F467144

General Info

Members Datasets Scaffolds Average Seq Length
592 260 1184 261

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10025473|Ga0265760_100254732
Length 297
Sequence MEVPFSVAVGVGVHGVLRLRCCFADREAKSSLRMTKRFMPLTFYKKPALVVYVTCGDPDLATTREIVLAAIEAGADVIELGVPFSDPVADGPVIQRASERALKHGTSLAQVLTMAAEVRVQAQSTGLIVFSYLNPILRMGMEKFCKVARAAGVDGALVTDLPVEEAGEYLRAMRAQDLAPIFLAAPTSPDERLKRIAEASRGFVYAVSRTGVTGARQQLAGDAQKLVKRLRRVTKLPIAVGFGISNASQFEEVGKFADAVVVGSAIVEMIEKNGGREAEAVGEFVRGLSAVSLQPSA

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
106 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
167 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
173 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
174 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
175 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
176 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
177 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
182 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
183 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
188 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
189 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
190 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
192 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
194 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
208 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.16
Metatranscriptomes 0.68
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 3.21
Rhizosphere 94.93
Stem 0
Stem Tuber 0
Unclassified 3.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10025473 3300031090 Bacteria 1727
2 Ga0065704_10004492 3300005289 Bacteria 4390
3 Ga0065707_10001423 3300005295 Bacteria 6610
4 Ga0070658_10227139 3300005327 Bacteria 1580
5 Ga0070676_10034851 3300005328 Bacteria 2891
6 Ga0070683_100000622 3300005329 Bacteria 25523
7 Ga0070683_100120825 3300005329 Bacteria 2474
8 Ga0070690_100032313 3300005330 Bacteria 3268
9 Ga0070670_100012898 3300005331 Bacteria 7154
10 Ga0068869_100000494 3300005334 Bacteria 21941
11 Ga0070666_10018231 3300005335 Bacteria 4510
12 Ga0070680_100060458 3300005336 Bacteria 3100
13 Ga0070682_100026667 3300005337 Bacteria 3460
14 Ga0070682_100303758 3300005337 Bacteria 1172
15 Ga0068868_100000004 3300005338 Bacteria 150718
16 Ga0068868_100012927 3300005338 Bacteria 6107
17 Ga0068868_100276841 3300005338 Bacteria 1419
18 Ga0070660_100002466 3300005339 Bacteria 12681
19 Ga0070660_100345916 3300005339 Bacteria 1224
20 Ga0070689_100115347 3300005340 Bacteria 2141
21 Ga0070687_100116493 3300005343 Bacteria 1521
22 Ga0070661_100000803 3300005344 Bacteria 22558
23 Ga0070661_100010136 3300005344 Bacteria 6544
24 Ga0070661_100056550 3300005344 Bacteria 2875
25 Ga0070668_100178163 3300005347 Bacteria 1735
26 Ga0070669_100117853 3300005353 Unclassified 2022
27 Ga0070675_100178843 3300005354 Unclassified 1833
28 Ga0070671_100076351 3300005355 Bacteria 2799
29 Ga0070673_100014401 3300005364 Bacteria 5506
30 Ga0070673_100324517 3300005364 Bacteria 1361
31 Ga0070659_100067076 3300005366 Bacteria 2845
32 Ga0070667_100001102 3300005367 Bacteria 24760
33 Ga0070667_100029634 3300005367 Bacteria 4562
34 Ga0070667_100278493 3300005367 Bacteria 1501
35 Ga0070709_10000874 3300005434 Bacteria 16864
36 Ga0070709_10051086 3300005434 Bacteria 2593
37 Ga0070709_10364950 3300005434 Bacteria 1070
38 Ga0070709_10477736 3300005434 Bacteria 943
39 Ga0070714_100014970 3300005435 Bacteria 6235
40 Ga0070714_100025370 3300005435 Bacteria 4892
41 Ga0070714_100041425 3300005435 Bacteria 3886
42 Ga0070714_100047283 3300005435 Bacteria 3655
43 Ga0070713_100000452 3300005436 Bacteria 26240
44 Ga0070713_100001346 3300005436 Bacteria 15710
45 Ga0070713_100074806 3300005436 Bacteria 2871
46 Ga0070713_100211685 3300005436 Bacteria 1755
47 Ga0070710_10056282 3300005437 Bacteria 2225
48 Ga0070711_100102857 3300005439 Bacteria 2081
49 Ga0070705_100077071 3300005440 Bacteria 2035
50 Ga0070705_100297845 3300005440 Bacteria 1154
51 Ga0070708_100001677 3300005445 Bacteria 17006
52 Ga0070708_100001992 3300005445 Bacteria 15726
53 Ga0070708_100016384 3300005445 Bacteria 6148
54 Ga0070663_100064717 3300005455 Bacteria 2643
55 Ga0070663_100161338 3300005455 Unclassified 1726
56 Ga0070678_100101276 3300005456 Bacteria 2233
57 Ga0070662_100003506 3300005457 Bacteria 9784
58 Ga0070681_10001332 3300005458 Bacteria 21596
59 Ga0070681_10007066 3300005458 Bacteria 10932
60 Ga0070681_10202858 3300005458 Bacteria 1901
61 Ga0070681_10270720 3300005458 Bacteria 1610
62 Ga0070681_10339293 3300005458 Bacteria 1412
63 Ga0068867_100077001 3300005459 Bacteria 2505
64 Ga0068867_100122286 3300005459 Bacteria 2013
65 Ga0070706_100002528 3300005467 Bacteria 18396
66 Ga0070706_100007456 3300005467 Bacteria 10255
67 Ga0070706_100007932 3300005467 Bacteria 9915
68 Ga0070706_100012937 3300005467 Bacteria 7723
69 Ga0070706_100064333 3300005467 Bacteria 3390
70 Ga0070706_100327683 3300005467 Bacteria 1428
71 Ga0070707_100001967 3300005468 Bacteria 19655
72 Ga0070707_100046391 3300005468 Bacteria 4158
73 Ga0070698_100004850 3300005471 Bacteria 14764
74 Ga0070698_100159554 3300005471 Bacteria 2199
75 Ga0070698_100226458 3300005471 Bacteria 1803
76 Ga0070699_100001330 3300005518 Bacteria 22773
77 Ga0070679_100002431 3300005530 Bacteria 16880
78 Ga0070679_100033309 3300005530 Bacteria 5101
79 Ga0070679_100123200 3300005530 Bacteria 2576
80 Ga0070679_100162681 3300005530 Bacteria 2206
81 Ga0070679_100173148 3300005530 Bacteria 2131
82 Ga0070684_100002702 3300005535 Bacteria 13101
83 Ga0070684_100018365 3300005535 Bacteria 5760
84 Ga0070697_100004597 3300005536 Bacteria 10602
85 Ga0070697_100034586 3300005536 Bacteria 4075
86 Ga0068853_100000160 3300005539 Bacteria 45847
