | Ga0209759_1000571 | |||
| 824 | Ga0209233_1000101 | |||
| 825 | Ga0209455_1000035 | |||
| 826 | Ga0207697_10002671 | |||
| 827 | Ga0207682_10000996 | |||
| 828 | Ga0207710_10000328 | |||
| 829 | Ga0207688_10000047 | |||
| 830 | Ga0207680_10000080 | |||
| 831 | Ga0207647_10000763 | |||
| 832 | Ga0207647_10013124 | |||
| 833 | Ga0207647_10061317 | |||
| 834 | Ga0207645_10000257 | |||
| 835 | Ga0207645_10011020 | |||
| 836 | Ga0207643_10000002 | |||
| 837 | Ga0207705_10004041 | |||
| 838 | Ga0207705_10004454 | |||
| 839 | Ga0207705_10005603 | |||
| 840 | Ga0207705_10036376 | |||
| 841 | Ga0207705_10055119 | |||
| 842 | Ga0207705_10056444 | |||
| 843 | Ga0207684_10128840 | |||
| 844 | Ga0207654_10002132 | |||
| 845 | Ga0207707_10000008 | |||
| 846 | Ga0207695_10000001 | |||
| 847 | Ga0207695_10000341 | |||
| 848 | Ga0207695_10002046 | |||
| 849 | Ga0207695_10006216 | |||
| 850 | Ga0207695_10017088 | |||
| 851 | Ga0207695_10024652 | |||
| 852 | Ga0207695_10027566 | |||
| 853 | Ga0207695_10033443 | |||
| 854 | Ga0207695_10060383 | |||
| 855 | Ga0207695_10071696 | |||
| 856 | Ga0207695_10175337 | |||
| 857 | Ga0207671_10000012 | |||
| 858 | Ga0207671_10000683 | |||
| 859 | Ga0207671_10006018 | |||
| 860 | Ga0207693_10001958 | |||
| 861 | Ga0207663_10005871 | |||
| 862 | Ga0207660_10001514 | |||
| 863 | Ga0207660_10009761 | |||
| 864 | Ga0207660_10049376 | |||
| 865 | Ga0207662_10000011 | |||
| 866 | Ga0207662_10003044 | |||
| 867 | Ga0207662_10010529 | |||
| 868 | Ga0207657_10000323 | |||
| 869 | Ga0207657_10001624 | |||
| 870 | Ga0207657_10004100 | |||
| 871 | Ga0207657_10017475 | |||
| 872 | Ga0207657_10128034 | |||
| 873 | Ga0207649_10000683 | |||
| 874 | Ga0207649_10003768 | |||
| 875 | Ga0207649_10018949 | |||
| 876 | Ga0207652_10000065 | |||
| 877 | Ga0207652_10002226 | |||
| 878 | Ga0207652_10005711 | |||
| 879 | Ga0207652_10016472 | |||
| 880 | Ga0207652_10020661 | |||
| 881 | Ga0207681_10001307 | |||
| 882 | Ga0207681_10001444 | |||
| 883 | Ga0207694_10002039 | |||
| 884 | Ga0207694_10003498 | |||
| 885 | Ga0207694_10003671 | |||
| 886 | Ga0207694_10007539 | |||
| 887 | Ga0207650_10000356 | |||
| 888 | Ga0207659_10000104 | |||
| 889 | Ga0207687_10006539 | |||
| 890 | Ga0207700_10142434 | |||
| 891 | Ga0207664_10000053 | |||
| 892 | Ga0207690_10001767 | |||
| 893 | Ga0207690_10002631 | |||
| 894 | Ga0207706_10000078 | |||
| 895 | Ga0207686_10017096 | |||
| 896 | Ga0207709_10036430 | |||
| 897 | Ga0207670_10000002 | |||
| 898 | Ga0207670_10000399 | |||
| 899 | Ga0207669_10001368 | |||
| 900 | Ga0207704_10000264 | |||
| 901 | Ga0207691_10000396 | |||
| 902 | Ga0207691_10012657 | |||
| 903 | Ga0207711_10000261 | |||
| 904 | Ga0207689_10000346 | |||
| 905 | Ga0207689_10022129 | |||
| 906 | Ga0207661_10003364 | |||
| 907 | Ga0207661_10167233 | |||
