F466984

General Info

Members Datasets Scaffolds Average Seq Length
590 284 1180 205

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_0080381|Ga0436365_0080381_240_923
Length 227
Sequence VNLDAIAGVAHEPAATPVGVVVVTHGAGGSRESPLLRQVCDEWARRGWLAVRYNLPYRRRRPTGPPSGSAATDRAGIAAAVELAHAISDGPVIAGGHSYGGRQTSMAASDKDIAIDVLTLFSYPVHPPGKPENPRTGHLPRITVPTVFTHGTSDPFGTIEEVRAAAALISAPSDVVEIAGARHDLGSKTLDVPALAADAALKLLGPRRVGAVGAPRSAPRPTPGTAQ

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
176 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
180 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
181 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
182 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
183 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
205 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
234 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
235 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
248 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
259 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
260 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
267 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
268 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
269 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
270 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
271 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
272 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
277 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
278 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
279 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
280 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
281 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
282 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
283 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
284 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.47
Metatranscriptomes 0
Isolates 1.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.24
Nodule 0.17
Rhizoplane 8.31
Rhizosphere 70.85
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_0080381 3300039437 Bacteria 1166
2 JGI24744J21845_10000220 3300002077 Bacteria 9036
3 Ga0055540_1001503 3300003792 Bacteria 13855
4 Ga0055540_1009141 3300003792 Bacteria 3466
5 Ga0070683_100100264 3300005329 Bacteria 2726
6 Ga0070683_100119231 3300005329 Bacteria 2492
7 Ga0070690_100009299 3300005330 Bacteria 5690
8 Ga0070670_100084798 3300005331 Bacteria 2722
9 Ga0068869_100009588 3300005334 Bacteria 6289
10 Ga0068869_100444302 3300005334 Bacteria 1074
11 Ga0070666_10166603 3300005335 Bacteria 1542
12 Ga0070680_100658567 3300005336 Bacteria 900
13 Ga0068868_100000603 3300005338 Bacteria 24143
14 Ga0068868_100480743 3300005338 Bacteria 1085
15 Ga0070660_100210351 3300005339 Bacteria 1579
16 Ga0070689_100040907 3300005340 Bacteria 3555
17 Ga0070689_100129395 3300005340 Bacteria 2023
18 Ga0070691_10000356 3300005341 Bacteria 16406
19 Ga0070691_10087723 3300005341 Bacteria 1530
20 Ga0070692_10040308 3300005345 Bacteria 2388
21 Ga0070668_100001911 3300005347 Bacteria 15238
22 Ga0070668_100006512 3300005347 Bacteria 8658
23 Ga0070668_100023651 3300005347 Bacteria 4649
24 Ga0070668_100078493 3300005347 Bacteria 2582
25 Ga0070668_100405566 3300005347 Bacteria 1165
26 Ga0070669_100007934 3300005353 Bacteria 7587
27 Ga0070669_100012933 3300005353 Bacteria 5928
28 Ga0070669_100046432 3300005353 Bacteria 3167
29 Ga0070675_100118574 3300005354 Bacteria 2247
30 Ga0070675_100498329 3300005354 Bacteria 1097
31 Ga0070671_100054164 3300005355 Bacteria 3335
32 Ga0070671_100132340 3300005355 Bacteria 2101
33 Ga0070671_100331055 3300005355 Bacteria 1298
34 Ga0070674_100000346 3300005356 Bacteria 23035
35 Ga0070674_100185710 3300005356 Bacteria 1595
36 Ga0070688_100052169 3300005365 Bacteria 2554
37 Ga0070688_100109145 3300005365 Bacteria 1837
38 Ga0070659_100092684 3300005366 Bacteria 2423
39 Ga0070667_100000029 3300005367 Bacteria 178990
40 Ga0070667_100001704 3300005367 Bacteria 19669
41 Ga0070667_100015134 3300005367 Bacteria 6371
42 Ga0070667_100331092 3300005367 Bacteria 1376
43 Ga0070667_100403286 3300005367 Bacteria 1245
44 Ga0070714_100290714 3300005435 Bacteria 1521
45 Ga0070714_100672738 3300005435 Bacteria 997
46 Ga0070713_100120764 3300005436 Bacteria 2298
47 Ga0070713_100964554 3300005436 Bacteria 822
48 Ga0070710_10006025 3300005437 Bacteria 5792
49 Ga0070710_10420345 3300005437 Bacteria 900
50 Ga0070701_10000569 3300005438 Bacteria 12839
51 Ga0070711_100000224 3300005439 Bacteria 29975
52 Ga0070711_100056338 3300005439 Bacteria 2718
53 Ga0070705_100093688 3300005440 Bacteria 1878
54 Ga0070700_100000375 3300005441 Bacteria 22955
55 Ga0070700_100031608 3300005441 Bacteria 3173
56 Ga0070700_100752910 3300005441 Bacteria 780
57 Ga0070694_100019812 3300005444 Bacteria 4282
58 Ga0070663_100010126 3300005455 Bacteria 5866
59 Ga0070663_100151242 3300005455 Bacteria 1780
60 Ga0070678_100000144 3300005456 Bacteria 29367
61 Ga0070678_100366763 3300005456 Bacteria 1242
62 Ga0070678_100982310 3300005456 Bacteria 775
63 Ga0070662_100029472 3300005457 Bacteria 3830
64 Ga0070662_100096363 3300005457 Bacteria 2231
65 Ga0068867_100053402 3300005459 Bacteria 2984
66 Ga0068867_100071214 3300005459 Bacteria 2601
67 Ga0068867_100601144 3300005459 Bacteria 959
68 Ga0070685_10018472 3300005466 Bacteria 3749
69 Ga0068853_100140150 3300005539 Bacteria 2170
70 Ga0068853_101144045 3300005539 Bacteria 751
71 Ga0070672_100020884 3300005543 Bacteria 4784
72 Ga0070672_100111108 3300005543 Bacteria 2234
73 Ga0070686_100098571 3300005544 Bacteria 1970
74 Ga0070686_100669370 3300005544 Bacteria 825
75 Ga0070695_100002556 3300005545 Bacteria 10508
