F466945

General Info

Members Datasets Scaffolds Average Seq Length
590 275 1180 154

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100574080|Ga0070708_1005740801
Length 158
Sequence MSHIYCPECGFQNPEAANYCSRCGALLVKDEPGSETTMSYTPEEGGEAGEAAPSLEDLGAEGPALVVRSGGGRAGEHFVPQGERTTIGRSPDCDIFLDDVTVSRKHAVLLHGDDGYYIEDQGSLNGTFLNRKRIESSARLENGDELQIGKYKLTFLET

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
87 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
155 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
156 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
157 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
158 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
181 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
182 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
204 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
205 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
211 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
212 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
220 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
221 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
227 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
232 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
233 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
259 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
260 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
271 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
272 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.85
Rhizosphere 88.81
Stem 0
Stem Tuber 0
Unclassified 0.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100574080 3300005445 Bacteria 1063
2 JGI24738J21930_10065240 3300002075 Bacteria 750
3 Ga0070683_100001516 3300005329 Bacteria 17949
4 Ga0070683_100007917 3300005329 Bacteria 9009
5 Ga0070683_100376993 3300005329 Bacteria 1352
6 Ga0070683_100741418 3300005329 Bacteria 941
7 Ga0070690_100081063 3300005330 Bacteria 2123
8 Ga0070670_101142307 3300005331 Bacteria 711
9 Ga0070680_100005813 3300005336 Bacteria 9360
10 Ga0070680_100173949 3300005336 Bacteria 1812
11 Ga0070682_100217587 3300005337 Bacteria 1357
12 Ga0068868_100065453 3300005338 Bacteria 2888
13 Ga0068868_100088992 3300005338 Bacteria 2485
14 Ga0070660_100015965 3300005339 Bacteria 5438
15 Ga0070691_10021850 3300005341 Bacteria 2965
16 Ga0070691_10039783 3300005341 Bacteria 2222
17 Ga0070692_10084571 3300005345 Bacteria 1715
18 Ga0070668_100001897 3300005347 Bacteria 15288
19 Ga0070668_100022054 3300005347 Bacteria 4814
20 Ga0070668_101035213 3300005347 Bacteria 739
21 Ga0070669_100836792 3300005353 Bacteria 784
22 Ga0070671_100124626 3300005355 Bacteria 2169
23 Ga0070671_101737296 3300005355 Bacteria 554
24 Ga0070674_100048532 3300005356 Bacteria 2914
25 Ga0070674_100569485 3300005356 Bacteria 953
26 Ga0070673_100488163 3300005364 Bacteria 1113
27 Ga0070703_10025976 3300005406 Bacteria 1739
28 Ga0070709_10038320 3300005434 Bacteria 2934
29 Ga0070714_100038774 3300005435 Bacteria 4007
30 Ga0070714_100058933 3300005435 Bacteria 3291
31 Ga0070713_100316843 3300005436 Bacteria 1439
32 Ga0070713_100862525 3300005436 Bacteria 870
33 Ga0070710_10140116 3300005437 Bacteria 1482
34 Ga0070701_10120679 3300005438 Bacteria 1477
35 Ga0070711_100375081 3300005439 Bacteria 1149
36 Ga0070711_100493528 3300005439 Bacteria 1008
37 Ga0070705_100012844 3300005440 Bacteria 4270
38 Ga0070705_100094774 3300005440 Bacteria 1870
39 Ga0070678_100034499 3300005456 Bacteria 3525
40 Ga0070678_100058257 3300005456 Bacteria 2834
41 Ga0070678_100250934 3300005456 Bacteria 1484
42 Ga0070662_100017440 3300005457 Bacteria 4842
43 Ga0070662_100175470 3300005457 Bacteria 1686