| 908 | Ga0207679_10000445 | |||
| 909 | Ga0207679_10000545 | |||
| 910 | Ga0207679_10014587 | |||
| 911 | Ga0207667_10001100 | |||
| 912 | Ga0207667_10003445 | |||
| 913 | Ga0207667_10006862 | |||
| 914 | Ga0207667_10011261 | |||
| 915 | Ga0207667_10064365 | |||
| 916 | Ga0207667_10143595 | |||
| 917 | Ga0207667_10152108 | |||
| 918 | Ga0207667_10244701 | |||
| 919 | Ga0207651_10000020 | |||
| 920 | Ga0207651_10021823 | |||
| 921 | Ga0207651_10165299 | |||
| 922 | Ga0207712_10000164 | |||
| 923 | Ga0207712_10000611 | |||
| 924 | Ga0207712_10170325 | |||
| 925 | Ga0207668_10000692 | |||
| 926 | Ga0207668_10067206 | |||
| 927 | Ga0207640_10000011 | |||
| 928 | Ga0207640_10000302 | |||
| 929 | Ga0207658_10000372 | |||
| 930 | Ga0207677_10000079 | |||
| 931 | Ga0207677_10073407 | |||
| 932 | Ga0207703_10000148 | |||
| 933 | Ga0207703_10000236 | |||
| 934 | Ga0207703_10058800 | |||
| 935 | Ga0207639_10000025 | |||
| 936 | Ga0207639_10001005 | |||
| 937 | Ga0207639_10009973 | |||
| 938 | Ga0207639_10030937 | |||
| 939 | Ga0207678_10002030 | |||
| 940 | Ga0207678_10040085 | |||
| 941 | Ga0207708_10000459 | |||
| 942 | Ga0207708_10007615 | |||
| 943 | Ga0207702_10013465 | |||
| 944 | Ga0207702_10014773 | |||
| 945 | Ga0207702_10020798 | |||
| 946 | Ga0207702_10227865 | |||
| 947 | Ga0207648_10000378 | |||
| 948 | Ga0207648_10014975 | |||
| 949 | Ga0207676_10000341 | |||
| 950 | Ga0207674_10006281 | |||
| 951 | Ga0207675_100000006 | |||
| 952 | Ga0207675_100002900 | |||
| 953 | Ga0207675_100071494 | |||
| 954 | Ga0207698_10004730 | |||
| 955 | Ga0207698_10005013 | |||
| 956 | Ga0207698_10008267 | |||
| 957 | Ga0207698_10015426 | |||
| 958 | Ga0207698_10036368 | |||
| 959 | Ga0207698_10101622 | |||
| 960 | Ga0207428_10022849 | |||
| 961 | Ga0268266_10000723 | |||
| 962 | Ga0268266_10043407 | |||
| 963 | Ga0268266_10079199 | |||
| 964 | Ga0268265_10000340 | |||
| 965 | Ga0268264_10000995 | |||
| 966 | Ga0265319_1010564 | |||
| 967 | Ga0265318_10000050 | |||
| 968 | Ga0307515_10000008 | |||
| 969 | Ga0307515_10105508 | |||
| 970 | Ga0265338_10000097 | |||
| 971 | Ga0265330_10000009 | |||
| 972 | Ga0265330_10001153 | |||
| 973 | Ga0265328_10001547 | |||
| 974 | Ga0265320_10000006 | |||
| 975 | Ga0265329_10003498 | |||
| 976 | Ga0265339_10005376 | |||
| 977 | Ga0265331_10000004 | |||
| 978 | Ga0265316_10085839 | |||
| 979 | Ga0265313_10001612 | |||
| 980 | Ga0265313_10030672 | |||
| 981 | Ga0265314_10000014 | |||
| 982 | Ga0265314_10002587 | |||
| 983 | Ga0265314_10011629 | |||
| 984 | Ga0265342_10000404 | |||
| 985 | Ga0307412_10001844 | |||
| 986 | Ga0373950_0000005 | |||
| 987 | Ga0373950_0000061 | |||
| 988 | Ga0373954_0017278 | |||
| 989 | Ga0373957_0030788 | |||
| 990 | Ga0373927_0005550 | |||
| 991 | Ga0373933_0001652 | |||
| 992 | Ga0373937_0017744 | |||
| 993 | Ga0373937_0164785 | |||