76 Ga0070695_100050784 3300005545 Bacteria 2659
77 Ga0070696_100000635 3300005546 Bacteria 22384
78 Ga0070696_100247143 3300005546 Bacteria 1348
79 Ga0070696_100633239 3300005546 Bacteria 865
80 Ga0070693_100004031 3300005547 Bacteria 6907
81 Ga0070693_100273490 3300005547 Bacteria 1128
82 Ga0070665_100001364 3300005548 Bacteria 28758
83 Ga0070665_100004989 3300005548 Bacteria 13765
84 Ga0070665_100007740 3300005548 Bacteria 10907
85 Ga0070665_100222779 3300005548 Bacteria 1886
86 Ga0070704_100000339 3300005549 Bacteria 21261
87 Ga0070704_100158938 3300005549 Bacteria 1785
88 Ga0068854_100000756 3300005578 Bacteria 19158
89 Ga0068854_100029987 3300005578 Bacteria 3770
90 Ga0068856_100026078 3300005614 Bacteria 5699
91 Ga0070702_100020346 3300005615 Bacteria 3475
92 Ga0070702_100089925 3300005615 Bacteria 1860
93 Ga0068852_100017360 3300005616 Bacteria 5645
94 Ga0068852_100105822 3300005616 Bacteria 2549
95 Ga0068859_100000342 3300005617 Bacteria 46429
96 Ga0068859_100001989 3300005617 Bacteria 20861
97 Ga0068859_100627484 3300005617 Bacteria 1167
98 Ga0068864_100253443 3300005618 Bacteria 1635
99 Ga0068866_10001049 3300005718 Bacteria 12174
100 Ga0068861_100003302 3300005719 Bacteria 10674
101 Ga0068861_100483554 3300005719 Bacteria 1116
102 Ga0068861_100589508 3300005719 Bacteria 1019
103 Ga0068851_10077099 3300005834 Bacteria 1735
104 Ga0068870_10275170 3300005840 Bacteria 1053
105 Ga0068863_100188536 3300005841 Bacteria 1981
106 Ga0068863_100911961 3300005841 Bacteria 879
107 Ga0068858_100005245 3300005842 Bacteria 12696
108 Ga0068858_100030973 3300005842 Bacteria 4968
109 Ga0068858_100080776 3300005842 Bacteria 3022
110 Ga0068860_100000088 3300005843 Bacteria 154416
111 Ga0068860_100000761 3300005843 Bacteria 36314
112 Ga0068860_100416998 3300005843 Bacteria 1330
113 Ga0068862_100000056 3300005844 Bacteria 142257
114 Ga0068862_100010605 3300005844 Bacteria 7617
115 Ga0068862_100364245 3300005844 Bacteria 1344
116 Ga0081455_10012020 3300005937 Bacteria 8662
117 Ga0075365_10002241 3300006038 Bacteria 9357
118 Ga0075365_10057363 3300006038 Bacteria 2590
119 Ga0075365_10242080 3300006038 Bacteria 1267
120 Ga0075365_10326329 3300006038 Bacteria 1081
121 Ga0075368_10048220 3300006042 Bacteria 1688
122 Ga0075363_100001458 3300006048 Bacteria 8977
123 Ga0075363_100005218 3300006048 Bacteria 5754
124 Ga0075363_100011812 3300006048 Bacteria 4192
125 Ga0075363_100016737 3300006048 Bacteria 3626
126 Ga0075363_100120515 3300006048 Bacteria 1465
127 Ga0075363_100211428 3300006048 Bacteria 1110
128 Ga0075363_100220202 3300006048 Bacteria 1088
129 Ga0075363_100228162 3300006048 Bacteria 1069
130 Ga0075364_10003364 3300006051 Bacteria 9076
131 Ga0075364_10003804 3300006051 Bacteria 8634
132 Ga0075364_10013987 3300006051 Bacteria 4946
133 Ga0075364_10014085 3300006051 Bacteria 4934
134 Ga0075364_10014738 3300006051 Bacteria 4835
135 Ga0075364_10035467 3300006051 Bacteria 3223
136 Ga0075364_10061162 3300006051 Bacteria 2470
137 Ga0075364_10250548 3300006051 Bacteria 1203
138 Ga0075364_10553798 3300006051 Bacteria 786
139 Ga0070715_10013021 3300006163 Bacteria 3045
140 Ga0070715_10040867 3300006163 Bacteria 1941
141 Ga0070716_100003576 3300006173 Bacteria 7339
142 Ga0070716_100007637 3300006173 Bacteria 5333
143 Ga0070716_100530403 3300006173 Bacteria 874
144 Ga0070712_100001750 3300006175 Bacteria 13280
145 Ga0070712_100006407 3300006175 Bacteria 7299
146 Ga0075362_10032340 3300006177 Bacteria 2269
147 Ga0075362_10070232 3300006177 Bacteria 1598
148 Ga0075362_10079004 3300006177 Bacteria 1514
149 Ga0075367_10004461 3300006178 Bacteria 6839
150 Ga0075369_10005134 3300006186 Bacteria 4877
151 Ga0075369_10028138 3300006186 Bacteria 2354
152 Ga0075369_10046158 3300006186 Bacteria 1875
153 Ga0075369_10052549 3300006186 Bacteria 1766
154 Ga0075369_10136784 3300006186 Bacteria 1116
155 Ga0075369_10159349 3300006186 Bacteria 1034
156 Ga0097621_100102649 3300006237 Bacteria 2408
157 Ga0097621_100115592 3300006237 Bacteria 2271
158 Ga0075370_10003179 3300006353 Bacteria 7772
159 Ga0075370_10005393 3300006353 Bacteria 6351
160 Ga0075370_10013185 3300006353 Bacteria 4387
161 Ga0075370_10114748 3300006353 Bacteria 1565
162 Ga0075370_10155316 3300006353 Bacteria 1342
163 Ga0068871_100228868 3300006358 Bacteria 1613
164 Ga0075430_100030487 3300006846 Bacteria 4582
165 Ga0068865_100001967 3300006881 Bacteria 12125
166 Ga0068865_100042864 3300006881 Bacteria 3088
167 Ga0068865_100127782 3300006881 Bacteria 1900
168 Ga0097620_100000342 3300006931 Bacteria 46429
169 Ga0097620_100001989 3300006931 Bacteria 20861
170 Ga0097620_100627474 3300006931 Bacteria 1167
171 Ga0099795_10036395 3300007788 Bacteria 1727
172 Ga0105250_10073305 3300009092 Bacteria 1384
173 Ga0105245_10001652 3300009098 Bacteria 20297
174 Ga0105245_10302264 3300009098 Bacteria 1570
175 Ga0105247_10000008 3300009101 Bacteria 391450
176 Ga0105247_10000627 3300009101 Bacteria 28286
177 Ga0105247_10105621 3300009101 Bacteria 1806
178 Ga0114129_10014386 3300009147 Bacteria 11277
179 Ga0105243_10001311 3300009148 Bacteria 22220
180 Ga0105241_10037642 3300009174 Bacteria 3645
181 Ga0105242_10003824 3300009176 Bacteria 11706
182 Ga0105242_10252869 3300009176 Bacteria 1589
183 Ga0105248_10000051 3300009177 Bacteria 150288
184 Ga0105248_10002866 3300009177 Bacteria 19141
185 Ga0105248_10054160 3300009177 Bacteria 4499
186 Ga0105248_10139317 3300009177 Bacteria 2737
187 Ga0105237_10307873 3300009545 Bacteria 1587
188 Ga0105249_10000040 3300009553 Bacteria 196153
189 Ga0105249_10010999 3300009553 Bacteria 7950
190 Ga0105249_10110565 3300009553 Bacteria 2597
191 Ga0105249_10196455 3300009553 Bacteria 1972
192 Ga0099796_10025414 3300010159 Bacteria 1870
193 Ga0105239_10004210 3300010375 Bacteria 17279