44 Ga0070681_11048806 3300005458 Bacteria 736
45 Ga0068867_100244821 3300005459 Bacteria 1456
46 Ga0068867_100261645 3300005459 Bacteria 1411
47 Ga0070685_10514802 3300005466 Bacteria 849
48 Ga0070685_11360429 3300005466 Bacteria 544
49 Ga0070706_100004250 3300005467 Bacteria 13897
50 Ga0070706_100054991 3300005467 Bacteria 3674
51 Ga0070706_100202169 3300005467 Bacteria 1856
52 Ga0070707_100120260 3300005468 Bacteria 2550
53 Ga0070698_100057209 3300005471 Bacteria 3947
54 Ga0070698_100393156 3300005471 Bacteria 1319
55 Ga0070699_100046359 3300005518 Bacteria 3761
56 Ga0070679_100104029 3300005530 Bacteria 2826
57 Ga0070684_100150601 3300005535 Bacteria 2107
58 Ga0070686_100030082 3300005544 Bacteria 3309
59 Ga0070686_100032945 3300005544 Bacteria 3181
60 Ga0070686_100313245 3300005544 Bacteria 1168
61 Ga0070695_100038132 3300005545 Bacteria 3031
62 Ga0070695_100111170 3300005545 Bacteria 1859
63 Ga0070695_100200186 3300005545 Bacteria 1427
64 Ga0070696_100037188 3300005546 Bacteria 3357
65 Ga0070696_100042301 3300005546 Bacteria 3151
66 Ga0070696_100188589 3300005546 Bacteria 1533
67 Ga0070693_100000955 3300005547 Bacteria 12824
68 Ga0070693_100007441 3300005547 Bacteria 5354
69 Ga0070693_100010299 3300005547 Bacteria 4681
70 Ga0070704_100058140 3300005549 Bacteria 2753
71 Ga0070704_100684813 3300005549 Bacteria 908
72 Ga0068855_100069343 3300005563 Bacteria 4103
73 Ga0068855_100408531 3300005563 Bacteria 1487
74 Ga0070664_100610719 3300005564 Bacteria 1012
75 Ga0068857_100019226 3300005577 Bacteria 5997
76 Ga0068857_100236780 3300005577 Bacteria 1670
77 Ga0068854_100017986 3300005578 Bacteria 4738
78 Ga0068854_100925255 3300005578 Bacteria 768
79 Ga0068856_100009373 3300005614 Bacteria 9508
80 Ga0068856_100161498 3300005614 Bacteria 2251
81 Ga0068856_100381180 3300005614 Bacteria 1429
82 Ga0068856_100478688 3300005614 Bacteria 1266
83 Ga0070702_100004649 3300005615 Bacteria 6294
84 Ga0070702_100186553 3300005615 Bacteria 1361
85 Ga0070702_101362140 3300005615 Bacteria 579
86 Ga0068864_100282740 3300005618 Bacteria 1549
87 Ga0068866_10168088 3300005718 Bacteria 1285
88 Ga0068861_100002424 3300005719 Bacteria 12151
89 Ga0068861_100132517 3300005719 Bacteria 2024
90 Ga0068861_100275749 3300005719 Bacteria 1446
91 Ga0068860_100143821 3300005843 Bacteria 2294
92 Ga0068862_100097810 3300005844 Bacteria 2563
93 Ga0081455_10005540 3300005937 Bacteria 13828
94 Ga0081455_10021298 3300005937 Bacteria 6083
95 Ga0081455_10022045 3300005937 Bacteria 5963
96 Ga0081455_10213171 3300005937 Bacteria 1437
97 Ga0081455_10442688 3300005937 Bacteria 890
98 Ga0081538_10012318 3300005981 Bacteria 6861
99 Ga0081540_1003067 3300005983 Bacteria 13383
100 Ga0081540_1004245 3300005983 Bacteria 11003
101 Ga0081540_1009431 3300005983 Bacteria 6726
102 Ga0081540_1012281 3300005983 Bacteria 5654
103 Ga0081539_10002640 3300005985 Bacteria 24492
104 Ga0081539_10047032 3300005985 Bacteria 2468
105 Ga0070717_10070065 3300006028 Bacteria 2921
106 Ga0070717_10137945 3300006028 Bacteria 2102
107 Ga0070717_10154396 3300006028 Bacteria 1988
108 Ga0075432_10006518 3300006058 Bacteria 3975
109 Ga0070715_10001178 3300006163 Bacteria 7508
110 Ga0070716_100041743 3300006173 Bacteria 2557
111 Ga0070712_100029726 3300006175 Bacteria 3665
112 Ga0070712_100942637 3300006175 Bacteria 745
113 Ga0097621_100739601 3300006237 Bacteria 908
114 Ga0068871_100162195 3300006358 Bacteria 1912
115 Ga0075428_100001593 3300006844 Bacteria 24255
116 Ga0075428_100206539 3300006844 Bacteria 2123
117 Ga0075428_100229808 3300006844 Bacteria 2002
118 Ga0075428_100382211 3300006844 Bacteria 1509
119 Ga0075428_100500271 3300006844 Bacteria 1300
120 Ga0075430_100032871 3300006846 Bacteria 4403