87 Ga0068853_100063817 3300005539 Bacteria 3191
88 Ga0068853_100176811 3300005539 Bacteria 1934
89 Ga0070686_100022716 3300005544 Bacteria 3740
90 Ga0070695_100135277 3300005545 Bacteria 1703
91 Ga0070696_100085704 3300005546 Bacteria 2236
92 Ga0070693_100051325 3300005547 Bacteria 2361
93 Ga0070693_100060563 3300005547 Bacteria 2198
94 Ga0070665_100005557 3300005548 Bacteria 12965
95 Ga0070665_100012491 3300005548 Bacteria 8559
96 Ga0070665_100102596 3300005548 Bacteria 2864
97 Ga0070704_100194719 3300005549 Bacteria 1632
98 Ga0068855_100004400 3300005563 Bacteria 17222
99 Ga0068855_100013111 3300005563 Bacteria 9996
100 Ga0068855_100032879 3300005563 Bacteria 6192
101 Ga0068855_100049109 3300005563 Bacteria 4977
102 Ga0068855_100089798 3300005563 Bacteria 3547
103 Ga0068855_100218482 3300005563 Bacteria 2138
104 Ga0070664_100009856 3300005564 Bacteria 7741
105 Ga0070664_100126570 3300005564 Bacteria 2242
106 Ga0070664_100224450 3300005564 Bacteria 1682
107 Ga0068857_100000700 3300005577 Bacteria 24940
108 Ga0068857_100015250 3300005577 Bacteria 6707
109 Ga0068857_100028774 3300005577 Bacteria 4902
110 Ga0068857_100195174 3300005577 Bacteria 1845
111 Ga0068854_100020488 3300005578 Bacteria 4475
112 Ga0068854_100020982 3300005578 Bacteria 4427
113 Ga0068856_100000911 3300005614 Bacteria 31594
114 Ga0068856_100079705 3300005614 Bacteria 3247
115 Ga0068856_100183429 3300005614 Bacteria 2106
116 Ga0068856_100192749 3300005614 Bacteria 2052
117 Ga0068856_100610630 3300005614 Bacteria 1111
118 Ga0070702_100550912 3300005615 Bacteria 856
119 Ga0068852_100000128 3300005616 Bacteria 50718
120 Ga0068852_100000198 3300005616 Bacteria 41169
121 Ga0068852_100018806 3300005616 Bacteria 5451
122 Ga0068852_100046527 3300005616 Bacteria 3698
123 Ga0068852_100135436 3300005616 Bacteria 2274
124 Ga0068859_100016248 3300005617 Bacteria 7477
125 Ga0068859_100026751 3300005617 Bacteria 5787
126 Ga0068859_100053846 3300005617 Bacteria 4046
127 Ga0068859_100286607 3300005617 Bacteria 1740
128 Ga0068859_100492468 3300005617 Bacteria 1321
129 Ga0068864_100003135 3300005618 Bacteria 13660
130 Ga0068864_100038087 3300005618 Bacteria 4104
131 Ga0068864_100179493 3300005618 Bacteria 1935
132 Ga0068866_10068095 3300005718 Unclassified 1871
133 Ga0068861_100201557 3300005719 Bacteria 1670
134 Ga0068861_100259614 3300005719 Bacteria 1487
135 Ga0068851_10029327 3300005834 Bacteria 2723
136 Ga0068851_10042840 3300005834 Bacteria 2280
137 Ga0068863_100003497 3300005841 Bacteria 15501
138 Ga0068863_100033533 3300005841 Bacteria 4891
139 Ga0068858_100002015 3300005842 Bacteria 20768
140 Ga0068858_100057620 3300005842 Bacteria 3590
141 Ga0068858_100066372 3300005842 Bacteria 3340
142 Ga0068858_100400178 3300005842 Bacteria 1319
143 Ga0068860_100000069 3300005843 Bacteria 179064
144 Ga0068860_100057036 3300005843 Bacteria 3712
145 Ga0081540_1009176 3300005983 Bacteria 6824
146 Ga0070717_10005877 3300006028 Bacteria 8986
147 Ga0070717_10007299 3300006028 Bacteria 8199
148 Ga0070717_10033797 3300006028 Bacteria 4128
149 Ga0070717_10064002 3300006028 Bacteria 3054
150 Ga0070717_10120402 3300006028 Bacteria 2248
151 Ga0070717_10264781 3300006028 Unclassified 1521
152 Ga0070715_10019895 3300006163 Bacteria 2581
153 Ga0070716_100020821 3300006173 Bacteria 3448
154 Ga0070716_100044704 3300006173 Bacteria 2482
155 Ga0070716_100094695 3300006173 Bacteria 1816
156 Ga0070712_100000238 3300006175 Bacteria 30830
157 Ga0070712_100012076 3300006175 Bacteria 5489
158 Ga0070712_100100374 3300006175 Bacteria 2138
159 Ga0097621_100002569 3300006237 Bacteria 12434
160 Ga0097621_100025151 3300006237 Bacteria 4656
161 Ga0097621_100058359 3300006237 Bacteria 3157
162 Ga0097621_100084783 3300006237 Bacteria 2642
163 Ga0068871_100001097 3300006358 Bacteria 18178
164 Ga0068871_100007508 3300006358 Bacteria 7795
165 Ga0068871_100150359 3300006358 Bacteria 1985
166 Ga0068871_100167689 3300006358 Bacteria 1881
167 Ga0068871_100206351 3300006358 Bacteria 1698
168 Ga0075433_10005914 3300006852 Bacteria 9636
169 Ga0075433_10014707 3300006852 Bacteria 6403
170 Ga0075436_100000448 3300006914 Bacteria 26448
171 Ga0075436_100319081 3300006914 Bacteria 1116
172 Ga0097620_100016248 3300006931 Bacteria 7477
173 Ga0097620_100026749 3300006931 Bacteria 5787
174 Ga0097620_100053848 3300006931 Bacteria 4046
175 Ga0097620_100286587 3300006931 Bacteria 1740
176 Ga0097620_100492496 3300006931 Bacteria 1321
177 Ga0075435_100070256 3300007076 Bacteria 2858
178 Ga0075435_100281383 3300007076 Bacteria 1420
179 Ga0075435_100447384 3300007076 Bacteria 1114
180 Ga0105240_10000084 3300009093 Bacteria 192787
181 Ga0105240_10000683 3300009093 Bacteria 62430
182 Ga0105240_10001414 3300009093 Bacteria 41169
183 Ga0105240_10005376 3300009093 Bacteria 19100
184 Ga0105240_10007183 3300009093 Bacteria 16221
185 Ga0105240_10011981 3300009093 Bacteria 12019
186 Ga0105240_10016547 3300009093 Bacteria 9982
187 Ga0105240_10020172 3300009093 Bacteria 8897
188 Ga0105240_10099821 3300009093 Bacteria 3533
189 Ga0105240_10369801 3300009093 Bacteria 1621
190 Ga0105245_10002009 3300009098 Bacteria 18458
191 Ga0105245_10186632 3300009098 Bacteria 1984
192 Ga0105245_10279117 3300009098 Unclassified 1632
193 Ga0105245_10352110 3300009098 Bacteria 1459
194 Ga0105247_10000429 3300009101 Bacteria 35735
195 Ga0105247_10015672 3300009101 Bacteria 4538
196 Ga0105247_10095844 3300009101 Bacteria 1890
197 Ga0114129_10471001 3300009147 Bacteria 1645
198 Ga0105243_10116441 3300009148 Bacteria 2245
199 Ga0105241_10000126 3300009174 Bacteria 54992
200 Ga0105241_10000246 3300009174 Bacteria 40855
201 Ga0105241_10001726 3300009174 Bacteria 16593
202 Ga0105241_10005467 3300009174 Bacteria 9395
203 Ga0105241_10011195 3300009174 Bacteria 6577