194 Ga0105239_10068961 3300010375 Bacteria 3886
195 Ga0105239_10343875 3300010375 Bacteria 1684
196 Ga0157374_10007432 3300013296 Bacteria 9343
197 Ga0157378_10008169 3300013297 Bacteria 9132
198 Ga0157378_10506619 3300013297 Bacteria 1207
199 Ga0163162_10007715 3300013306 Bacteria 10483
200 Ga0163162_10020350 3300013306 Bacteria 6518
201 Ga0163162_10272243 3300013306 Bacteria 1825
202 Ga0163162_10318576 3300013306 Bacteria 1688
203 Ga0157372_10015804 3300013307 Bacteria 8097
204 Ga0157372_10585202 3300013307 Bacteria 1301
205 Ga0157375_10004381 3300013308 Bacteria 12259
206 Ga0157375_10452105 3300013308 Bacteria 1450
207 Ga0163163_10014923 3300014325 Bacteria 7158
208 Ga0157380_10000214 3300014326 Bacteria 34343
209 Ga0157380_10192226 3300014326 Bacteria 1803
210 Ga0182008_10095533 3300014497 Bacteria 1467
211 Ga0157379_10082179 3300014968 Bacteria 2887
212 Ga0157379_10320156 3300014968 Bacteria 1416
213 Ga0157376_10183712 3300014969 Bacteria 1913
214 Ga0157376_10270982 3300014969 Bacteria 1595
215 Ga0163161_10001940 3300017792 Bacteria 15077
216 Ga0163161_10030873 3300017792 Bacteria 3815
217 Ga0213874_10091830 3300021377 Bacteria 998
218 Ga0213876_10002474 3300021384 Bacteria 10843
219 Ga0213876_10178981 3300021384 Bacteria 1128
220 Ga0213875_10051272 3300021388 Bacteria 1933
221 Ga0213875_10056612 3300021388 Bacteria 1837
222 Ga0209051_1000401 3300025303 Bacteria 60172
223 Ga0209051_1001662 3300025303 Bacteria 17953
224 Ga0209051_1026733 3300025303 Bacteria 2318
225 Ga0209051_1053986 3300025303 Bacteria 1315
226 Ga0209051_1098594 3300025303 Bacteria 792
227 Ga0207692_10199538 3300025898 Bacteria 1175
228 Ga0207642_10001391 3300025899 Bacteria 7502
229 Ga0207710_10000006 3300025900 Bacteria 538831
230 Ga0207710_10000373 3300025900 Bacteria 31099
231 Ga0207710_10039590 3300025900 Bacteria 2087
232 Ga0207688_10000253 3300025901 Bacteria 24125
233 Ga0207688_10020799 3300025901 Bacteria 3582
234 Ga0207680_10178554 3300025903 Bacteria 1434
235 Ga0207680_10210274 3300025903 Bacteria 1330
236 Ga0207685_10002309 3300025905 Bacteria 4336
237 Ga0207685_10054976 3300025905 Bacteria 1552
238 Ga0207699_10006814 3300025906 Bacteria 5558
239 Ga0207645_10095526 3300025907 Bacteria 1914
240 Ga0207654_10207260 3300025911 Bacteria 1294
241 Ga0207671_10202290 3300025914 Bacteria 1551
242 Ga0207671_10326617 3300025914 Bacteria 1214
243 Ga0207693_10000498 3300025915 Bacteria 35481
244 Ga0207693_10020894 3300025915 Bacteria 5204
245 Ga0207663_10001093 3300025916 Bacteria 12458
246 Ga0207663_10015804 3300025916 Bacteria 4172
247 Ga0207660_10207846 3300025917 Bacteria 1532
248 Ga0207660_10494625 3300025917 Bacteria 992
249 Ga0207662_10149267 3300025918 Bacteria 1486
250 Ga0207662_10259640 3300025918 Bacteria 1143
251 Ga0207681_10001108 3300025923 Bacteria 17456
252 Ga0207681_10044399 3300025923 Bacteria 2978
253 Ga0207650_10070820 3300025925 Bacteria 2622
254 Ga0207659_10013693 3300025926 Bacteria 5206
255 Ga0207659_10426578 3300025926 Bacteria 1113
256 Ga0207687_10001262 3300025927 Bacteria 17295
257 Ga0207687_10027587 3300025927 Bacteria 3812
258 Ga0207700_10824647 3300025928 Bacteria 830
259 Ga0207664_10079287 3300025929 Bacteria 2665
260 Ga0207664_10472128 3300025929 Bacteria 1121
261 Ga0207644_10046908 3300025931 Bacteria 3080
262 Ga0207644_10245754 3300025931 Bacteria 1426
263 Ga0207644_10490534 3300025931 Bacteria 1012
264 Ga0207690_10016607 3300025932 Bacteria 4483
265 Ga0207706_10010581 3300025933 Bacteria 8425
266 Ga0207706_10080897 3300025933 Bacteria 2856
267 Ga0207686_10040139 3300025934 Bacteria 2844
268 Ga0207709_10001287 3300025935 Bacteria 17895
269 Ga0207670_10002917 3300025936 Bacteria 9038
270 Ga0207670_10095120 3300025936 Bacteria 2115
271 Ga0207669_10000304 3300025937 Bacteria 22560
272 Ga0207669_10019642 3300025937 Bacteria 3524
273 Ga0207669_10257801 3300025937 Bacteria 1302
274 Ga0207669_10385107 3300025937 Bacteria 1094
275 Ga0207704_10000284 3300025938 Bacteria 24146
276 Ga0207704_10247544 3300025938 Bacteria 1336
277 Ga0207665_10006139 3300025939 Bacteria 7977
278 Ga0207665_10010628 3300025939 Bacteria 6047
279 Ga0207665_10463029 3300025939 Bacteria 975
280 Ga0207691_10034924 3300025940 Bacteria 4671
281 Ga0207711_10000811 3300025941 Bacteria 30675
282 Ga0207711_10023935 3300025941 Bacteria 5111
283 Ga0207711_10052549 3300025941 Bacteria 3492
284 Ga0207689_10018457 3300025942 Bacteria 5886
285 Ga0207689_10050697 3300025942 Bacteria 3421
286 Ga0207661_10044125 3300025944 Bacteria 3522
287 Ga0207661_10210156 3300025944 Bacteria 1715
288 Ga0207712_10000017 3300025961 Bacteria 337943
289 Ga0207712_10145384 3300025961 Bacteria 1825
290 Ga0207668_10000470 3300025972 Bacteria 25320
291 Ga0207668_10001040 3300025972 Bacteria 16577
292 Ga0207668_10329139 3300025972 Bacteria 1270
293 Ga0207640_10003489 3300025981 Bacteria 8470
294 Ga0207640_10212382 3300025981 Bacteria 1475
295 Ga0207658_10000016 3300025986 Bacteria 215618
296 Ga0207658_10002132 3300025986 Bacteria 14703
297 Ga0207658_10007143 3300025986 Bacteria 7608
298 Ga0207658_10161414 3300025986 Bacteria 1837
299 Ga0207658_10282237 3300025986 Bacteria 1424
300 Ga0207677_10001233 3300026023 Bacteria 13788
301 Ga0207677_10163490 3300026023 Bacteria 1732
302 Ga0207677_10189384 3300026023 Bacteria 1626
303 Ga0207703_10002647 3300026035 Bacteria 15422
304 Ga0207703_10052295 3300026035 Bacteria 3316
305 Ga0207703_10099304 3300026035 Bacteria 2464
306 Ga0207639_10121807 3300026041 Bacteria 2144
307 Ga0207639_10506813 3300026041 Bacteria 1103
308 Ga0207678_10004109 3300026067 Bacteria 13090
309 Ga0207678_10047391 3300026067 Bacteria 3717
310 Ga0207678_10128677 3300026067 Bacteria 2159
311 Ga0207708_10041151 3300026075 Bacteria 3523