121 Ga0075430_100375172 3300006846 Bacteria 1174
122 Ga0075431_100162719 3300006847 Bacteria 2294
123 Ga0075431_100488740 3300006847 Bacteria 1223
124 Ga0075433_10116251 3300006852 Bacteria 2373
125 Ga0075433_10203761 3300006852 Bacteria 1759
126 Ga0075433_10321164 3300006852 Bacteria 1370
127 Ga0075433_10495187 3300006852 Bacteria 1076
128 Ga0075434_100157152 3300006871 Bacteria 2293
129 Ga0075434_100331639 3300006871 Bacteria 1542
130 Ga0075434_100627193 3300006871 Bacteria 1094
131 Ga0075429_100048775 3300006880 Bacteria 3682
132 Ga0075429_100368976 3300006880 Bacteria 1257
133 Ga0068865_100008938 3300006881 Bacteria 6199
134 Ga0075435_100085601 3300007076 Bacteria 2595
135 Ga0075435_100086158 3300007076 Bacteria 2586
136 Ga0075435_100101240 3300007076 Bacteria 2387
137 Ga0105250_10094105 3300009092 Bacteria 1221
138 Ga0105240_10170198 3300009093 Bacteria 2581
139 Ga0105240_11290606 3300009093 Bacteria 770
140 Ga0105240_12102069 3300009093 Bacteria 586
141 Ga0111539_10187041 3300009094 Bacteria 2418
142 Ga0111539_10297333 3300009094 Bacteria 1879
143 Ga0111539_10397129 3300009094 Bacteria 1606
144 Ga0111539_10528664 3300009094 Bacteria 1374
145 Ga0111539_10640642 3300009094 Bacteria 1238
146 Ga0111539_12927553 3300009094 Bacteria 552
147 Ga0105245_10017950 3300009098 Bacteria 6179
148 Ga0105245_10022625 3300009098 Bacteria 5518
149 Ga0105245_10149154 3300009098 Bacteria 2210
150 Ga0105245_10724411 3300009098 Bacteria 1029
151 Ga0105247_10420855 3300009101 Bacteria 956
152 Ga0114129_10015135 3300009147 Bacteria 10979
153 Ga0114129_10057375 3300009147 Bacteria 5449
154 Ga0114129_10117145 3300009147 Bacteria 3671
155 Ga0114129_10311272 3300009147 Bacteria 2096
156 Ga0114129_10725377 3300009147 Bacteria 1275
157 Ga0114129_11648562 3300009147 Bacteria 784
158 Ga0114129_12748472 3300009147 Bacteria 586
159 Ga0105243_10034643 3300009148 Bacteria 3910
160 Ga0105243_10065198 3300009148 Bacteria 2925
161 Ga0105243_10066701 3300009148 Bacteria 2895
162 Ga0105243_10502910 3300009148 Bacteria 1149
163 Ga0105243_11373590 3300009148 Bacteria 726
164 Ga0105241_10042890 3300009174 Bacteria 3425
165 Ga0105241_10510505 3300009174 Bacteria 1073
166 Ga0105242_10242478 3300009176 Bacteria 1621
167 Ga0105242_10959849 3300009176 Bacteria 860
168 Ga0105242_11054320 3300009176 Bacteria 824
169 Ga0105248_10175944 3300009177 Bacteria 2412
170 Ga0105248_10389205 3300009177 Bacteria 1570
171 Ga0105248_11340796 3300009177 Bacteria 809
172 Ga0105237_10425164 3300009545 Bacteria 1334
173 Ga0105238_10515923 3300009551 Bacteria 1197
174 Ga0105238_11743223 3300009551 Bacteria 654
175 Ga0105249_10013812 3300009553 Bacteria 7136
176 Ga0105249_10117370 3300009553 Bacteria 2524
177 Ga0105239_10037996 3300010375 Bacteria 5276
178 Ga0105239_10178693 3300010375 Bacteria 2374
179 Ga0105239_10574805 3300010375 Bacteria 1284
180 Ga0105239_10617444 3300010375 Bacteria 1237
181 Ga0105239_11595200 3300010375 Bacteria 755
182 Ga0105246_10053206 3300011119 Bacteria 2785
183 Ga0157341_1011297 3300012494 Bacteria 771
184 Ga0157342_1000270 3300012507 Bacteria 2904
185 Ga0157373_10020182 3300013100 Bacteria 4847
186 Ga0157373_10219963 3300013100 Bacteria 1340
187 Ga0157371_10182566 3300013102 Bacteria 1501
188 Ga0157369_10456603 3300013105 Bacteria 1323
189 Ga0157374_10436140 3300013296 Bacteria 1310
190 Ga0157374_10457349 3300013296 Bacteria 1278
191 Ga0157378_10173988 3300013297 Bacteria 2021
192 Ga0157378_10667399 3300013297 Bacteria 1057
193 Ga0163162_10028521 3300013306 Bacteria 5524
194 Ga0157372_10614588 3300013307 Bacteria 1267
195 Ga0157372_11580435 3300013307 Bacteria 755
196 Ga0157375_10097561 3300013308 Bacteria 3014
197 Ga0157375_10575665 3300013308 Bacteria 1286
198 Ga0157375_11085653 3300013308 Bacteria 936