204 Ga0105241_10027117 3300009174 Bacteria 4264
205 Ga0105241_10084540 3300009174 Bacteria 2491
206 Ga0105242_10060334 3300009176 Bacteria 3116
207 Ga0105242_10383763 3300009176 Unclassified 1307
208 Ga0105248_10141244 3300009177 Bacteria 2716
209 Ga0105248_10171375 3300009177 Bacteria 2446
210 Ga0105248_10233635 3300009177 Bacteria 2070
211 Ga0105237_10000600 3300009545 Bacteria 50222
212 Ga0105237_10002410 3300009545 Bacteria 23212
213 Ga0105237_10014754 3300009545 Bacteria 8155
214 Ga0105237_10025015 3300009545 Bacteria 6108
215 Ga0105238_10000160 3300009551 Bacteria 73564
216 Ga0105238_10000333 3300009551 Bacteria 51587
217 Ga0105238_10000669 3300009551 Bacteria 35976
218 Ga0105238_10004744 3300009551 Bacteria 13447
219 Ga0105238_10009141 3300009551 Bacteria 9919
220 Ga0105238_10316774 3300009551 Bacteria 1545
221 Ga0105249_10031589 3300009553 Bacteria 4789
222 Ga0105249_10044421 3300009553 Bacteria 4041
223 Ga0099796_10017934 3300010159 Unclassified 2117
224 Ga0099796_10081216 3300010159 Bacteria 1189
225 Ga0105239_10005862 3300010375 Bacteria 14324
226 Ga0105239_10013521 3300010375 Bacteria 9061
227 Ga0105239_10360898 3300010375 Bacteria 1641
228 Ga0105246_10000367 3300011119 Bacteria 24218
229 Ga0105246_10022046 3300011119 Bacteria 4107
230 Ga0157371_10037357 3300013102 Bacteria 3476
231 Ga0157371_10056139 3300013102 Bacteria 2793
232 Ga0157370_10000733 3300013104 Bacteria 41175
233 Ga0157370_10010701 3300013104 Bacteria 9652
234 Ga0157370_10137567 3300013104 Bacteria 2276
235 Ga0157370_10174415 3300013104 Bacteria 1998
236 Ga0157369_10000777 3300013105 Bacteria 41175
237 Ga0157369_10006928 3300013105 Bacteria 13078
238 Ga0157369_10009806 3300013105 Bacteria 10955
239 Ga0157369_10042622 3300013105 Bacteria 4950
240 Ga0157369_10218751 3300013105 Bacteria 1994
241 Ga0157369_10312954 3300013105 Bacteria 1633
242 Ga0157374_10000612 3300013296 Bacteria 31607
243 Ga0157374_10003225 3300013296 Bacteria 13703
244 Ga0157374_10003603 3300013296 Bacteria 13038
245 Ga0157374_10031528 3300013296 Bacteria 4819
246 Ga0157374_10097442 3300013296 Bacteria 2814
247 Ga0157378_10000594 3300013297 Bacteria 33911
248 Ga0157378_10085157 3300013297 Bacteria 2863
249 Ga0157378_10300708 3300013297 Bacteria 1553
250 Ga0157378_10832454 3300013297 Bacteria 950
251 Ga0163162_10006695 3300013306 Bacteria 11170
252 Ga0163162_10116679 3300013306 Bacteria 2771
253 Ga0163162_10685832 3300013306 Bacteria 1147
254 Ga0163162_11005893 3300013306 Bacteria 943
255 Ga0157372_10000551 3300013307 Bacteria 41175
256 Ga0157372_10001342 3300013307 Bacteria 26606
257 Ga0157372_10018390 3300013307 Bacteria 7511
258 Ga0157372_10018623 3300013307 Bacteria 7469
259 Ga0157372_10025450 3300013307 Bacteria 6435
260 Ga0157372_10046400 3300013307 Bacteria 4823
261 Ga0157372_10068048 3300013307 Bacteria 4004
262 Ga0157372_10227379 3300013307 Bacteria 2163
263 Ga0157372_10352777 3300013307 Bacteria 1714
264 Ga0157372_10398394 3300013307 Bacteria 1604
265 Ga0157375_10014485 3300013308 Bacteria 7035
266 Ga0157375_10074193 3300013308 Bacteria 3423
267 Ga0163163_10008686 3300014325 Bacteria 9035
268 Ga0163163_10008874 3300014325 Bacteria 8951
269 Ga0163163_10033320 3300014325 Bacteria 4983
270 Ga0163163_10213274 3300014325 Bacteria 1980
271 Ga0163163_10596507 3300014325 Bacteria 1168
272 Ga0182008_10206038 3300014497 Bacteria 1002
273 Ga0157379_10000285 3300014968 Bacteria 40069
274 Ga0157379_10033927 3300014968 Bacteria 4550
275 Ga0157379_10140252 3300014968 Bacteria 2179
276 Ga0157379_10179979 3300014968 Bacteria 1910
277 Ga0157376_10000340 3300014969 Bacteria 31116
278 Ga0157376_10100424 3300014969 Bacteria 2527
279 Ga0157376_10169399 3300014969 Bacteria 1987
280 Ga0157376_10297910 3300014969 Bacteria 1525
281 Ga0157376_10829871 3300014969 Bacteria 939
282 Ga0163161_10035523 3300017792 Bacteria 3568
283 Ga0213876_10040878 3300021384 Bacteria 2450
284 Ga0224571_100182 3300022734 Bacteria 2934
285 Ga0228598_1002144 3300024227 Bacteria 4319
286 Ga0207642_10039299 3300025899 Bacteria 2055
287 Ga0207710_10000516 3300025900 Bacteria 23849
288 Ga0207680_10094055 3300025903 Bacteria 1913
289 Ga0207647_10075764 3300025904 Bacteria 2024
290 Ga0207647_10102407 3300025904 Bacteria 1698
291 Ga0207685_10002469 3300025905 Bacteria 4248
292 Ga0207685_10078039 3300025905 Bacteria 1362
293 Ga0207699_10003658 3300025906 Bacteria 7343
294 Ga0207699_10054750 3300025906 Bacteria 2371
295 Ga0207699_10431068 3300025906 Bacteria 943
296 Ga0207645_10005173 3300025907 Bacteria 9533
297 Ga0207643_10200460 3300025908 Bacteria 1215
298 Ga0207705_10093639 3300025909 Bacteria 2203
299 Ga0207705_10187720 3300025909 Bacteria 1562
300 Ga0207684_10000343 3300025910 Bacteria 64775
301 Ga0207684_10114336 3300025910 Bacteria 2311
302 Ga0207684_10140106 3300025910 Bacteria 2079
303 Ga0207684_10272704 3300025910 Bacteria 1460
304 Ga0207654_10000079 3300025911 Bacteria 63973
305 Ga0207654_10000122 3300025911 Bacteria 50286
306 Ga0207654_10000144 3300025911 Bacteria 44931
307 Ga0207654_10000981 3300025911 Bacteria 15653
308 Ga0207654_10025534 3300025911 Bacteria 3188
309 Ga0207654_10037740 3300025911 Bacteria 2706
310 Ga0207654_10129570 3300025911 Bacteria 1595
311 Ga0207707_10003765 3300025912 Bacteria 13441
312 Ga0207707_10019296 3300025912 Bacteria 5950
313 Ga0207707_10130590 3300025912 Bacteria 2197
314 Ga0207695_10000052 3300025913 Bacteria 398089
315 Ga0207695_10000145 3300025913 Bacteria 209555
316 Ga0207695_10000306 3300025913 Bacteria 119113
317 Ga0207695_10000380 3300025913 Bacteria 100840
318 Ga0207695_10002205 3300025913 Bacteria 29296
319 Ga0207695_10003111 3300025913 Bacteria 23739
320 Ga0207695_10004211 3300025913 Bacteria 19765
321 Ga0207695_10101153 3300025913 Bacteria 2877