312 Ga0207702_10024948 3300026078 Bacteria 4961
313 Ga0207641_10019282 3300026088 Bacteria 5597
314 Ga0207641_10336927 3300026088 Bacteria 1434
315 Ga0207648_10026614 3300026089 Bacteria 5138
316 Ga0207648_10033094 3300026089 Bacteria 4560
317 Ga0207676_10236450 3300026095 Bacteria 1636
318 Ga0207676_10660920 3300026095 Bacteria 1009
319 Ga0207675_100039992 3300026118 Bacteria 4376
320 Ga0207675_100146203 3300026118 Bacteria 2248
321 Ga0207675_100167063 3300026118 Bacteria 2102
322 Ga0207683_10000505 3300026121 Bacteria 35999
323 Ga0207683_10094757 3300026121 Bacteria 2661
324 Ga0207698_10055958 3300026142 Bacteria 3043
325 Ga0207698_10205789 3300026142 Bacteria 1766
326 Ga0207698_10903027 3300026142 Bacteria 891
327 Ga0209813_10020537 3300027866 Bacteria 1848
328 Ga0268266_10003467 3300028379 Bacteria 15736
329 Ga0268266_10034863 3300028379 Bacteria 4281
330 Ga0268266_10046092 3300028379 Bacteria 3732
331 Ga0268266_10060513 3300028379 Bacteria 3265
332 Ga0268265_10000068 3300028380 Bacteria 142272
333 Ga0268265_10013315 3300028380 Bacteria 5588
334 Ga0268264_10000056 3300028381 Bacteria 310339
335 Ga0268264_10001510 3300028381 Bacteria 21672
336 Ga0268264_10270550 3300028381 Bacteria 1587
337 Ga0316578_10072942 3300031728 Bacteria 2034
338 Ga0307409_100045003 3300031995 Bacteria 3329
339 Ga0307409_100874746 3300031995 Bacteria 911
340 Ga0307416_100122833 3300032002 Bacteria 2319
341 Ga0307416_100844226 3300032002 Bacteria 1014
342 Ga0307414_10476680 3300032004 Bacteria 1100
343 Ga0307411_10587095 3300032005 Bacteria 956
344 Ga0307415_100236137 3300032126 Bacteria 1476
345 Ga0307415_100486789 3300032126 Bacteria 1075
346 Ga0373942_0081151 3300035207 Bacteria 963
347 Ga0373931_0004318 3300035691 Bacteria 6484
348 Ga0316582_0161473 3300036647 Bacteria 1518
349 Ga0316584_0037306 3300036712 Bacteria 3610
350 Ga0436364_0086127 3300037853 Bacteria 6020
351 Ga0436364_1215586 3300037853 Bacteria 29880
352 Ga0436364_1372978 3300037853 Bacteria 13480
353 Ga0436365_0012648 3300039437 Bacteria 2447
354 Ga0436365_0768403 3300039437 Bacteria 31379
355 Ga0436365_0815018 3300039437 Bacteria 21496
356 Ga0436365_1528956 3300039437 Bacteria 1255
357 Ga0436365_1776852 3300039437 Bacteria 23405
358 Ga0436361_1157439 3300039447 Bacteria 1719
359 Ga0436363_0021931 3300039450 Bacteria 1025
360 Ga0436363_0480492 3300039450 Bacteria 3636
361 Ga0436363_0505092 3300039450 Bacteria 2011
362 Ga0439461_0000681 3300041410 Bacteria 4919
363 Ga0439466_0051864 3300041411 Bacteria 1342
364 Ga0439466_0075662 3300041411 Bacteria 1067
365 Ga0439465_0000755 3300041413 Bacteria 10028
366 Ga0439465_0006181 3300041413 Bacteria 3807
367 Ga0439465_0009795 3300041413 Bacteria 3019
368 Ga0451793_1756660 3300041452 Bacteria 1071
369 Ga0451797_1395861 3300041453 Bacteria 857
370 Ga0451853_3431377 3300041512 Bacteria 1432
371 Ga0439431_0116565 3300041997 Bacteria 743
372 Ga0439442_035328 3300042002 Bacteria 1045
373 Ga0439445_0009959 3300042004 Bacteria 2244
374 Ga0439460_0047420 3300042461 Bacteria 1279
375 Ga0466969_0011023 3300044656 Bacteria 4787
376 Ga0466972_0009378 3300044658 Bacteria 4919
377 Ga0466972_0022132 3300044658 Bacteria 3165
378 Ga0466972_0081042 3300044658 Bacteria 1545
379 Ga0466972_0172884 3300044658 Bacteria 1014
380 Ga0466972_0395979 3300044658 Bacteria 647
381 Ga0466965_0079222 3300044683 Bacteria 1659
382 Ga0466966_0003232 3300044684 Bacteria 10740
383 Ga0466966_0008994 3300044684 Bacteria 6619
384 Ga0466966_0010351 3300044684 Bacteria 6192
385 Ga0466961_0003187 3300044693 Bacteria 10214
386 Ga0466961_0008027 3300044693 Bacteria 6727
387 Ga0466961_0090338 3300044693 Bacteria 1934
388 Ga0466963_0022418 3300044694 Bacteria 4000
389 Ga0466963_0162094 3300044694 Bacteria 1556
390 Ga0466963_0179884 3300044694 Bacteria 1476
391 Ga0466963_0536796 3300044694 Bacteria 826
392 Ga0466964_0227006 3300044706 Bacteria 909
393 Ga0466964_0374614 3300044706 Bacteria 737
394 Ga0466971_0055587 3300044719 Bacteria 1784
395 Ga0466971_0069488 3300044719 Bacteria 1598
396 Ga0466968_0017365 3300044735 Bacteria 2875
397 Ga0466968_0024190 3300044735 Bacteria 2480
398 Ga0466968_0330975 3300044735 Bacteria 737
399 Ga0466970_0010255 3300044765 Bacteria 4752
400 Ga0466970_0023771 3300044765 Bacteria 3203
401 Ga0466970_0165041 3300044765 Bacteria 1226
402 Ga0466957_0000331 3300044842 Bacteria 23031
403 Ga0466957_0008691 3300044842 Bacteria 5784
404 Ga0466960_0000511 3300044901 Bacteria 13319
405 Ga0466960_0027069 3300044901 Bacteria 2611
406 Ga0466960_0037286 3300044901 Bacteria 2280
407 Ga0466960_0067944 3300044901 Bacteria 1767
408 Ga0466960_0075469 3300044901 Bacteria 1687
409 Ga0466959_0012825 3300045049 Bacteria 6064
410 Ga0466959_0015223 3300045049 Bacteria 5603
411 Ga0466959_0029235 3300045049 Bacteria 4083
412 Ga0466959_0555913 3300045049 Bacteria 774
413 Ga0466959_0564169 3300045049 Bacteria 767
414 Ga0466958_0000581 3300045836 Bacteria 15582
415 Ga0466958_0000621 3300045836 Bacteria 15208
416 Ga0466958_0032553 3300045836 Bacteria 3102
417 Ga0466958_0161105 3300045836 Bacteria 1417
418 Ga0466967_0035121 3300045976 Bacteria 4263
419 Ga0466967_0062432 3300045976 Bacteria 3307
420 Ga0466967_0196498 3300045976 Bacteria 1908
421 Ga0466967_0238894 3300045976 Bacteria 1732
422 Ga0466967_0688800 3300045976 Bacteria 1012
423 Ga0466967_1169773 3300045976 Bacteria 766
424 Ga0495603_0098509 3300046455 Bacteria 1707
425 Ga0495629_0041406 3300046459 Bacteria 3241
426 Ga0495638_0014680 3300046460 Bacteria 5284
427 Ga0495653_0147516 3300046463 Bacteria 1647
428 Ga0495582_0024545 3300046473 Bacteria 3300
429 Ga0495639_0211607 3300046475 Bacteria 951
430 Ga0495583_0270599 3300046506 Bacteria 678
431 Ga0495606_0054052 3300046507 Bacteria 2602
432 Ga0495606_0144037 3300046507 Bacteria 1405