199 Ga0157375_11939021 3300013308 Bacteria 700
200 Ga0163163_10008456 3300014325 Bacteria 9146
201 Ga0163163_10214949 3300014325 Bacteria 1972
202 Ga0157380_10208951 3300014326 Bacteria 1738
203 Ga0157380_10899353 3300014326 Bacteria 911
204 Ga0157380_11167239 3300014326 Bacteria 812
205 Ga0157377_10419705 3300014745 Bacteria 916
206 Ga0157376_10114798 3300014969 Bacteria 2376
207 Ga0157376_10251140 3300014969 Bacteria 1652
208 Ga0157376_11341003 3300014969 Bacteria 746
209 Ga0163161_10033749 3300017792 Bacteria 3657
210 Ga0163161_10915832 3300017792 Bacteria 744
211 Ga0207642_10315477 3300025899 Bacteria 911
212 Ga0207688_10374761 3300025901 Bacteria 880
213 Ga0207647_10212274 3300025904 Bacteria 1117
214 Ga0207685_10020731 3300025905 Bacteria 2190
215 Ga0207685_10645979 3300025905 Bacteria 572
216 Ga0207699_10167213 3300025906 Bacteria 1469
217 Ga0207699_10335890 3300025906 Bacteria 1063
218 Ga0207699_10677413 3300025906 Bacteria 754
219 Ga0207645_10230647 3300025907 Bacteria 1222
220 Ga0207684_10162337 3300025910 Bacteria 1924
221 Ga0207654_10071489 3300025911 Bacteria 2063
222 Ga0207693_10035327 3300025915 Bacteria 3941
223 Ga0207693_10035435 3300025915 Bacteria 3935
224 Ga0207663_10016959 3300025916 Bacteria 4049
225 Ga0207663_10061493 3300025916 Bacteria 2383
226 Ga0207663_10178383 3300025916 Bacteria 1515
227 Ga0207662_10065156 3300025918 Bacteria 2194
228 Ga0207657_10041998 3300025919 Bacteria 4038
229 Ga0207649_11179002 3300025920 Bacteria 605
230 Ga0207652_10095362 3300025921 Bacteria 2620
231 Ga0207681_10173579 3300025923 Bacteria 1636
232 Ga0207681_10926447 3300025923 Bacteria 730
233 Ga0207650_11052633 3300025925 Bacteria 692
234 Ga0207687_10020549 3300025927 Bacteria 4381
235 Ga0207687_10043574 3300025927 Bacteria 3093
236 Ga0207687_10090885 3300025927 Bacteria 2226
237 Ga0207687_10153985 3300025927 Bacteria 1757
238 Ga0207700_10215706 3300025928 Bacteria 1624
239 Ga0207700_10548358 3300025928 Bacteria 1026
240 Ga0207700_10905293 3300025928 Bacteria 789
241 Ga0207664_10016122 3300025929 Bacteria 5444
242 Ga0207664_10177447 3300025929 Bacteria 1827
243 Ga0207644_10027581 3300025931 Bacteria 3925
244 Ga0207644_10360065 3300025931 Bacteria 1183
245 Ga0207706_10008012 3300025933 Bacteria 9751
246 Ga0207706_10019932 3300025933 Bacteria 6028
247 Ga0207706_10080270 3300025933 Bacteria 2868
248 Ga0207706_10203018 3300025933 Bacteria 1738
249 Ga0207686_10207222 3300025934 Bacteria 1408
250 Ga0207686_10536912 3300025934 Bacteria 912
251 Ga0207709_10229256 3300025935 Bacteria 1345
252 Ga0207669_10017321 3300025937 Bacteria 3692
253 Ga0207669_10533464 3300025937 Bacteria 944
254 Ga0207704_10290615 3300025938 Bacteria 1247
255 Ga0207704_10394074 3300025938 Bacteria 1091
256 Ga0207665_10006983 3300025939 Bacteria 7472
257 Ga0207691_10193540 3300025940 Bacteria 1773
258 Ga0207661_10034633 3300025944 Bacteria 3929
259 Ga0207679_10568144 3300025945 Bacteria 1019
260 Ga0207651_10377329 3300025960 Bacteria 1201
261 Ga0207651_10575271 3300025960 Bacteria 982
262 Ga0207651_10657851 3300025960 Bacteria 920
263 Ga0207712_10067741 3300025961 Bacteria 2556
264 Ga0207712_10169852 3300025961 Bacteria 1703
265 Ga0207668_10004402 3300025972 Bacteria 8274
266 Ga0207668_11343085 3300025972 Bacteria 644
267 Ga0207640_10105951 3300025981 Bacteria 1982
268 Ga0207677_10379890 3300026023 Bacteria 1192
269 Ga0207677_10437493 3300026023 Bacteria 1118
270 Ga0207678_10129262 3300026067 Bacteria 2154
271 Ga0207708_10004374 3300026075 Bacteria 10410
272 Ga0207702_10009726 3300026078 Bacteria 8076
273 Ga0207702_10084216 3300026078 Bacteria 2768
274 Ga0207702_11639783 3300026078 Bacteria 636
275 Ga0207641_10470832 3300026088 Bacteria 1217