322 Ga0207695_10103376 3300025913 Bacteria 2840
323 Ga0207695_10185139 3300025913 Bacteria 2002
324 Ga0207695_10361823 3300025913 Bacteria 1337
325 Ga0207671_10000076 3300025914 Bacteria 151211
326 Ga0207671_10000541 3300025914 Bacteria 51028
327 Ga0207671_10218869 3300025914 Bacteria 1491
328 Ga0207693_10000182 3300025915 Bacteria 57166
329 Ga0207693_10044220 3300025915 Bacteria 3500
330 Ga0207660_10119563 3300025917 Bacteria 1994
331 Ga0207662_10073545 3300025918 Bacteria 2073
332 Ga0207657_10001194 3300025919 Bacteria 27626
333 Ga0207657_10052147 3300025919 Bacteria 3552
334 Ga0207657_10272925 3300025919 Bacteria 1344
335 Ga0207649_10002069 3300025920 Bacteria 11411
336 Ga0207649_10008442 3300025920 Bacteria 5616
337 Ga0207649_10063301 3300025920 Bacteria 2335
338 Ga0207649_10322559 3300025920 Bacteria 1135
339 Ga0207652_10024533 3300025921 Bacteria 5004
340 Ga0207652_10063031 3300025921 Bacteria 3205
341 Ga0207652_10119711 3300025921 Bacteria 2342
342 Ga0207652_10191685 3300025921 Bacteria 1839
343 Ga0207652_10249893 3300025921 Bacteria 1599
344 Ga0207652_10594716 3300025921 Bacteria 992
345 Ga0207646_10010660 3300025922 Bacteria 8950
346 Ga0207646_10173772 3300025922 Unclassified 1945
347 Ga0207646_10298857 3300025922 Bacteria 1454
348 Ga0207681_10125584 3300025923 Bacteria 1889
349 Ga0207694_10000029 3300025924 Bacteria 239107
350 Ga0207694_10000141 3300025924 Bacteria 74190
351 Ga0207694_10012950 3300025924 Bacteria 6282
352 Ga0207694_10035940 3300025924 Bacteria 3801
353 Ga0207694_10098553 3300025924 Bacteria 2314
354 Ga0207659_10330641 3300025926 Bacteria 1260
355 Ga0207687_10001340 3300025927 Bacteria 16844
356 Ga0207687_10028719 3300025927 Bacteria 3738
357 Ga0207700_10000217 3300025928 Bacteria 34284
358 Ga0207700_10003969 3300025928 Bacteria 8656
359 Ga0207700_10531970 3300025928 Bacteria 1042
360 Ga0207664_10031008 3300025929 Bacteria 4087
361 Ga0207664_10080485 3300025929 Bacteria 2648
362 Ga0207664_10108914 3300025929 Bacteria 2301
363 Ga0207664_10201599 3300025929 Bacteria 1718
364 Ga0207644_10002743 3300025931 Bacteria 11341
365 Ga0207706_10002665 3300025933 Bacteria 17382
366 Ga0207686_10267479 3300025934 Bacteria 1256
367 Ga0207686_10428743 3300025934 Bacteria 1013
368 Ga0207704_10134947 3300025938 Unclassified 1716
369 Ga0207665_10046207 3300025939 Unclassified 2917
370 Ga0207665_10052272 3300025939 Bacteria 2752
371 Ga0207665_10076007 3300025939 Bacteria 2302
372 Ga0207691_10006913 3300025940 Bacteria 10941
373 Ga0207711_10000016 3300025941 Bacteria 486741
374 Ga0207711_10004269 3300025941 Bacteria 12212
375 Ga0207711_10011774 3300025941 Bacteria 7265
376 Ga0207711_10056297 3300025941 Bacteria 3379
377 Ga0207711_10087703 3300025941 Bacteria 2730
378 Ga0207689_10001059 3300025942 Bacteria 26471
379 Ga0207689_10016786 3300025942 Bacteria 6197
380 Ga0207689_10046126 3300025942 Bacteria 3603
381 Ga0207661_10000489 3300025944 Bacteria 25486
382 Ga0207661_10100567 3300025944 Bacteria 2427
383 Ga0207661_10115987 3300025944 Bacteria 2273
384 Ga0207661_10153645 3300025944 Unclassified 1991
385 Ga0207679_10079448 3300025945 Bacteria 2501
386 Ga0207667_10001853 3300025949 Bacteria 26558
387 Ga0207667_10007242 3300025949 Bacteria 13383
388 Ga0207667_10010076 3300025949 Bacteria 11080
389 Ga0207667_10011700 3300025949 Bacteria 10179
390 Ga0207667_10014152 3300025949 Bacteria 9106
391 Ga0207651_10008108 3300025960 Bacteria 5647
392 Ga0207651_10079764 3300025960 Bacteria 2353
393 Ga0207712_10006249 3300025961 Bacteria 7509
394 Ga0207712_10704160 3300025961 Bacteria 882
395 Ga0207668_10010161 3300025972 Bacteria 5676
396 Ga0207640_10005960 3300025981 Bacteria 6656
397 Ga0207640_10037253 3300025981 Bacteria 3059
398 Ga0207640_10057215 3300025981 Bacteria 2563
399 Ga0207658_10003304 3300025986 Bacteria 11443
400 Ga0207658_10188495 3300025986 Unclassified 1712
401 Ga0207677_10000023 3300026023 Bacteria 128514
402 Ga0207677_10009566 3300026023 Bacteria 5455
403 Ga0207703_10004334 3300026035 Bacteria 11660
404 Ga0207703_10262393 3300026035 Bacteria 1562
405 Ga0207703_10321038 3300026035 Bacteria 1418
406 Ga0207639_10000050 3300026041 Bacteria 121432
407 Ga0207639_10108085 3300026041 Bacteria 2261
408 Ga0207639_10138248 3300026041 Bacteria 2026
409 Ga0207678_10015533 3300026067 Bacteria 6695
410 Ga0207702_10000643 3300026078 Bacteria 38203
411 Ga0207702_10001243 3300026078 Bacteria 25735
412 Ga0207702_10020068 3300026078 Bacteria 5537
413 Ga0207702_10245105 3300026078 Unclassified 1680
414 Ga0207702_10398293 3300026078 Bacteria 1327
415 Ga0207702_10923078 3300026078 Bacteria 865
416 Ga0207641_10023893 3300026088 Bacteria 5039
417 Ga0207648_10017005 3300026089 Bacteria 6628
418 Ga0207676_10001284 3300026095 Bacteria 18676
419 Ga0207676_10045586 3300026095 Bacteria 3389
420 Ga0207674_10001505 3300026116 Bacteria 30063
421 Ga0207674_10002586 3300026116 Bacteria 22784
422 Ga0207674_10093917 3300026116 Bacteria 2987
423 Ga0207674_10127267 3300026116 Bacteria 2512
424 Ga0207674_10450642 3300026116 Bacteria 1244
425 Ga0207675_100032766 3300026118 Bacteria 4841
426 Ga0207675_100069306 3300026118 Bacteria 3296
427 Ga0207683_10001215 3300026121 Bacteria 23357
428 Ga0207698_10000034 3300026142 Bacteria 108528
429 Ga0207698_10000743 3300026142 Bacteria 18908
430 Ga0207698_10013081 3300026142 Bacteria 5463
431 Ga0207698_10096371 3300026142 Bacteria 2438
432 Ga0207698_10107102 3300026142 Bacteria 2333
433 Ga0207698_10187685 3300026142 Bacteria 1838
434 Ga0207698_10459358 3300026142 Bacteria 1231
435 Ga0265354_1003886 3300028016 Bacteria 1620
436 Ga0268266_10015296 3300028379 Bacteria 6585
437 Ga0268266_10017862 3300028379 Bacteria 6044
438 Ga0268266_10481194 3300028379 Bacteria 1183
439 Ga0268265_10067091 3300028380 Bacteria 2776