433 Ga0495620_0133138 3300046515 Bacteria 975
434 Ga0495666_0085243 3300046526 Bacteria 1492
435 Ga0495622_0121528 3300046557 Bacteria 1192
436 Ga0495668_0095161 3300046616 Bacteria 1630
437 Ga0495588_0303057 3300046674 Bacteria 841
438 Ga0495624_0091475 3300046690 Bacteria 1877
439 Ga0495604_0168915 3300047317 Bacteria 1540
440 Ga0495672_0008984 3300047320 Bacteria 7293
441 Ga0495672_0013338 3300047320 Bacteria 5675
442 Ga0495672_0200787 3300047320 Bacteria 997
443 Ga0495673_0000928 3300047469 Bacteria 26577
444 Ga0495626_0028204 3300048091 Bacteria 2724
445 Ga0496100_0006168 3300048903 Bacteria 6519
446 Ga0496100_0290195 3300048903 Bacteria 1222
447 Ga0496101_0000918 3300048904 Bacteria 17384
448 Ga0496101_0002887 3300048904 Bacteria 10573
449 Ga0496101_0082837 3300048904 Bacteria 2374
450 Ga0496101_0428308 3300048904 Bacteria 1043
451 Ga0496101_0878237 3300048904 Bacteria 706
452 Ga0496102_0001024 3300048905 Bacteria 26045
453 Ga0496102_0002231 3300048905 Bacteria 16617
454 Ga0496102_0041739 3300048905 Bacteria 4156
455 Ga0496102_0108076 3300048905 Bacteria 2591
456 Ga0496102_0115992 3300048905 Bacteria 2499
457 Ga0496103_0000353 3300048906 Bacteria 41823
458 Ga0496103_0002000 3300048906 Bacteria 13138
459 Ga0496103_0028690 3300048906 Bacteria 3379
460 Ga0496104_0011970 3300048907 Bacteria 7784
461 Ga0496104_0036381 3300048907 Bacteria 4602
462 Ga0496104_0132555 3300048907 Bacteria 2394
463 Ga0496105_0009652 3300048908 Bacteria 7555
464 Ga0496105_0061781 3300048908 Bacteria 3092
465 Ga0496106_0018039 3300048909 Bacteria 5217
466 Ga0496106_0023722 3300048909 Bacteria 4559
467 Ga0496106_0036274 3300048909 Bacteria 3688
468 Ga0496107_0000127 3300048910 Bacteria 37071
469 Ga0496107_0002266 3300048910 Bacteria 12412
470 Ga0496107_0053369 3300048910 Bacteria 2916
471 Ga0496108_0006135 3300048911 Bacteria 9721
472 Ga0496108_0045000 3300048911 Bacteria 3685
473 Ga0496108_0656208 3300048911 Bacteria 912
474 Ga0496109_0008453 3300048912 Bacteria 8753
475 Ga0496109_0016254 3300048912 Bacteria 6505
476 Ga0496109_0392952 3300048912 Bacteria 1310
477 Ga0496110_0057562 3300048913 Bacteria 3422
478 Ga0496110_0137298 3300048913 Bacteria 2210
479 Ga0496110_0236406 3300048913 Bacteria 1662
480 Ga0496110_0403907 3300048913 Bacteria 1245
481 Ga0496112_0003935 3300048915 Bacteria 12436
482 Ga0496112_0017714 3300048915 Bacteria 6702
483 Ga0496112_0047429 3300048915 Bacteria 4215
484 Ga0496112_0084057 3300048915 Bacteria 3148
485 Ga0496113_0059775 3300048916 Bacteria 2872
486 Ga0496114_0000176 3300048917 Bacteria 45206
487 Ga0496114_0006698 3300048917 Bacteria 9075
488 Ga0496114_0064488 3300048917 Bacteria 3068
489 Ga0496115_0004720 3300048918 Bacteria 9883
490 Ga0496115_0380022 3300048918 Bacteria 1149
491 Ga0496115_0408216 3300048918 Bacteria 1101
492 Ga0496116_0003013 3300048919 Bacteria 17071
493 Ga0496117_0001778 3300048920 Bacteria 29523
494 Ga0496118_0000067 3300048921 Bacteria 207219
495 Ga0496118_0000461 3300048921 Bacteria 67437
496 Ga0496119_0004875 3300048922 Bacteria 13138
497 Ga0496119_0105838 3300048922 Bacteria 1571
498 Ga0496119_0127281 3300048922 Bacteria 1392
499 Ga0496120_0005855 3300048923 Bacteria 9613
500 Ga0496121_0002515 3300048924 Bacteria 27826
501 Ga0496124_0459402 3300048927 Bacteria 866
502 Ga0496125_0040065 3300048928 Bacteria 4023
503 Ga0496126_0026087 3300048929 Bacteria 5609
504 Ga0496126_0087013 3300048929 Bacteria 2753
505 Ga0501032_0000926 3300049569 Bacteria 23723
506 Ga0501032_0051331 3300049569 Bacteria 2781
507 Ga0501033_0080726 3300049570 Bacteria 2386
508 Ga0501034_0005055 3300049571 Bacteria 14492
509 Ga0501034_0016975 3300049571 Bacteria 7462
510 Ga0501036_0017091 3300049572 Bacteria 6064
511 Ga0501037_0001869 3300049573 Bacteria 15288
512 Ga0501037_0039948 3300049573 Bacteria 3453
513 Ga0501038_0077915 3300049574 Bacteria 2797
514 Ga0501039_0000657 3300049575 Bacteria 24951
515 Ga0501043_0000892 3300049579 Bacteria 26475
516 Ga0501043_0017159 3300049579 Bacteria 5677
517 Ga0501046_0005026 3300049580 Bacteria 11872
518 Ga0501047_0016835 3300049581 Bacteria 6984
519 Ga0501047_0060991 3300049581 Bacteria 3639
520 Ga0501047_0314251 3300049581 Bacteria 1407
521 Ga0501048_0004119 3300049582 Bacteria 11078
522 Ga0501067_0042356 3300049583 Bacteria 2528
523 Ga0501067_0250114 3300049583 Bacteria 987
524 Ga0501070_0002534 3300049586 Bacteria 16021
525 Ga0501070_0002797 3300049586 Bacteria 15225
526 Ga0501077_0164015 3300049593 Bacteria 1411
527 Ga0501080_0216648 3300049742 Bacteria 1753
528 Ga0501083_0161496 3300049744 Bacteria 1466
529 Ga0501035_0001648 3300049822 Bacteria 22561
530 Ga0501035_0004241 3300049822 Bacteria 13621
531 Ga0501044_0012063 3300049823 Bacteria 9359
532 Ga0501044_0031094 3300049823 Bacteria 5621
533 Ga0501044_0034268 3300049823 Bacteria 5326
534 Ga0501044_0164827 3300049823 Bacteria 2191
535 Ga0501044_0182403 3300049823 Bacteria 2065
536 nmdc:mga03683_65709_c1 3300050489 Bacteria 1541
537 nmdc:mga03n38_1709_c1 3300050490 Bacteria 6471
538 nmdc:mga03n38_248615_c1 3300050490 Bacteria 938
539 nmdc:mga03n38_3662_c1 3300050490 Bacteria 4970
540 nmdc:mga03n38_6756_c1 3300050490 Bacteria 4012
541 nmdc:mga03n38_87311_c1 3300050490 Bacteria 1478
542 nmdc:mga00v17_124380_c1 3300050491 Bacteria 1645
543 nmdc:mga00v17_2473_c1 3300050491 Bacteria 9446
544 nmdc:mga00v17_3558_c1 3300050491 Bacteria 8047
545 nmdc:mga00v17_4970_c1 3300050491 Bacteria 6973
546 nmdc:mga00v17_85996_c1 3300050491 Bacteria 1970
547 nmdc:mga0yw44_11764_c1 3300050492 Bacteria 4535
548 nmdc:mga0yw44_193717_c1 3300050492 Bacteria 1341
549 nmdc:mga0k408_45722_c1 3300050493 Bacteria 2526
550 nmdc:mga06z11_1895_c1 3300050494 Bacteria 7887
551 nmdc:mga06z11_319493_c1 3300050494 Bacteria 926