276 Ga0207648_10013296 3300026089 Bacteria 7666
277 Ga0207648_10152368 3300026089 Bacteria 2040
278 Ga0207648_10259553 3300026089 Bacteria 1550
279 Ga0207676_10789883 3300026095 Bacteria 925
280 Ga0207674_10011255 3300026116 Bacteria 10057
281 Ga0207675_100000913 3300026118 Bacteria 29474
282 Ga0207675_100043372 3300026118 Bacteria 4200
283 Ga0207675_100465796 3300026118 Bacteria 1254
284 Ga0207683_10000626 3300026121 Bacteria 32385
285 Ga0207683_10054538 3300026121 Bacteria 3505
286 Ga0207683_10425824 3300026121 Bacteria 1223
287 Ga0209966_1023460 3300027695 Bacteria 1213
288 Ga0209974_10247879 3300027876 Bacteria 669
289 Ga0207428_10003755 3300027907 Bacteria 14580
290 Ga0207428_10231458 3300027907 Bacteria 1383
291 Ga0307408_100066364 3300031548 Bacteria 2650
292 Ga0307413_10059138 3300031824 Bacteria 2353
293 Ga0307410_10039370 3300031852 Bacteria 3103
294 Ga0307410_10420580 3300031852 Bacteria 1084
295 Ga0307407_10111105 3300031903 Bacteria 1720
296 Ga0307412_10027022 3300031911 Bacteria 3574
297 Ga0307416_100253679 3300032002 Bacteria 1714
298 Ga0307416_100394210 3300032002 Bacteria 1419
299 Ga0307416_102201915 3300032002 Bacteria 652
300 Ga0307415_100302507 3300032126 Bacteria 1325
301 Ga0373930_0060512 3300034816 Bacteria 844
302 Ga0373948_0004859 3300034817 Bacteria 2148
303 Ga0373950_0140280 3300034818 Bacteria 547
304 Ga0373958_0151960 3300034819 Bacteria 580
305 Ga0373959_0033447 3300034820 Bacteria 1049
306 Ga0373938_0045347 3300034957 Bacteria 989
307 Ga0373944_0026194 3300035089 Bacteria 1721
308 Ga0373952_0011758 3300035092 Bacteria 1712
309 Ga0373939_0067474 3300035114 Bacteria 1156
310 Ga0373945_0001474 3300035116 Bacteria 7190
311 Ga0373956_0204759 3300035119 Bacteria 936
312 Ga0373960_0019823 3300035121 Bacteria 1771
313 Ga0373960_0094735 3300035121 Bacteria 960
314 Ga0373943_0015075 3300035170 Bacteria 3509
315 Ga0373943_0209481 3300035170 Bacteria 1082
316 Ga0373943_0428946 3300035170 Bacteria 766
317 Ga0373943_0478523 3300035170 Bacteria 726
318 Ga0373946_0631405 3300035171 Archaea 557
319 Ga0373961_0026166 3300035241 Bacteria 1592
320 Ga0373962_0019718 3300035242 Bacteria 1766
321 Ga0373962_0117339 3300035242 Bacteria 845
322 Ga0373931_0024664 3300035691 Bacteria 3049
323 Ga0373931_0053632 3300035691 Bacteria 2152
324 Ga0373927_0481858 3300035695 Bacteria 820
325 Ga0373947_0021881 3300035725 Bacteria 3705
326 Ga0373947_0162284 3300035725 Bacteria 1446
327 Ga0373937_0572590 3300036401 Bacteria 1073
328 Ga0373925_0011304 3300037068 Bacteria 6477
329 Ga0373925_0200907 3300037068 Bacteria 1585
330 Ga0373925_0388034 3300037068 Unclassified 1138
331 Ga0395899_0002231 3300037312 Bacteria 15875
332 Ga0395899_0013460 3300037312 Bacteria 6256
333 Ga0395899_0017949 3300037312 Bacteria 5384
334 Ga0395899_0020886 3300037312 Bacteria 4965
335 Ga0395899_0086100 3300037312 Bacteria 2283
336 Ga0395899_0135136 3300037312 Bacteria 1758
337 Ga0395899_0135739 3300037312 Bacteria 1754
338 Ga0395899_0156689 3300037312 Bacteria 1611
339 Ga0395899_0573466 3300037312 Bacteria 722
340 Ga0395900_0005039 3300037418 Bacteria 13865
341 Ga0395900_0016906 3300037418 Bacteria 7446
342 Ga0395900_0025474 3300037418 Bacteria 6055
343 Ga0395900_0031286 3300037418 Bacteria 5466
344 Ga0395900_0062293 3300037418 Bacteria 3834
345 Ga0395900_0076257 3300037418 Bacteria 3446
346 Ga0395900_0160369 3300037418 Bacteria 2294
347 Ga0395900_0184594 3300037418 Bacteria 2117
348 Ga0395900_0287272 3300037418 Bacteria 1635
349 Ga0395900_0487739 3300037418 Bacteria 1184
350 Ga0395898_0007564 3300037466 Bacteria 11531
351 Ga0395898_0012453 3300037466 Bacteria 8793
352 Ga0395898_0020414 3300037466 Bacteria 6727
353 Ga0395898_0020929 3300037466 Bacteria 6639