| 994 | Ga0373925_0014340 | |||
| 995 | Ga0373925_0028864 | |||
| 996 | Ga0373925_0063820 | |||
| 997 | Ga0395899_0060574 | |||
| 998 | Ga0395900_0000013 | |||
| 999 | Ga0395900_0000617 | |||
| 1000 | Ga0395900_0092338 | |||
| 1001 | Ga0395900_0106729 | |||
| 1002 | Ga0395898_0000303 | |||
| 1003 | Ga0395898_0002048 | |||
| 1004 | Ga0395905_0046398 | |||
| 1005 | Ga0436364_0133609 | |||
| 1006 | Ga0436365_1252353 | |||
| 1007 | Ga0436365_1480745 | |||
| 1008 | Ga0436360_0390756 | |||
| 1009 | Ga0436361_0141304 | |||
| 1010 | Ga0436361_0164894 | |||
| 1011 | Ga0436361_1114110 | |||
| 1012 | Ga0436361_1140677 | |||
| 1013 | Ga0436363_0017557 | |||
| 1014 | Ga0436362_0694326 | |||
| 1015 | Ga0439465_0001943 | |||
| 1016 | Ga0466969_0002366 | |||
| 1017 | Ga0466969_0022828 | |||
| 1018 | Ga0466982_0000043 | |||
| 1019 | Ga0466965_0018118 | |||
| 1020 | Ga0466966_0059900 | |||
| 1021 | Ga0466966_0109360 | |||
| 1022 | Ga0466961_0002165 | |||
| 1023 | Ga0466961_0048258 | |||
| 1024 | Ga0466963_0003421 | |||
| 1025 | Ga0466964_0000794 | |||
| 1026 | Ga0453684_0099140 | |||
| 1027 | Ga0466970_0006491 | |||
| 1028 | Ga0466959_0099658 | |||
| 1029 | Ga0451576_0021954 | |||
| 1030 | Ga0466958_0016276 | |||
| 1031 | Ga0466958_0051338 | |||
| 1032 | Ga0466967_0007648 | |||
| 1033 | Ga0466967_0139167 | |||
| 1034 | Ga0495603_0002099 | |||
| 1035 | Ga0495629_0010888 | |||
| 1036 | Ga0495651_0047873 | |||
| 1037 | Ga0495651_0158544 | |||
| 1038 | Ga0495653_0025086 | |||
| 1039 | Ga0495580_0000482 | |||
| 1040 | Ga0495580_0034150 | |||
| 1041 | Ga0495639_0003287 | |||
| 1042 | Ga0495662_0001834 | |||
| 1043 | Ga0495664_0001233 | |||
| 1044 | Ga0495584_0002523 | |||
| 1045 | Ga0495585_0003101 | |||
| 1046 | Ga0495594_0000656 | |||
| 1047 | Ga0495594_0009135 | |||
| 1048 | Ga0495594_0024980 | |||
| 1049 | Ga0495620_0001797 | |||
| 1050 | Ga0495630_0007224 | |||
| 1051 | Ga0495630_0058688 | |||
| 1052 | Ga0495632_0000016 | |||
| 1053 | Ga0495644_0000011 | |||
| 1054 | Ga0495648_0004872 | |||
| 1055 | Ga0495652_0093008 | |||
| 1056 | Ga0495665_0028838 | |||
| 1057 | Ga0495640_0014308 | |||
| 1058 | Ga0495586_0008307 | |||
| 1059 | Ga0495645_0005967 | |||
| 1060 | Ga0495645_0019236 | |||
| 1061 | Ga0495645_0030128 | |||
| 1062 | Ga0495622_0013202 | |||
| 1063 | Ga0495667_0079665 | |||
| 1064 | Ga0495634_0002173 | |||
| 1065 | Ga0495634_0029880 | |||
| 1066 | Ga0495625_0004582 | |||
| 1067 | Ga0495625_0014217 | |||
| 1068 | Ga0495635_0016521 | |||
| 1069 | Ga0495659_0017916 | |||
| 1070 | Ga0495623_0035256 | |||
| 1071 | Ga0495646_0013801 | |||
| 1072 | Ga0495613_0014611 | |||
| 1073 | Ga0495613_0018611 | |||
| 1074 | Ga0495600_0004359 | |||
| 1075 | Ga0495581_0000504 | |||
| 1076 | Ga0495604_0007012 | |||
| 1077 | Ga0495674_0001339 | |||
| 1078 | Ga0495674_0018901 | |||