440 Ga0268265_10250314 3300028380 Bacteria 1569
441 Ga0268264_10000086 3300028381 Bacteria 239021
442 Ga0265323_10011198 3300028653 Bacteria 3621
443 Ga0265336_10003829 3300028666 Bacteria 5797
444 Ga0265338_10048119 3300028800 Bacteria 3884
445 Ga0265338_10049885 3300028800 Bacteria 3788
446 Ga0265338_10086680 3300028800 Bacteria 2604
447 Ga0265762_1008867 3300030760 Bacteria 1791
448 Ga0265760_10000079 3300031090 Bacteria 24883
449 Ga0265760_10012942 3300031090 Bacteria 2389
450 Ga0265330_10000081 3300031235 Bacteria 80150
451 Ga0265330_10001812 3300031235 Bacteria 11985
452 Ga0265330_10035004 3300031235 Bacteria 2242
453 Ga0265332_10030276 3300031238 Bacteria 2364
454 Ga0265332_10085524 3300031238 Bacteria 1336
455 Ga0265328_10000875 3300031239 Bacteria 13924
456 Ga0265328_10004714 3300031239 Bacteria 5894
457 Ga0265320_10038279 3300031240 Bacteria 2407
458 Ga0265325_10000107 3300031241 Bacteria 58325
459 Ga0265329_10011286 3300031242 Bacteria 3249
460 Ga0265340_10000452 3300031247 Bacteria 22181
461 Ga0265340_10017622 3300031247 Bacteria 3694
462 Ga0265339_10000246 3300031249 Bacteria 43605
463 Ga0265339_10010564 3300031249 Bacteria 5730
464 Ga0265339_10022818 3300031249 Bacteria 3621
465 Ga0265316_10002225 3300031344 Bacteria 20351
466 Ga0265316_10004353 3300031344 Bacteria 14115
467 Ga0265316_10012460 3300031344 Bacteria 7623
468 Ga0265316_10012607 3300031344 Bacteria 7569
469 Ga0265316_10021668 3300031344 Bacteria 5437
470 Ga0307408_100189284 3300031548 Unclassified 1657
471 Ga0265313_10000769 3300031595 Bacteria 32597
472 Ga0316579_10009834 3300031691 Bacteria 4028
473 Ga0265314_10000052 3300031711 Bacteria 187634
474 Ga0265314_10007911 3300031711 Bacteria 9168
475 Ga0265314_10012845 3300031711 Bacteria 6803
476 Ga0265314_10101428 3300031711 Unclassified 1849
477 Ga0265342_10000771 3300031712 Bacteria 32633
478 Ga0265342_10009155 3300031712 Bacteria 7013
479 Ga0265342_10028533 3300031712 Bacteria 3475
480 Ga0265342_10071520 3300031712 Bacteria 2021
481 Ga0265342_10100123 3300031712 Bacteria 1652
482 Ga0307405_10088548 3300031731 Bacteria 2043
483 Ga0307409_100176955 3300031995 Bacteria 1884
484 Ga0307411_10635973 3300032005 Bacteria 922
485 Ga0373928_0038214 3300035084 Bacteria 1092
486 Ga0373940_0065485 3300035088 Unclassified 1048
487 Ga0373949_0031784 3300035090 Bacteria 1261
488 Ga0373923_0007143 3300035111 Bacteria 3911
489 Ga0373932_0015826 3300035112 Unclassified 1918
490 Ga0373936_0000583 3300035113 Bacteria 12587
491 Ga0373941_0023277 3300035115 Bacteria 1767
492 Ga0373945_0017712 3300035116 Bacteria 2415
493 Ga0373953_0006680 3300035117 Bacteria 3817
494 Ga0373943_0012677 3300035170 Bacteria 3799
495 Ga0373943_0161812 3300035170 Bacteria 1219
496 Ga0373946_0135287 3300035171 Bacteria 1138
497 Ga0373955_0084165 3300035172 Unclassified 1803
498 Ga0373955_0287665 3300035172 Bacteria 989
499 Ga0373931_0032815 3300035691 Bacteria 2688
500 Ga0373935_0000723 3300035692 Bacteria 17580
501 Ga0373935_0330068 3300035692 Eukaryota 1084
502 Ga0373927_0000297 3300035695 Bacteria 39222
503 Ga0373927_0084758 3300035695 Bacteria 2056
504 Ga0373933_0049156 3300035724 Bacteria 2513
505 Ga0373947_0000661 3300035725 Bacteria 20407
506 Ga0373947_0279155 3300035725 Bacteria 1110
507 Ga0373937_0155936 3300036401 Bacteria 2140
508 Ga0373937_0356283 3300036401 Unclassified 1386
509 Ga0373925_0008245 3300037068 Bacteria 7581
510 Ga0373925_0100285 3300037068 Bacteria 2225
511 Ga0395905_0460439 3300037471 Bacteria 1170
512 Ga0400484_23685 3300038725 Bacteria 3857
513 Ga0400484_44802 3300038725 Bacteria 5411
514 Ga0400483_122514 3300039062 Bacteria 1217
515 Ga0400483_177020 3300039062 Bacteria 2852
516 Ga0400483_186737 3300039062 Bacteria 2495
517 Ga0436365_0237225 3300039437 Bacteria 2829
518 Ga0436363_0980168 3300039450 Bacteria 1567
519 Ga0436362_0553429 3300039453 Bacteria 3786
520 Ga0466963_0001802 3300044694 Bacteria 11659
521 Ga0466967_0157742 3300045976 Bacteria 2127
522 Ga0495629_0013259 3300046459 Bacteria 5950
523 Ga0495638_0144032 3300046460 Bacteria 1388
524 Ga0495650_0004855 3300046471 Bacteria 8997
525 Ga0495580_0004509 3300046472 Bacteria 11696
526 Ga0495580_0004760 3300046472 Bacteria 11357
527 Ga0495580_0010953 3300046472 Bacteria 7034
528 Ga0495580_0048946 3300046472 Bacteria 2990
529 Ga0495580_0061849 3300046472 Unclassified 2628
530 Ga0495582_0028180 3300046473 Bacteria 3082
531 Ga0495582_0034381 3300046473 Bacteria 2786
532 Ga0495630_0051512 3300046517 Bacteria 3081
533 Ga0495586_0176839 3300046535 Bacteria 1207
534 Ga0495587_0188078 3300046536 Bacteria 1170
535 Ga0495645_0292958 3300046543 Bacteria 1066
536 Ga0495625_0002017 3300046660 Bacteria 22868
537 Ga0495625_0101511 3300046660 Bacteria 1976
538 Ga0495635_0069685 3300046663 Unclassified 2411
539 Ga0495661_0040092 3300046665 Bacteria 2907
540 Ga0495658_0004799 3300046683 Bacteria 6630
541 Ga0495674_0010175 3300047319 Bacteria 8911
542 Ga0495674_0314509 3300047319 Bacteria 1277
543 Ga0495672_0001406 3300047320 Bacteria 23700
544 Ga0495602_0147076 3300048088 Bacteria 1857
545 Ga0496100_0005846 3300048903 Bacteria 6658
546 Ga0496101_0005037 3300048904 Bacteria 8402
547 Ga0496102_0028622 3300048905 Bacteria 4978
548 Ga0496103_0011683 3300048906 Bacteria 5209
549 Ga0496104_0070396 3300048907 Bacteria 3325
550 Ga0496104_0124690 3300048907 Bacteria 2473
551 Ga0496104_0237614 3300048907 Bacteria 1734
552 Ga0496104_0425112 3300048907 Bacteria 1240
553 Ga0496104_0528159 3300048907 Bacteria 1091
554 Ga0496105_0108417 3300048908 Bacteria 2293
555 Ga0496105_0126663 3300048908 Bacteria 2105
556 Ga0496106_0035812 3300048909 Bacteria 3711
557 Ga0496106_0042918 3300048909 Bacteria 3392
558 Ga0496112_0004186 3300048915 Bacteria 12155
559 Ga0496112_0007016 3300048915 Bacteria 9949