354 Ga0395898_0054569 3300037466 Bacteria 3899
355 Ga0395898_0171864 3300037466 Bacteria 2071
356 Ga0395898_0328377 3300037466 Bacteria 1459
357 Ga0395898_0492577 3300037466 Bacteria 1166
358 Ga0395898_0525055 3300037466 Bacteria 1125
359 Ga0395898_0566405 3300037466 Bacteria 1078
360 Ga0395905_0008121 3300037471 Bacteria 10371
361 Ga0395905_0013654 3300037471 Bacteria 7780
362 Ga0395905_0021885 3300037471 Bacteria 6046
363 Ga0395905_0028429 3300037471 Bacteria 5271
364 Ga0395905_0054704 3300037471 Bacteria 3735
365 Ga0395905_0057239 3300037471 Bacteria 3647
366 Ga0395905_0156721 3300037471 Bacteria 2142
367 Ga0395905_0391842 3300037471 Bacteria 1283
368 Ga0395905_0657559 3300037471 Bacteria 950
369 Ga0395901_0030335 3300038443 Bacteria 5570
370 Ga0395901_0045321 3300038443 Bacteria 4563
371 Ga0395901_0049742 3300038443 Bacteria 4355
372 Ga0395901_0069638 3300038443 Bacteria 3664
373 Ga0395901_0078528 3300038443 Bacteria 3446
374 Ga0395901_0090168 3300038443 Bacteria 3209
375 Ga0395901_0197312 3300038443 Bacteria 2110
376 Ga0395901_0204260 3300038443 Bacteria 2070
377 Ga0395901_0285998 3300038443 Bacteria 1712
378 Ga0395901_0331838 3300038443 Bacteria 1572
379 Ga0395901_0403504 3300038443 Bacteria 1404
380 Ga0395901_0438860 3300038443 Bacteria 1337
381 Ga0395901_0453131 3300038443 Bacteria 1312
382 Ga0395901_0617372 3300038443 Bacteria 1091
383 Ga0395901_0637461 3300038443 Bacteria 1070
384 Ga0395901_0764910 3300038443 Bacteria 958
385 Ga0395901_1856037 3300038443 Bacteria 551
386 Ga0242420_051978 3300038996 Bacteria 803
387 Ga0451807_0266489 3300041486 Bacteria 1159
388 Ga0451855_1203666 3300041511 Bacteria 757
389 Ga0451853_1542749 3300041512 Bacteria 1009
390 Ga0439448_0027734 3300042005 Bacteria 1786
391 Ga0439448_0155315 3300042005 Bacteria 795
392 Ga0439458_0037321 3300042157 Bacteria 1171
393 Ga0466964_0085815 3300044706 Bacteria 1360
394 Ga0466964_0224908 3300044706 Bacteria 913
395 Ga0451576_0070035 3300045051 Bacteria 3650
396 Ga0466967_0013205 3300045976 Bacteria 6369
397 Ga0466967_0094238 3300045976 Bacteria 2726
398 Ga0495592_0199485 3300046454 Bacteria 1351
399 Ga0495603_0003409 3300046455 Bacteria 9462
400 Ga0495603_0019238 3300046455 Bacteria 4134
401 Ga0495603_0119620 3300046455 Bacteria 1535
402 Ga0495641_0001038 3300046461 Bacteria 23885
403 Ga0495641_0026985 3300046461 Bacteria 2797
404 Ga0495641_0030587 3300046461 Bacteria 2580
405 Ga0495641_0232063 3300046461 Bacteria 828
406 Ga0495651_0715719 3300046462 Bacteria 623
407 Ga0495580_0065763 3300046472 Bacteria 2539
408 Ga0495582_0005453 3300046473 Bacteria 7094
409 Ga0495582_0026667 3300046473 Bacteria 3167
410 Ga0495582_0042154 3300046473 Bacteria 2515
411 Ga0495582_0248780 3300046473 Bacteria 1019
412 Ga0495582_0263571 3300046473 Bacteria 988
413 Ga0495582_0298475 3300046473 Bacteria 926
414 Ga0495605_0030298 3300046474 Bacteria 2776
415 Ga0495639_0132547 3300046475 Bacteria 1194
416 Ga0495584_0126291 3300046491 Bacteria 1297
417 Ga0495584_0625486 3300046491 Bacteria 549
418 Ga0495585_0157184 3300046492 Bacteria 1182
419 Ga0495585_0230556 3300046492 Bacteria 931
420 Ga0495594_0000335 3300046499 Bacteria 23428
421 Ga0495607_0283280 3300046501 Bacteria 786
422 Ga0495583_0106484 3300046506 Bacteria 1192
423 Ga0495630_0014685 3300046517 Bacteria 5710
424 Ga0495630_0429723 3300046517 Bacteria 1012
425 Ga0495631_0390677 3300046518 Bacteria 592
426 Ga0495637_0220714 3300046520 Bacteria 690
427 Ga0495663_0119660 3300046525 Bacteria 881
428 Ga0495663_0169657 3300046525 Bacteria 752
429 Ga0495663_0190291 3300046525 Bacteria 713
430 Ga0495642_0143615 3300046528 Bacteria 1031
431 Ga0495652_0237551 3300046529 Bacteria 1359
432 Ga0495665_0030829 3300046531 Bacteria 2869
433 Ga0495640_0097263 3300046533 Bacteria 1936