552 nmdc:mga04h51_20279_c1 3300050495 Bacteria 1982
553 nmdc:mga07m45_122983_c1 3300050496 Bacteria 1499
554 nmdc:mga07m45_1775_c1 3300050496 Bacteria 9936
555 nmdc:mga07m45_30982_c1 3300050496 Bacteria 2964
556 nmdc:mga05p37_441633_c1 3300050507 Bacteria 1509
557 nmdc:mga0qj67_14646_c1 3300050509 Bacteria 2867
558 nmdc:mga0qj67_54760_c1 3300050509 Bacteria 3159
559 nmdc:mga06r32_40354_c1 3300050510 Bacteria 4430
560 nmdc:mga0sz30_12120_c1 3300050516 Bacteria 3346
561 nmdc:mga0sz30_153392_c1 3300050516 Bacteria 1019
562 nmdc:mga0sz30_17991_c1 3300050516 Bacteria 2824
563 nmdc:mga0sz30_18346_c1 3300050516 Bacteria 2799
564 nmdc:mga0sz30_188455_c1 3300050516 Bacteria 916
565 nmdc:mga0sz30_37291_c1 3300050516 Bacteria 1720
566 nmdc:mga0sz30_7551_c1 3300050516 Bacteria 4081
567 nmdc:mga0sz30_7973_c1 3300050516 Bacteria 3985
568 nmdc:mga0sz30_8029_c1 3300050516 Bacteria 3976
569 Ga0500610_0018694 3300053079 Bacteria 3357
570 Ga0500635_0005490 3300053080 Bacteria 3330
571 Ga0500643_010168 3300053087 Bacteria 3529
572 Ga0500562_098590 3300053108 Bacteria 795
573 Ga0500593_120179 3300053117 Bacteria 1066
574 Ga0500628_070813 3300053129 Bacteria 873
575 Ga0500652_001465 3300053131 Bacteria 7295
576 Ga0500568_0041486 3300053139 Bacteria 1849
577 Ga0500568_0195904 3300053139 Bacteria 741
578 Ga0500616_0001663 3300053153 Bacteria 20519
579 Ga0466962_0005066 3300061719 Bacteria 6337
580 Ga0466962_0024161 3300061719 Bacteria 2920
581 Ga0466962_0154150 3300061719 Bacteria 1115
582 2644487366 2643221687 Bacteria 6500351
583 2738702595 2738541274 Bacteria 6909446
584 2739329504 2738543028 Bacteria 6917070
585 2842135191 2842134933 Bacteria 5847019
586 2902794402 2902792274 Bacteria 7270173
587 2902803258 2902799365 Bacteria 5419524
588 2902839475 2902837492 Bacteria 6697721
589 2929213140 2929212328 Bacteria 7708288
590 2939587133 2939582691 Bacteria 7088898
591 Ga0436365_0080381
592 JGI24744J21845_10000220
593 Ga0055540_1001503
594 Ga0055540_1009141
595 Ga0070683_100100264
596 Ga0070683_100119231
597 Ga0070690_100009299
598 Ga0070670_100084798
599 Ga0068869_100009588
600 Ga0068869_100444302
601 Ga0070666_10166603
602 Ga0070680_100658567
603 Ga0068868_100000603
604 Ga0068868_100480743
605 Ga0070660_100210351
606 Ga0070689_100040907
607 Ga0070689_100129395
608 Ga0070691_10000356
609 Ga0070691_10087723
610 Ga0070692_10040308
611 Ga0070668_100001911
612 Ga0070668_100006512
613 Ga0070668_100023651
614 Ga0070668_100078493
615 Ga0070668_100405566
616 Ga0070669_100007934
617 Ga0070669_100012933
618 Ga0070669_100046432
619 Ga0070675_100118574
620 Ga0070675_100498329
621 Ga0070671_100054164
622 Ga0070671_100132340
623 Ga0070671_100331055
624 Ga0070674_100000346
625 Ga0070674_100185710
626 Ga0070688_100052169
627 Ga0070688_100109145
628 Ga0070659_100092684
629 Ga0070667_100000029
630 Ga0070667_100001704
631 Ga0070667_100015134
632 Ga0070667_100331092
633 Ga0070667_100403286
634 Ga0070714_100290714
635 Ga0070714_100672738
636 Ga0070713_100120764
637 Ga0070713_100964554
638 Ga0070710_10006025
639 Ga0070710_10420345
640 Ga0070701_10000569
641 Ga0070711_100000224
642 Ga0070711_100056338
643 Ga0070705_100093688
644 Ga0070700_100000375
645 Ga0070700_100031608
646 Ga0070700_100752910
647 Ga0070694_100019812
648 Ga0070663_100010126
649 Ga0070663_100151242
650 Ga0070678_100000144
651 Ga0070678_100366763
652 Ga0070678_100982310
653 Ga0070662_100029472
654 Ga0070662_100096363
655 Ga0068867_100053402
656 Ga0068867_100071214
657 Ga0068867_100601144
658 Ga0070685_10018472
659 Ga0068853_100140150
660 Ga0068853_101144045
661 Ga0070672_100020884
662 Ga0070672_100111108
663 Ga0070686_100098571
664 Ga0070686_100669370
665 Ga0070695_100002556
666 Ga0070695_100050784
667 Ga0070696_100000635
668 Ga0070696_100247143
669 Ga0070696_100633239
670 Ga0070693_100004031
671 Ga0070693_100273490
672 Ga0070665_100001364
673 Ga0070665_100004989
674 Ga0070665_100007740
675 Ga0070665_100222779
676 Ga0070704_100000339
677 Ga0070704_100158938
678 Ga0068854_100000756
679 Ga0068854_100029987
680 Ga0068856_100026078
681 Ga0070702_100020346
682 Ga0070702_100089925
683 Ga0068852_100017360
684 Ga0068852_100105822
685 Ga0068859_100000342
686 Ga0068859_100001989
687 Ga0068859_100627484
688 Ga0068864_100253443
689 Ga0068866_10001049
690 Ga0068861_100003302
691 Ga0068861_100483554
692 Ga0068861_100589508
693 Ga0068851_10077099
694 Ga0068870_10275170
695 Ga0068863_100188536
696 Ga0068863_100911961
697 Ga0068858_100005245
698 Ga0068858_100030973
699 Ga0068858_100080776
700 Ga0068860_100000088
701 Ga0068860_100000761
702 Ga0068860_100416998
703 Ga0068862_100000056
704 Ga0068862_100010605
705 Ga0068862_100364245
706 Ga0081455_10012020
707 Ga0075365_10002241
708 Ga0075365_10057363
709 Ga0075365_10242080
710 Ga0075365_10326329
711 Ga0075368_10048220
712 Ga0075363_100001458
713 Ga0075363_100005218
714 Ga0075363_100011812
715 Ga0075363_100016737
716 Ga0075363_100120515
717 Ga0075363_100211428
718 Ga0075363_100220202
719 Ga0075363_100228162
720 Ga0075364_10003364
721 Ga0075364_10003804
722 Ga0075364_10013987
723 Ga0075364_10014085
724 Ga0075364_10014738
725 Ga0075364_10035467
726 Ga0075364_10061162
727 Ga0075364_10250548
728 Ga0075364_10553798
729 Ga0070715_10013021
730 Ga0070715_10040867
731 Ga0070716_100003576
732 Ga0070716_100007637
733 Ga0070716_100530403
734 Ga0070712_100001750
735 Ga0070712_100006407
736 Ga0075362_10032340
737 Ga0075362_10070232
738 Ga0075362_10079004
739 Ga0075367_10004461
740 Ga0075369_10005134
741 Ga0075369_10028138
742 Ga0075369_10046158
743 Ga0075369_10052549
744 Ga0075369_10136784
745 Ga0075369_10159349
746 Ga0097621_100102649
747 Ga0097621_100115592
748 Ga0075370_10003179
749 Ga0075370_10005393
750 Ga0075370_10013185
751 Ga0075370_10114748
752 Ga0075370_10155316