| 1079 | Ga0495680_0012546 | |||
| 1080 | Ga0495683_0004359 | |||
| 1081 | Ga0495675_0002972 | |||
| 1082 | Ga0495675_0024803 | |||
| 1083 | Ga0495673_0000018 | |||
| 1084 | Ga0495684_0020385 | |||
| 1085 | Ga0495686_0000009 | |||
| 1086 | Ga0495686_0000204 | |||
| 1087 | Ga0495686_0020931 | |||
| 1088 | Ga0495602_0049899 | |||
| 1089 | Ga0495614_0000176 | |||
| 1090 | Ga0496100_0007942 | |||
| 1091 | Ga0496101_0016442 | |||
| 1092 | Ga0496102_0000960 | |||
| 1093 | Ga0496102_0004947 | |||
| 1094 | Ga0496103_0018220 | |||
| 1095 | Ga0496103_0028216 | |||
| 1096 | Ga0496104_0004038 | |||
| 1097 | Ga0496104_0084415 | |||
| 1098 | Ga0496104_0127314 | |||
| 1099 | Ga0496106_0098926 | |||
| 1100 | Ga0496108_0006006 | |||
| 1101 | Ga0496108_0020699 | |||
| 1102 | Ga0496108_0032569 | |||
| 1103 | Ga0496109_0036098 | |||
| 1104 | Ga0496109_0062855 | |||
| 1105 | Ga0496110_0122219 | |||
| 1106 | Ga0496111_0023938 | |||
| 1107 | Ga0496112_0009377 | |||
| 1108 | Ga0496112_0036305 | |||
| 1109 | Ga0496114_0000065 | |||
| 1110 | Ga0496114_0014141 | |||
| 1111 | Ga0496114_0078124 | |||
| 1112 | Ga0496115_0011623 | |||
| 1113 | Ga0496115_0088091 | |||
| 1114 | Ga0496121_0026216 | |||
| 1115 | Ga0496126_0001516 | |||
| 1116 | Ga0501299_001753 | |||
| 1117 | Ga0501032_0039671 | |||
| 1118 | Ga0501032_0087678 | |||
| 1119 | Ga0501033_0038064 | |||
| 1120 | Ga0501033_0038468 | |||
| 1121 | Ga0501033_0071594 | |||
| 1122 | Ga0501034_0000963 | |||
| 1123 | Ga0501036_0033905 | |||
| 1124 | Ga0501036_0094923 | |||
| 1125 | Ga0501036_0130327 | |||
| 1126 | Ga0501038_0069120 | |||
| 1127 | Ga0501039_0065514 | |||
| 1128 | Ga0501040_0073516 | |||
| 1129 | Ga0501042_0090860 | |||
| 1130 | Ga0501043_0000305 | |||
| 1131 | Ga0501043_0002542 | |||
| 1132 | Ga0501046_0000009 | |||
| 1133 | Ga0501046_0000385 | |||
| 1134 | Ga0501046_0004854 | |||
| 1135 | Ga0501046_0006733 | |||
| 1136 | Ga0501047_0000004 | |||
| 1137 | Ga0501047_0000365 | |||
| 1138 | Ga0501047_0015948 | |||
| 1139 | Ga0501048_0001146 | |||
| 1140 | Ga0501048_0003237 | |||
| 1141 | Ga0501067_0000391 | |||
| 1142 | Ga0501067_0002692 | |||
| 1143 | Ga0501067_0020311 | |||
| 1144 | Ga0501068_0045057 | |||
| 1145 | Ga0501068_0058479 | |||
| 1146 | Ga0501070_0000211 | |||
| 1147 | Ga0501070_0000928 | |||
| 1148 | Ga0501070_0025212 | |||
| 1149 | Ga0501070_0059447 | |||
| 1150 | Ga0501072_0000012 | |||
| 1151 | Ga0501073_0001323 | |||
| 1152 | Ga0501073_0002572 | |||
| 1153 | Ga0501073_0009197 | |||
| 1154 | Ga0501074_0002782 | |||
| 1155 | Ga0501074_0019112 | |||
| 1156 | Ga0501074_0035579 | |||
| 1157 | Ga0501074_0060629 | |||
| 1158 | Ga0501250_001008 | |||
| 1159 | Ga0501225_0003440 | |||
| 1160 | Ga0501080_0034111 | |||
| 1161 | Ga0501080_0088960 | |||
| 1162 | Ga0501080_0129262 | |||
| 1163 | Ga0501083_0051833 | |||