434 Ga0495667_0074632 3300046559 Bacteria 2208
435 Ga0495656_0139021 3300046615 Bacteria 1163
436 Ga0495656_0635933 3300046615 Bacteria 572
437 Ga0495588_0001807 3300046674 Bacteria 9121
438 Ga0495599_0236367 3300046678 Bacteria 1115
439 Ga0495646_0626272 3300046680 Bacteria 545
440 Ga0495647_0007861 3300046681 Bacteria 3581
441 Ga0495647_0141007 3300046681 Bacteria 1028
442 Ga0495658_0010122 3300046683 Bacteria 4712
443 Ga0495658_0058534 3300046683 Bacteria 2204
444 Ga0495658_0756751 3300046683 Bacteria 622
445 Ga0495613_0027711 3300046689 Bacteria 4217
446 Ga0495613_0498647 3300046689 Bacteria 820
447 Ga0495624_0140727 3300046690 Unclassified 1478
448 Ga0495670_0092039 3300046691 Bacteria 1553
449 Ga0495589_0088493 3300046794 Bacteria 1504
450 Ga0495589_0267689 3300046794 Bacteria 796
451 Ga0495581_0002157 3300047315 Bacteria 11106
452 Ga0495581_0062252 3300047315 Bacteria 2156
453 Ga0495674_0823015 3300047319 Bacteria 721
454 Ga0495676_0013466 3300047321 Bacteria 7349
455 Ga0495676_0028678 3300047321 Bacteria 4750
456 Ga0495676_0048973 3300047321 Bacteria 3402
457 Ga0495676_0134533 3300047321 Bacteria 1780
458 Ga0495676_0963115 3300047321 Bacteria 545
459 Ga0495680_0382193 3300047322 Bacteria 975
460 Ga0495675_0823595 3300047444 Bacteria 512
461 Ga0495677_0124167 3300047445 Bacteria 986
462 Ga0495679_160343 3300047446 Bacteria 601
463 Ga0495684_0335246 3300047471 Bacteria 1078
464 Ga0495684_0750525 3300047471 Bacteria 642
465 Ga0495626_0278724 3300048091 Bacteria 665
466 Ga0496100_0177129 3300048903 Bacteria 1540
467 Ga0496100_0524552 3300048903 Bacteria 914
468 Ga0496100_0623522 3300048903 Bacteria 838
469 Ga0496100_1148270 3300048903 Bacteria 612
470 Ga0496101_0157344 3300048904 Bacteria 1741
471 Ga0496101_0178372 3300048904 Bacteria 1635
472 Ga0496102_0015057 3300048905 Bacteria 6732
473 Ga0496102_0055258 3300048905 Bacteria 3620
474 Ga0496103_0040829 3300048906 Bacteria 2851
475 Ga0496103_0096233 3300048906 Bacteria 1871
476 Ga0496104_0000772 3300048907 Bacteria 27396
477 Ga0496104_0007557 3300048907 Bacteria 9613
478 Ga0496104_0052321 3300048907 Bacteria 3857
479 Ga0496105_0000542 3300048908 Bacteria 24896
480 Ga0496105_0072837 3300048908 Bacteria 2838
481 Ga0496105_0077575 3300048908 Bacteria 2743
482 Ga0496105_0142981 3300048908 Bacteria 1969
483 Ga0496105_0436669 3300048908 Bacteria 1035
484 Ga0496106_0060727 3300048909 Bacteria 2866
485 Ga0496106_0949080 3300048909 Bacteria 678
486 Ga0496107_0026371 3300048910 Bacteria 4118
487 Ga0496107_0341842 3300048910 Bacteria 1113
488 Ga0496107_0391114 3300048910 Bacteria 1034
489 Ga0496107_0549708 3300048910 Bacteria 855
490 Ga0496107_0735324 3300048910 Bacteria 724
491 Ga0496108_0004136 3300048911 Bacteria 11664
492 Ga0496108_0005130 3300048911 Bacteria 10585
493 Ga0496108_0011514 3300048911 Bacteria 7189
494 Ga0496108_0578461 3300048911 Bacteria 979
495 Ga0496109_0004123 3300048912 Bacteria 12137
496 Ga0496109_0008161 3300048912 Bacteria 8880
497 Ga0496109_0014812 3300048912 Bacteria 6785
498 Ga0496109_0687854 3300048912 Bacteria 960
499 Ga0496109_0922409 3300048912 Bacteria 811
500 Ga0496109_1003453 3300048912 Bacteria 772
501 Ga0496110_0002626 3300048913 Bacteria 13533
502 Ga0496110_0003110 3300048913 Bacteria 12598
503 Ga0496110_0006858 3300048913 Bacteria 9052
504 Ga0496110_0063412 3300048913 Bacteria 3265
505 Ga0496110_0485646 3300048913 Bacteria 1125
506 Ga0496111_0003211 3300048914 Bacteria 10089
507 Ga0496111_0012472 3300048914 Bacteria 5755
508 Ga0496111_0019344 3300048914 Bacteria 4728
509 Ga0496111_0189320 3300048914 Bacteria 1530
510 Ga0496111_0259282 3300048914 Bacteria 1290
511 Ga0496111_0389582 3300048914 Bacteria 1030
512 Ga0496111_0948860 3300048914 Bacteria 618