753 Ga0068871_100228868
754 Ga0075430_100030487
755 Ga0068865_100001967
756 Ga0068865_100042864
757 Ga0068865_100127782
758 Ga0097620_100000342
759 Ga0097620_100001989
760 Ga0097620_100627474
761 Ga0099795_10036395
762 Ga0105250_10073305
763 Ga0105245_10001652
764 Ga0105245_10302264
765 Ga0105247_10000008
766 Ga0105247_10000627
767 Ga0105247_10105621
768 Ga0114129_10014386
769 Ga0105243_10001311
770 Ga0105241_10037642
771 Ga0105242_10003824
772 Ga0105242_10252869
773 Ga0105248_10000051
774 Ga0105248_10002866
775 Ga0105248_10054160
776 Ga0105248_10139317
777 Ga0105237_10307873
778 Ga0105249_10000040
779 Ga0105249_10010999
780 Ga0105249_10110565
781 Ga0105249_10196455
782 Ga0099796_10025414
783 Ga0105239_10004210
784 Ga0105239_10068961
785 Ga0105239_10343875
786 Ga0157374_10007432
787 Ga0157378_10008169
788 Ga0157378_10506619
789 Ga0163162_10007715
790 Ga0163162_10020350
791 Ga0163162_10272243
792 Ga0163162_10318576
793 Ga0157372_10015804
794 Ga0157372_10585202
795 Ga0157375_10004381
796 Ga0157375_10452105
797 Ga0163163_10014923
798 Ga0157380_10000214
799 Ga0157380_10192226
800 Ga0182008_10095533
801 Ga0157379_10082179
802 Ga0157379_10320156
803 Ga0157376_10183712
804 Ga0157376_10270982
805 Ga0163161_10001940
806 Ga0163161_10030873
807 Ga0213874_10091830
808 Ga0213876_10002474
809 Ga0213876_10178981
810 Ga0213875_10051272
811 Ga0213875_10056612
812 Ga0209051_1000401
813 Ga0209051_1001662
814 Ga0209051_1026733
815 Ga0209051_1053986
816 Ga0209051_1098594
817 Ga0207692_10199538
818 Ga0207642_10001391
819 Ga0207710_10000006
820 Ga0207710_10000373
821 Ga0207710_10039590
822 Ga0207688_10000253
823 Ga0207688_10020799
824 Ga0207680_10178554
825 Ga0207680_10210274
826 Ga0207685_10002309
827 Ga0207685_10054976
828 Ga0207699_10006814
829 Ga0207645_10095526
830 Ga0207654_10207260
831 Ga0207671_10202290
832 Ga0207671_10326617
833 Ga0207693_10000498
834 Ga0207693_10020894
835 Ga0207663_10001093
836 Ga0207663_10015804
837 Ga0207660_10207846
838 Ga0207660_10494625
839 Ga0207662_10149267
840 Ga0207662_10259640
841 Ga0207681_10001108
842 Ga0207681_10044399
843 Ga0207650_10070820
844 Ga0207659_10013693
845 Ga0207659_10426578
846 Ga0207687_10001262
847 Ga0207687_10027587
848 Ga0207700_10824647
849 Ga0207664_10079287
850 Ga0207664_10472128
851 Ga0207644_10046908
852 Ga0207644_10245754
853 Ga0207644_10490534
854 Ga0207690_10016607
855 Ga0207706_10010581
856 Ga0207706_10080897
857 Ga0207686_10040139
858 Ga0207709_10001287
859 Ga0207670_10002917
860 Ga0207670_10095120
861 Ga0207669_10000304
862 Ga0207669_10019642
863 Ga0207669_10257801
864 Ga0207669_10385107
865 Ga0207704_10000284
866 Ga0207704_10247544
867 Ga0207665_10006139
868 Ga0207665_10010628
869 Ga0207665_10463029
870 Ga0207691_10034924
871 Ga0207711_10000811
872 Ga0207711_10023935
873 Ga0207711_10052549
874 Ga0207689_10018457
875 Ga0207689_10050697
876 Ga0207661_10044125
877 Ga0207661_10210156
878 Ga0207712_10000017
879 Ga0207712_10145384
880 Ga0207668_10000470
881 Ga0207668_10001040
882 Ga0207668_10329139
883 Ga0207640_10003489
884 Ga0207640_10212382
885 Ga0207658_10000016
886 Ga0207658_10002132
887 Ga0207658_10007143
888 Ga0207658_10161414
889 Ga0207658_10282237
890 Ga0207677_10001233
891 Ga0207677_10163490
892 Ga0207677_10189384
893 Ga0207703_10002647
894 Ga0207703_10052295
895 Ga0207703_10099304
896 Ga0207639_10121807
897 Ga0207639_10506813
898 Ga0207678_10004109
899 Ga0207678_10047391
900 Ga0207678_10128677
901 Ga0207708_10041151
902 Ga0207702_10024948
903 Ga0207641_10019282
904 Ga0207641_10336927
905 Ga0207648_10026614
906 Ga0207648_10033094
907 Ga0207676_10236450
908 Ga0207676_10660920
909 Ga0207675_100039992
910 Ga0207675_100146203
911 Ga0207675_100167063
912 Ga0207683_10000505
913 Ga0207683_10094757
914 Ga0207698_10055958
915 Ga0207698_10205789
916 Ga0207698_10903027
917 Ga0209813_10020537
918 Ga0268266_10003467
919 Ga0268266_10034863
920 Ga0268266_10046092
921 Ga0268266_10060513
922 Ga0268265_10000068
923 Ga0268265_10013315
924 Ga0268264_10000056
925 Ga0268264_10001510
926 Ga0268264_10270550
927 Ga0316578_10072942
928 Ga0307409_100045003
929 Ga0307409_100874746
930 Ga0307416_100122833
931 Ga0307416_100844226
932 Ga0307414_10476680
933 Ga0307411_10587095
934 Ga0307415_100236137
935 Ga0307415_100486789
936 Ga0373942_0081151
937 Ga0373931_0004318
938 Ga0316582_0161473
939 Ga0316584_0037306
940 Ga0436364_0086127
941 Ga0436364_1215586
942 Ga0436364_1372978
943 Ga0436365_0012648
944 Ga0436365_0768403
945 Ga0436365_0815018
946 Ga0436365_1528956
947 Ga0436365_1776852
948 Ga0436361_1157439
949 Ga0436363_0021931
950 Ga0436363_0480492
951 Ga0436363_0505092
952 Ga0439461_0000681
953 Ga0439466_0051864
954 Ga0439466_0075662
955 Ga0439465_0000755
956 Ga0439465_0006181
957 Ga0439465_0009795
958 Ga0451793_1756660
959 Ga0451797_1395861
960 Ga0451853_3431377
961 Ga0439431_0116565
962 Ga0439442_035328
963 Ga0439445_0009959
964 Ga0439460_0047420
965 Ga0466969_0011023
966 Ga0466972_0009378
967 Ga0466972_0022132
968 Ga0466972_0081042
969 Ga0466972_0172884
970 Ga0466972_0395979
971 Ga0466965_0079222
972 Ga0466966_0003232
973 Ga0466966_0008994
974 Ga0466966_0010351
975 Ga0466961_0003187
976 Ga0466961_0008027
977 Ga0466961_0090338
978 Ga0466963_0022418
979 Ga0466963_0162094
980 Ga0466963_0179884
981 Ga0466963_0536796
982 Ga0466964_0227006
983 Ga0466964_0374614
984 Ga0466971_0055587
985 Ga0466971_0069488
986 Ga0466968_0017365
987 Ga0466968_0024190
988 Ga0466968_0330975
989 Ga0466970_0010255
990 Ga0466970_0023771
991 Ga0466970_0165041
992 Ga0466957_0000331
993 Ga0466957_0008691
994 Ga0466960_0000511
995 Ga0466960_0027069
996 Ga0466960_0037286
997 Ga0466960_0067944
998 Ga0466960_0075469
999 Ga0466959_0012825
1000 Ga0466959_0015223
1001 Ga0466959_0029235
1002 Ga0466959_0555913
1003 Ga0466959_0564169