560 Ga0496112_0108966 3300048915 Bacteria 2740
561 Ga0496112_0461270 3300048915 Bacteria 1208
562 Ga0496114_0067218 3300048917 Bacteria 3006
563 Ga0496115_0032065 3300048918 Bacteria 4144
564 Ga0496119_0266127 3300048922 Bacteria 858
565 Ga0496126_0000944 3300048929 Bacteria 49984
566 Ga0501034_0000468 3300049571 Bacteria 66573
567 Ga0501034_0017139 3300049571 Bacteria 7432
568 Ga0501068_0000246 3300049584 Bacteria 26620
569 Ga0501072_0001788 3300049588 Bacteria 16003
570 Ga0501073_0000741 3300049589 Bacteria 23102
571 Ga0501074_0036524 3300049590 Bacteria 3559
572 Ga0501075_0156485 3300049591 Bacteria 1738
573 Ga0501077_0051112 3300049593 Bacteria 2627
574 Ga0501080_0000523 3300049742 Bacteria 30182
575 Ga0501083_0050649 3300049744 Bacteria 2794
576 Ga0501044_0492709 3300049823 Bacteria 1127
577 nmdc:mga05p37_64797_c1 3300050507 Bacteria 4496
578 nmdc:mga09592_79066_c1 3300050508 Bacteria 2799
579 nmdc:mga0n895_127930_c1 3300050512 Bacteria 2564
580 nmdc:mga0n895_132052_c1 3300050512 Bacteria 2522
581 nmdc:mga0n895_75515_c1 3300050512 Bacteria 3350
582 nmdc:mga0rr50_250032_c1 3300050513 Bacteria 1472
583 nmdc:mga0rr50_292793_c1 3300050513 Bacteria 1360
584 nmdc:mga0rr50_422447_c1 3300050513 Bacteria 1128
585 nmdc:mga0rr50_81992_c1 3300050513 Bacteria 2490
586 nmdc:mga08x19_15050_c1 3300050514 Bacteria 4699
587 nmdc:mga08x19_8443_c1 3300050514 Bacteria 6136
588 nmdc:mga0a205_587975_c1 3300050515 Bacteria 967
589 nmdc:mga0a205_7432_c1 3300050515 Bacteria 9922
590 Ga0495601_0385579 3300053077 Bacteria 909
591 Ga0500595_008775 3300053119 Bacteria 4110
592 2884218572 2884215851 Bacteria 4554841
593 Ga0265760_10025473
594 Ga0065704_10004492
595 Ga0065707_10001423
596 Ga0070658_10227139
597 Ga0070676_10034851
598 Ga0070683_100000622
599 Ga0070683_100120825
600 Ga0070690_100032313
601 Ga0070670_100012898
602 Ga0068869_100000494
603 Ga0070666_10018231
604 Ga0070680_100060458
605 Ga0070682_100026667
606 Ga0070682_100303758
607 Ga0068868_100000004
608 Ga0068868_100012927
609 Ga0068868_100276841
610 Ga0070660_100002466
611 Ga0070660_100345916
612 Ga0070689_100115347
613 Ga0070687_100116493
614 Ga0070661_100000803
615 Ga0070661_100010136
616 Ga0070661_100056550
617 Ga0070668_100178163
618 Ga0070669_100117853
619 Ga0070675_100178843
620 Ga0070671_100076351
621 Ga0070673_100014401
622 Ga0070673_100324517
623 Ga0070659_100067076
624 Ga0070667_100001102
625 Ga0070667_100029634
626 Ga0070667_100278493
627 Ga0070709_10000874
628 Ga0070709_10051086
629 Ga0070709_10364950
630 Ga0070709_10477736
631 Ga0070714_100014970
632 Ga0070714_100025370
633 Ga0070714_100041425
634 Ga0070714_100047283
635 Ga0070713_100000452
636 Ga0070713_100001346
637 Ga0070713_100074806
638 Ga0070713_100211685
639 Ga0070710_10056282
640 Ga0070711_100102857
641 Ga0070705_100077071
642 Ga0070705_100297845
643 Ga0070708_100001677
644 Ga0070708_100001992
645 Ga0070708_100016384
646 Ga0070663_100064717
647 Ga0070663_100161338
648 Ga0070678_100101276
649 Ga0070662_100003506
650 Ga0070681_10001332
651 Ga0070681_10007066
652 Ga0070681_10202858
653 Ga0070681_10270720
654 Ga0070681_10339293
655 Ga0068867_100077001
656 Ga0068867_100122286
657 Ga0070706_100002528
658 Ga0070706_100007456
659 Ga0070706_100007932
660 Ga0070706_100012937
661 Ga0070706_100064333
662 Ga0070706_100327683
663 Ga0070707_100001967
664 Ga0070707_100046391
665 Ga0070698_100004850
666 Ga0070698_100159554
667 Ga0070698_100226458
668 Ga0070699_100001330
669 Ga0070679_100002431
670 Ga0070679_100033309
671 Ga0070679_100123200
672 Ga0070679_100162681
673 Ga0070679_100173148
674 Ga0070684_100002702
675 Ga0070684_100018365
676 Ga0070697_100004597
677 Ga0070697_100034586
678 Ga0068853_100000160
679 Ga0068853_100063817
680 Ga0068853_100176811
681 Ga0070686_100022716
682 Ga0070695_100135277
683 Ga0070696_100085704
684 Ga0070693_100051325
685 Ga0070693_100060563
686 Ga0070665_100005557
687 Ga0070665_100012491
688 Ga0070665_100102596
689 Ga0070704_100194719
690 Ga0068855_100004400
691 Ga0068855_100013111
692 Ga0068855_100032879
693 Ga0068855_100049109
694 Ga0068855_100089798
695 Ga0068855_100218482
696 Ga0070664_100009856
697 Ga0070664_100126570
698 Ga0070664_100224450
699 Ga0068857_100000700
700 Ga0068857_100015250
701 Ga0068857_100028774
702 Ga0068857_100195174
703 Ga0068854_100020488
704 Ga0068854_100020982
705 Ga0068856_100000911
706 Ga0068856_100079705
707 Ga0068856_100183429
708 Ga0068856_100192749
709 Ga0068856_100610630
710 Ga0070702_100550912
711 Ga0068852_100000128
712 Ga0068852_100000198
713 Ga0068852_100018806
714 Ga0068852_100046527
715 Ga0068852_100135436
716 Ga0068859_100016248
717 Ga0068859_100026751
718 Ga0068859_100053846
719 Ga0068859_100286607
720 Ga0068859_100492468
721 Ga0068864_100003135
722 Ga0068864_100038087
723 Ga0068864_100179493
724 Ga0068866_10068095
725 Ga0068861_100201557
726 Ga0068861_100259614
727 Ga0068851_10029327
728 Ga0068851_10042840
729 Ga0068863_100003497
730 Ga0068863_100033533
731 Ga0068858_100002015
732 Ga0068858_100057620
733 Ga0068858_100066372
734 Ga0068858_100400178
735 Ga0068860_100000069
736 Ga0068860_100057036
737 Ga0081540_1009176
738 Ga0070717_10005877
739 Ga0070717_10007299
740 Ga0070717_10033797
741 Ga0070717_10064002
742 Ga0070717_10120402
743 Ga0070717_10264781
744 Ga0070715_10019895
745 Ga0070716_100020821
746 Ga0070716_100044704
747 Ga0070716_100094695
748 Ga0070712_100000238
749 Ga0070712_100012076
750 Ga0070712_100100374
751 Ga0097621_100002569
752 Ga0097621_100025151
753 Ga0097621_100058359
754 Ga0097621_100084783
755 Ga0068871_100001097
756 Ga0068871_100007508
757 Ga0068871_100150359
758 Ga0068871_100167689
759 Ga0068871_100206351
760 Ga0075433_10005914
761 Ga0075433_10014707
762 Ga0075436_100000448
763 Ga0075436_100319081
764 Ga0097620_100016248
765 Ga0097620_100026749