| 1164 | Ga0501083_0052976 | |||
| 1165 | Ga0501083_0075344 | |||
| 1166 | Ga0501044_0040095 | |||
| 1167 | nmdc:mga05p37_8895_c1 | |||
| 1168 | nmdc:mga08y16_4270_c1 | |||
| 1169 | nmdc:mga08x19_39410_c1 | |||
| 1170 | nmdc:mga0a205_19009_c1 | |||
| 1171 | nmdc:mga0sz30_43148_c1 | |||
| 1172 | Ga0495601_0008167 | |||
| 1173 | Ga0495601_0040481 | |||
| 1174 | Ga0500616_0000020 | |||
| 1175 | Ga0500633_0007410 | |||
| 1176 | Ga0501084_0000038 | |||
| 1177 | Ga0500661_002056 | |||
| 1178 | Ga0501082_0025677 | |||
| 1179 | Ga0530510_0071747 | |||
| 1180 | 2671118295 | |||
| 1181 | 2842916665 | |||
| 1182 | 2842919149 | |||
| 1183 | 2881413417 | |||
| 1184 | 2919406239 | |||
| 1185 | 2953994575 | |||
| 1186 | 641645923 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3abk-assembly1.cif.gz_A | bovine heart cytochrome c oxidase at the no-bound fully reduced state (50k) | 0.9693 | 30 | 532 |
| 3omi-assembly2.cif.gz_C | catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with d132a mutation | 0.9688 | 30 | 521 |
| 8d4t-assembly1.cif.gz_N | mammalian civ with gdn bound | 0.9687 | 30 | 532 |
| 3oma-assembly2.cif.gz_C | catalytic core subunits (i and ii) of cytochrome c oxidase from rhodobacter sphaeroides with k362m mutation | 0.9677 | 30 | 521 |
| 6pw1-assembly2.cif.gz_C | cytochrome c oxidase delta 16 | 0.9677 | 29 | 523 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O21042_10_509_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9676 | 29 | 494 | 1.20.210.10 |
| af_Q7HP04_41_512_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9674 | 27 | 487 | 1.20.210.10 |
| 2yevD01 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9637 | 28 | 540 | 1.20.210.10 |
| af_Q9ZZX1_1_342_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9633 | 26 | 351 | 1.20.210.10 |
| af_P03878_1_258_1.20.210.10 | Mainly Alpha;Up-down Bundle;Cytochrome C Oxidase; Chain A;Cytochrome c oxidase-like, subunit I domain | 0.9588 | 26 | 270 | 1.20.210.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9YPN7-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.9831 | 22 | 539 |
GO:0004129
GO:0005886 GO:0006119 GO:0015990 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A0A0D6Y6-F1-model_v4 | Cytochrome C oxidase subunit I | 0.983 | 24 | 538 |
GO:0004129
GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904 |
| AF-A0A534UJA3-F1-model_v4 | Cytochrome c oxidase subunit 1 (EC 7.1.1.9) | 0.9829 | 18 | 543 |
GO:0004129
GO:0005886 GO:0006119 GO:0015990 GO:0020037 GO:0022904 GO:0046872 |
| AF-A0A2V6KF27-F1-model_v4 | Cytochrome c oxidase subunit I | 0.9826 | 15 | 538 |
GO:0004129
GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904 |
| AF-A0A7Y6PLJ8-F1-model_v4 | Cytochrome c oxidase subunit I | 0.9826 | 19 | 539 |
GO:0004129
GO:0009060 GO:0015990 GO:0016020 GO:0020037 GO:0022904 |