1004 Ga0466958_0000581
1005 Ga0466958_0000621
1006 Ga0466958_0032553
1007 Ga0466958_0161105
1008 Ga0466967_0035121
1009 Ga0466967_0062432
1010 Ga0466967_0196498
1011 Ga0466967_0238894
1012 Ga0466967_0688800
1013 Ga0466967_1169773
1014 Ga0495603_0098509
1015 Ga0495629_0041406
1016 Ga0495638_0014680
1017 Ga0495653_0147516
1018 Ga0495582_0024545
1019 Ga0495639_0211607
1020 Ga0495583_0270599
1021 Ga0495606_0054052
1022 Ga0495606_0144037
1023 Ga0495620_0133138
1024 Ga0495666_0085243
1025 Ga0495622_0121528
1026 Ga0495668_0095161
1027 Ga0495588_0303057
1028 Ga0495624_0091475
1029 Ga0495604_0168915
1030 Ga0495672_0008984
1031 Ga0495672_0013338
1032 Ga0495672_0200787
1033 Ga0495673_0000928
1034 Ga0495626_0028204
1035 Ga0496100_0006168
1036 Ga0496100_0290195
1037 Ga0496101_0000918
1038 Ga0496101_0002887
1039 Ga0496101_0082837
1040 Ga0496101_0428308
1041 Ga0496101_0878237
1042 Ga0496102_0001024
1043 Ga0496102_0002231
1044 Ga0496102_0041739
1045 Ga0496102_0108076
1046 Ga0496102_0115992
1047 Ga0496103_0000353
1048 Ga0496103_0002000
1049 Ga0496103_0028690
1050 Ga0496104_0011970
1051 Ga0496104_0036381
1052 Ga0496104_0132555
1053 Ga0496105_0009652
1054 Ga0496105_0061781
1055 Ga0496106_0018039
1056 Ga0496106_0023722
1057 Ga0496106_0036274
1058 Ga0496107_0000127
1059 Ga0496107_0002266
1060 Ga0496107_0053369
1061 Ga0496108_0006135
1062 Ga0496108_0045000
1063 Ga0496108_0656208
1064 Ga0496109_0008453
1065 Ga0496109_0016254
1066 Ga0496109_0392952
1067 Ga0496110_0057562
1068 Ga0496110_0137298
1069 Ga0496110_0236406
1070 Ga0496110_0403907
1071 Ga0496112_0003935
1072 Ga0496112_0017714
1073 Ga0496112_0047429
1074 Ga0496112_0084057
1075 Ga0496113_0059775
1076 Ga0496114_0000176
1077 Ga0496114_0006698
1078 Ga0496114_0064488
1079 Ga0496115_0004720
1080 Ga0496115_0380022
1081 Ga0496115_0408216
1082 Ga0496116_0003013
1083 Ga0496117_0001778
1084 Ga0496118_0000067
1085 Ga0496118_0000461
1086 Ga0496119_0004875
1087 Ga0496119_0105838
1088 Ga0496119_0127281
1089 Ga0496120_0005855
1090 Ga0496121_0002515
1091 Ga0496124_0459402
1092 Ga0496125_0040065
1093 Ga0496126_0026087
1094 Ga0496126_0087013
1095 Ga0501032_0000926
1096 Ga0501032_0051331
1097 Ga0501033_0080726
1098 Ga0501034_0005055
1099 Ga0501034_0016975
1100 Ga0501036_0017091
1101 Ga0501037_0001869
1102 Ga0501037_0039948
1103 Ga0501038_0077915
1104 Ga0501039_0000657
1105 Ga0501043_0000892
1106 Ga0501043_0017159
1107 Ga0501046_0005026
1108 Ga0501047_0016835
1109 Ga0501047_0060991
1110 Ga0501047_0314251
1111 Ga0501048_0004119
1112 Ga0501067_0042356
1113 Ga0501067_0250114
1114 Ga0501070_0002534
1115 Ga0501070_0002797
1116 Ga0501077_0164015
1117 Ga0501080_0216648
1118 Ga0501083_0161496
1119 Ga0501035_0001648
1120 Ga0501035_0004241
1121 Ga0501044_0012063
1122 Ga0501044_0031094
1123 Ga0501044_0034268
1124 Ga0501044_0164827
1125 Ga0501044_0182403
1126 nmdc:mga03683_65709_c1
1127 nmdc:mga03n38_1709_c1
1128 nmdc:mga03n38_248615_c1
1129 nmdc:mga03n38_3662_c1
1130 nmdc:mga03n38_6756_c1
1131 nmdc:mga03n38_87311_c1
1132 nmdc:mga00v17_124380_c1
1133 nmdc:mga00v17_2473_c1
1134 nmdc:mga00v17_3558_c1
1135 nmdc:mga00v17_4970_c1
1136 nmdc:mga00v17_85996_c1
1137 nmdc:mga0yw44_11764_c1
1138 nmdc:mga0yw44_193717_c1
1139 nmdc:mga0k408_45722_c1
1140 nmdc:mga06z11_1895_c1
1141 nmdc:mga06z11_319493_c1
1142 nmdc:mga04h51_20279_c1
1143 nmdc:mga07m45_122983_c1
1144 nmdc:mga07m45_1775_c1
1145 nmdc:mga07m45_30982_c1
1146 nmdc:mga05p37_441633_c1
1147 nmdc:mga0qj67_14646_c1
1148 nmdc:mga0qj67_54760_c1
1149 nmdc:mga06r32_40354_c1
1150 nmdc:mga0sz30_12120_c1
1151 nmdc:mga0sz30_153392_c1
1152 nmdc:mga0sz30_17991_c1
1153 nmdc:mga0sz30_18346_c1
1154 nmdc:mga0sz30_188455_c1
1155 nmdc:mga0sz30_37291_c1
1156 nmdc:mga0sz30_7551_c1
1157 nmdc:mga0sz30_7973_c1
1158 nmdc:mga0sz30_8029_c1
1159 Ga0500610_0018694
1160 Ga0500635_0005490
1161 Ga0500643_010168
1162 Ga0500562_098590
1163 Ga0500593_120179
1164 Ga0500628_070813
1165 Ga0500652_001465
1166 Ga0500568_0041486
1167 Ga0500568_0195904
1168 Ga0500616_0001663
1169 Ga0466962_0005066
1170 Ga0466962_0024161
1171 Ga0466962_0154150
1172 2644487366
1173 2738702595
1174 2739329504
1175 2842135191
1176 2902794402
1177 2902803258
1178 2902839475
1179 2929213140
1180 2939587133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20408

Abhydrolase_11

Alpha/beta hydrolase domain

17

193

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wtn-assembly1.cif.gz_A ferulic acid bound to est1e from butyrivibrio proteoclasticus 0.8294 8 203
3trd-assembly1.cif.gz_A structure of an alpha-beta serine hydrolase homologue from coxiella burnetii 0.8159 8 199
2wtm-assembly1.cif.gz_B est1e from butyrivibrio proteoclasticus 0.807 8 203
3jw8-assembly1.cif.gz_A crystal structure of human mono-glyceride lipase 0.8052 8 202
2wtm-assembly2.cif.gz_D est1e from butyrivibrio proteoclasticus 0.8043 8 203
ID Description Score Start End Superfamily
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9976 2 202 3.40.50.1820
af_P96267_2_202_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9927 2 202 3.40.50.1820
af_B4FGW5_14_203_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8463 14 189 3.40.50.1820
af_Q5JUR7_11_206_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8231 6 195 3.40.50.1820
af_F4JBL2_8_318_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8186 8 202 3.40.50.1820
ID Description Score Start End GO Terms
AF-S4ZGA6-F1-model_v4 deleted 0.9967 22 204
AF-X8B3N9-F1-model_v4 deleted 0.9949 10 204
AF-A0A2S8BMY3-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9906 84 205
AF-A0A655J8J3-F1-model_v4 Alpha/beta hydrolase superfamily enzyme, predicted hydrolase 0.9891 106 203 GO:0016787
AF-K0UNA9-F1-model_v4 KANL3/Tex30 alpha/beta hydrolase-like domain-containing protein 0.9876 91 205

Map