766 Ga0097620_100053848
767 Ga0097620_100286587
768 Ga0097620_100492496
769 Ga0075435_100070256
770 Ga0075435_100281383
771 Ga0075435_100447384
772 Ga0105240_10000084
773 Ga0105240_10000683
774 Ga0105240_10001414
775 Ga0105240_10005376
776 Ga0105240_10007183
777 Ga0105240_10011981
778 Ga0105240_10016547
779 Ga0105240_10020172
780 Ga0105240_10099821
781 Ga0105240_10369801
782 Ga0105245_10002009
783 Ga0105245_10186632
784 Ga0105245_10279117
785 Ga0105245_10352110
786 Ga0105247_10000429
787 Ga0105247_10015672
788 Ga0105247_10095844
789 Ga0114129_10471001
790 Ga0105243_10116441
791 Ga0105241_10000126
792 Ga0105241_10000246
793 Ga0105241_10001726
794 Ga0105241_10005467
795 Ga0105241_10011195
796 Ga0105241_10027117
797 Ga0105241_10084540
798 Ga0105242_10060334
799 Ga0105242_10383763
800 Ga0105248_10141244
801 Ga0105248_10171375
802 Ga0105248_10233635
803 Ga0105237_10000600
804 Ga0105237_10002410
805 Ga0105237_10014754
806 Ga0105237_10025015
807 Ga0105238_10000160
808 Ga0105238_10000333
809 Ga0105238_10000669
810 Ga0105238_10004744
811 Ga0105238_10009141
812 Ga0105238_10316774
813 Ga0105249_10031589
814 Ga0105249_10044421
815 Ga0099796_10017934
816 Ga0099796_10081216
817 Ga0105239_10005862
818 Ga0105239_10013521
819 Ga0105239_10360898
820 Ga0105246_10000367
821 Ga0105246_10022046
822 Ga0157371_10037357
823 Ga0157371_10056139
824 Ga0157370_10000733
825 Ga0157370_10010701
826 Ga0157370_10137567
827 Ga0157370_10174415
828 Ga0157369_10000777
829 Ga0157369_10006928
830 Ga0157369_10009806
831 Ga0157369_10042622
832 Ga0157369_10218751
833 Ga0157369_10312954
834 Ga0157374_10000612
835 Ga0157374_10003225
836 Ga0157374_10003603
837 Ga0157374_10031528
838 Ga0157374_10097442
839 Ga0157378_10000594
840 Ga0157378_10085157
841 Ga0157378_10300708
842 Ga0157378_10832454
843 Ga0163162_10006695
844 Ga0163162_10116679
845 Ga0163162_10685832
846 Ga0163162_11005893
847 Ga0157372_10000551
848 Ga0157372_10001342
849 Ga0157372_10018390
850 Ga0157372_10018623
851 Ga0157372_10025450
852 Ga0157372_10046400
853 Ga0157372_10068048
854 Ga0157372_10227379
855 Ga0157372_10352777
856 Ga0157372_10398394
857 Ga0157375_10014485
858 Ga0157375_10074193
859 Ga0163163_10008686
860 Ga0163163_10008874
861 Ga0163163_10033320
862 Ga0163163_10213274
863 Ga0163163_10596507
864 Ga0182008_10206038
865 Ga0157379_10000285
866 Ga0157379_10033927
867 Ga0157379_10140252
868 Ga0157379_10179979
869 Ga0157376_10000340
870 Ga0157376_10100424
871 Ga0157376_10169399
872 Ga0157376_10297910
873 Ga0157376_10829871
874 Ga0163161_10035523
875 Ga0213876_10040878
876 Ga0224571_100182
877 Ga0228598_1002144
878 Ga0207642_10039299
879 Ga0207710_10000516
880 Ga0207680_10094055
881 Ga0207647_10075764
882 Ga0207647_10102407
883 Ga0207685_10002469
884 Ga0207685_10078039
885 Ga0207699_10003658
886 Ga0207699_10054750
887 Ga0207699_10431068
888 Ga0207645_10005173
889 Ga0207643_10200460
890 Ga0207705_10093639
891 Ga0207705_10187720
892 Ga0207684_10000343
893 Ga0207684_10114336
894 Ga0207684_10140106
895 Ga0207684_10272704
896 Ga0207654_10000079
897 Ga0207654_10000122
898 Ga0207654_10000144
899 Ga0207654_10000981
900 Ga0207654_10025534
901 Ga0207654_10037740
902 Ga0207654_10129570
903 Ga0207707_10003765
904 Ga0207707_10019296
905 Ga0207707_10130590
906 Ga0207695_10000052
907 Ga0207695_10000145
908 Ga0207695_10000306
909 Ga0207695_10000380
910 Ga0207695_10002205
911 Ga0207695_10003111
912 Ga0207695_10004211
913 Ga0207695_10101153
914 Ga0207695_10103376
915 Ga0207695_10185139
916 Ga0207695_10361823
917 Ga0207671_10000076
918 Ga0207671_10000541
919 Ga0207671_10218869
920 Ga0207693_10000182
921 Ga0207693_10044220
922 Ga0207660_10119563
923 Ga0207662_10073545
924 Ga0207657_10001194
925 Ga0207657_10052147
926 Ga0207657_10272925
927 Ga0207649_10002069
928 Ga0207649_10008442
929 Ga0207649_10063301
930 Ga0207649_10322559
931 Ga0207652_10024533
932 Ga0207652_10063031
933 Ga0207652_10119711
934 Ga0207652_10191685
935 Ga0207652_10249893
936 Ga0207652_10594716
937 Ga0207646_10010660
938 Ga0207646_10173772
939 Ga0207646_10298857
940 Ga0207681_10125584
941 Ga0207694_10000029
942 Ga0207694_10000141
943 Ga0207694_10012950
944 Ga0207694_10035940
945 Ga0207694_10098553
946 Ga0207659_10330641
947 Ga0207687_10001340
948 Ga0207687_10028719
949 Ga0207700_10000217
950 Ga0207700_10003969
951 Ga0207700_10531970
952 Ga0207664_10031008
953 Ga0207664_10080485
954 Ga0207664_10108914
955 Ga0207664_10201599
956 Ga0207644_10002743
957 Ga0207706_10002665
958 Ga0207686_10267479
959 Ga0207686_10428743
960 Ga0207704_10134947
961 Ga0207665_10046207
962 Ga0207665_10052272
963 Ga0207665_10076007
964 Ga0207691_10006913
965 Ga0207711_10000016
966 Ga0207711_10004269
967 Ga0207711_10011774
968 Ga0207711_10056297
969 Ga0207711_10087703
970 Ga0207689_10001059
971 Ga0207689_10016786
972 Ga0207689_10046126
973 Ga0207661_10000489
974 Ga0207661_10100567
975 Ga0207661_10115987
976 Ga0207661_10153645
977 Ga0207679_10079448
978 Ga0207667_10001853
979 Ga0207667_10007242
980 Ga0207667_10010076
981 Ga0207667_10011700
982 Ga0207667_10014152
983 Ga0207651_10008108
984 Ga0207651_10079764
985 Ga0207712_10006249
986 Ga0207712_10704160
987 Ga0207668_10010161
988 Ga0207640_10005960
989 Ga0207640_10037253
990 Ga0207640_10057215
991 Ga0207658_10003304
992 Ga0207658_10188495
993 Ga0207677_10000023
994 Ga0207677_10009566
995 Ga0207703_10004334
996 Ga0207703_10262393
997 Ga0207703_10321038
998 Ga0207639_10000050
999 Ga0207639_10108085
1000 Ga0207639_10138248
1001 Ga0207678_10015533
1002 Ga0207702_10000643
1003 Ga0207702_10001243
1004 Ga0207702_10020068
1005 Ga0207702_10245105
1006 Ga0207702_10398293
1007 Ga0207702_10923078
1008 Ga0207641_10023893
1009 Ga0207648_10017005
1010 Ga0207676_10001284
1011 Ga0207676_10045586
1012 Ga0207674_10001505
1013 Ga0207674_10002586
1014 Ga0207674_10093917
1015 Ga0207674_10127267
1016 Ga0207674_10450642
1017 Ga0207675_100032766
1018 Ga0207675_100069306
1019 Ga0207683_10001215
1020 Ga0207698_10000034
1021 Ga0207698_10000743
1022 Ga0207698_10013081
1023 Ga0207698_10096371
1024 Ga0207698_10107102
1025 Ga0207698_10187685
1026 Ga0207698_10459358
1027 Ga0265354_1003886
1028 Ga0268266_10015296
1029 Ga0268266_10017862
1030 Ga0268266_10481194
1031 Ga0268265_10067091
1032 Ga0268265_10250314
1033 Ga0268264_10000086
1034 Ga0265323_10011198
1035 Ga0265336_10003829
1036 Ga0265338_10048119
1037 Ga0265338_10049885
1038 Ga0265338_10086680
1039 Ga0265762_1008867
1040 Ga0265760_10000079
1041 Ga0265760_10012942
1042 Ga0265330_10000081
1043 Ga0265330_10001812
1044 Ga0265330_10035004
1045 Ga0265332_10030276
1046 Ga0265332_10085524
1047 Ga0265328_10000875
1048 Ga0265328_10004714
1049 Ga0265320_10038279
1050 Ga0265325_10000107
1051 Ga0265329_10011286
1052 Ga0265340_10000452
1053 Ga0265340_10017622
1054 Ga0265339_10000246
1055 Ga0265339_10010564
1056 Ga0265339_10022818
1057 Ga0265316_10002225
1058 Ga0265316_10004353
1059 Ga0265316_10012460
1060 Ga0265316_10012607
1061 Ga0265316_10021668
1062 Ga0307408_100189284
1063 Ga0265313_10000769
1064 Ga0316579_10009834
1065 Ga0265314_10000052
1066 Ga0265314_10007911
1067 Ga0265314_10012845
1068 Ga0265314_10101428
1069 Ga0265342_10000771
1070 Ga0265342_10009155
1071 Ga0265342_10028533
1072 Ga0265342_10071520
1073 Ga0265342_10100123
1074 Ga0307405_10088548
1075 Ga0307409_100176955
1076 Ga0307411_10635973
1077 Ga0373928_0038214
1078 Ga0373940_0065485
1079 Ga0373949_0031784
1080 Ga0373923_0007143
1081 Ga0373932_0015826
1082 Ga0373936_0000583
1083 Ga0373941_0023277
1084 Ga0373945_0017712
1085 Ga0373953_0006680
1086 Ga0373943_0012677
1087 Ga0373943_0161812
1088 Ga0373946_0135287
1089 Ga0373955_0084165
1090 Ga0373955_0287665
1091 Ga0373931_0032815
1092 Ga0373935_0000723
1093 Ga0373935_0330068
1094 Ga0373927_0000297
1095 Ga0373927_0084758
1096 Ga0373933_0049156
1097 Ga0373947_0000661
1098 Ga0373947_0279155
1099 Ga0373937_0155936
1100 Ga0373937_0356283
1101 Ga0373925_0008245
1102 Ga0373925_0100285
1103 Ga0395905_0460439
1104 Ga0400484_23685
1105 Ga0400484_44802
1106 Ga0400483_122514
1107 Ga0400483_177020
1108 Ga0400483_186737
1109 Ga0436365_0237225
1110 Ga0436363_0980168
1111 Ga0436362_0553429
1112 Ga0466963_0001802
1113 Ga0466967_0157742
1114 Ga0495629_0013259
1115 Ga0495638_0144032
1116 Ga0495650_0004855
1117 Ga0495580_0004509
1118 Ga0495580_0004760
1119 Ga0495580_0010953
1120 Ga0495580_0048946
1121 Ga0495580_0061849
1122 Ga0495582_0028180
1123 Ga0495582_0034381
1124 Ga0495630_0051512
1125 Ga0495586_0176839
1126 Ga0495587_0188078
1127 Ga0495645_0292958
1128 Ga0495625_0002017
1129 Ga0495625_0101511
1130 Ga0495635_0069685
1131 Ga0495661_0040092
1132 Ga0495658_0004799
1133 Ga0495674_0010175
1134 Ga0495674_0314509
1135 Ga0495672_0001406
1136 Ga0495602_0147076
1137 Ga0496100_0005846
1138 Ga0496101_0005037
1139 Ga0496102_0028622
1140 Ga0496103_0011683
1141 Ga0496104_0070396
1142 Ga0496104_0124690
1143 Ga0496104_0237614
1144 Ga0496104_0425112
1145 Ga0496104_0528159
1146 Ga0496105_0108417
1147 Ga0496105_0126663
1148 Ga0496106_0035812
1149 Ga0496106_0042918
1150 Ga0496112_0004186
1151 Ga0496112_0007016
1152 Ga0496112_0108966
1153 Ga0496112_0461270
1154 Ga0496114_0067218
1155 Ga0496115_0032065
1156 Ga0496119_0266127
1157 Ga0496126_0000944
1158 Ga0501034_0000468
1159 Ga0501034_0017139
1160 Ga0501068_0000246
1161 Ga0501072_0001788
1162 Ga0501073_0000741
1163 Ga0501074_0036524
1164 Ga0501075_0156485
1165 Ga0501077_0051112
1166 Ga0501080_0000523
1167 Ga0501083_0050649
1168 Ga0501044_0492709
1169 nmdc:mga05p37_64797_c1
1170 nmdc:mga09592_79066_c1
1171 nmdc:mga0n895_127930_c1
1172 nmdc:mga0n895_132052_c1
1173 nmdc:mga0n895_75515_c1
1174 nmdc:mga0rr50_250032_c1
1175 nmdc:mga0rr50_292793_c1
1176 nmdc:mga0rr50_422447_c1
1177 nmdc:mga0rr50_81992_c1
1178 nmdc:mga08x19_15050_c1
1179 nmdc:mga08x19_8443_c1
1180 nmdc:mga0a205_587975_c1
1181 nmdc:mga0a205_7432_c1
1182 Ga0495601_0385579
1183 Ga0500595_008775
1184 2884218572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00290

Trp_syntA

Tryptophan synthase alpha chain

38

291

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ey5-assembly1.cif.gz_C lbcats 0.9415 3 256
5ey5-assembly1.cif.gz_C lbcats 0.9341 3 256
5e0k-assembly3.cif.gz_K x-ray crystal structure of tryptophan synthase complex from pyrococcus furiosus at 2.76 a 0.9294 18 255
5ey5-assembly1.cif.gz_A lbcats 0.929 1 255
1wdw-assembly3.cif.gz_K structural basis of mutual activation of the tryptophan synthase a2b2 complex from a hyperthermophile, pyrococcus furiosus 0.9281 18 255
ID Description Score Start End Superfamily
af_B4F800_73_338_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9466 4 255 3.20.20.70
af_A0A1D8PMH6_3_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9452 3 255 3.20.20.70
af_A0A1D8PMH6_3_266_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9309 3 255 3.20.20.70
5ey5A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.929 1 255 3.20.20.70
af_B4F800_73_338_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9287 4 255 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A352F538-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9848 1 256 GO:0004834
GO:0005829
GO:0006568
AF-A0A352F538-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.981 1 256 GO:0004834
GO:0005829
GO:0006568
AF-A0A538NHQ3-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9802 1 255 GO:0004834
GO:0005829
GO:0006568
AF-A0A3N5P7U5-F1-model_v4 tryptophan synthase (EC 4.2.1.20) 0.9785 2 255 GO:0004834
GO:0005829
GO:0006568
AF-A0A2V5M5S6-F1-model_v4 Tryptophan synthase alpha chain (EC 4.2.1.20) 0.9777 37 256 GO:0004834
GO:0005829
GO:0006568

Map