513 Ga0496111_1055200 3300048914 Bacteria 581
514 Ga0496112_0040085 3300048915 Bacteria 4578
515 Ga0496112_0055298 3300048915 Bacteria 3902
516 Ga0496112_0108701 3300048915 Bacteria 2743
517 Ga0496112_0236102 3300048915 Bacteria 1782
518 Ga0496112_0472924 3300048915 Bacteria 1190
519 Ga0496112_0482704 3300048915 Bacteria 1176
520 Ga0496112_0636248 3300048915 Bacteria 997
521 Ga0496112_1251987 3300048915 Bacteria 658
522 Ga0496113_0003511 3300048916 Bacteria 9405
523 Ga0496113_0008566 3300048916 Bacteria 6671
524 Ga0496113_0098075 3300048916 Bacteria 2268
525 Ga0496114_0143343 3300048917 Bacteria 2070
526 Ga0496114_0212917 3300048917 Bacteria 1695
527 Ga0496114_0312320 3300048917 Bacteria 1388
528 Ga0496115_0020984 3300048918 Bacteria 5041
529 Ga0501032_0327016 3300049569 Bacteria 989
530 Ga0501038_1273249 3300049574 Bacteria 532
531 Ga0501040_0868171 3300049576 Bacteria 653
532 Ga0501041_0044670 3300049577 Bacteria 2693
533 Ga0501041_0627709 3300049577 Bacteria 686
534 Ga0501048_1310142 3300049582 Bacteria 521
535 Ga0501067_0014258 3300049583 Bacteria 4401
536 Ga0501067_0068115 3300049583 Bacteria 1970
537 Ga0501067_0566480 3300049583 Bacteria 636
538 Ga0501068_0203203 3300049584 Bacteria 1257
539 Ga0501069_0006339 3300049585 Bacteria 6183
540 Ga0501070_0100033 3300049586 Bacteria 2399
541 Ga0501071_1221390 3300049587 Bacteria 581
542 Ga0501072_0323573 3300049588 Bacteria 1225
543 Ga0501075_0086657 3300049591 Bacteria 2373
544 Ga0501075_0624288 3300049591 Bacteria 822
545 Ga0501077_0339093 3300049593 Bacteria 959
546 Ga0501077_0486387 3300049593 Bacteria 791
547 Ga0501217_183050 3300049661 Bacteria 644
548 Ga0501081_0971884 3300049743 Bacteria 641
549 Ga0501045_0222723 3300049824 Bacteria 1404
550 nmdc:mga05p37_10413_c1 3300050507 Bacteria 7784
551 nmdc:mga05p37_308233_c1 3300050507 Bacteria 1878
552 nmdc:mga05p37_377420_c1 3300050507 Bacteria 1662
553 nmdc:mga05p37_385928_c1 3300050507 Bacteria 1640
554 nmdc:mga05p37_44713_c1 3300050507 Bacteria 5448
555 nmdc:mga09592_394194_c1 3300050508 Bacteria 1197
556 nmdc:mga09592_449417_c1 3300050508 Bacteria 1112
557 nmdc:mga0qj67_143598_c1 3300050509 Bacteria 1935
558 nmdc:mga06r32_211251_c1 3300050510 Bacteria 1928
559 nmdc:mga08y16_233740_c1 3300050511 Bacteria 1901
560 nmdc:mga08y16_264377_c1 3300050511 Bacteria 1776
561 nmdc:mga08y16_3967_c1 3300050511 Bacteria 15416
562 nmdc:mga08y16_520639_c1 3300050511 Bacteria 1206
563 nmdc:mga0n895_1076154_c1 3300050512 Bacteria 782
564 nmdc:mga0n895_21569_c1 3300050512 Bacteria 6027
565 nmdc:mga0n895_51009_c1 3300050512 Bacteria 4058
566 nmdc:mga0n895_69449_c1 3300050512 Bacteria 3491
567 nmdc:mga0n895_861826_c1 3300050512 Bacteria 893
568 nmdc:mga0rr50_131748_c1 3300050513 Bacteria 2003
569 nmdc:mga0rr50_17069_c1 3300050513 Bacteria 4836
570 nmdc:mga0rr50_41457_c1 3300050513 Bacteria 3355
571 nmdc:mga08x19_335795_c1 3300050514 Bacteria 1053
572 nmdc:mga08x19_88024_c1 3300050514 Bacteria 2047
573 nmdc:mga0a205_129469_c1 3300050515 Bacteria 2425
574 nmdc:mga0a205_1322683_c1 3300050515 Bacteria 568
575 nmdc:mga0a205_154113_c1 3300050515 Bacteria 2196
576 nmdc:mga0a205_163016_c1 3300050515 Bacteria 2125
577 nmdc:mga0a205_241456_c1 3300050515 Bacteria 1687
578 nmdc:mga0a205_572458_c1 3300050515 Bacteria 984
579 nmdc:mga0a205_628214_c1 3300050515 Bacteria 926
580 nmdc:mga0a205_788798_c1 3300050515 Bacteria 798
581 Ga0495601_0020364 3300053077 Bacteria 4051
582 Ga0495601_0228999 3300053077 Bacteria 1214
583 Ga0495601_0328473 3300053077 Bacteria 996
584 Ga0495595_0073042 3300053084 Bacteria 1624
585 Ga0495619_0115924 3300053085 Bacteria 1833
586 Ga0501084_0130322 3300054114 Bacteria 2117
587 Ga0530510_0109283 3300061734 Bacteria 2024
588 Ga0530510_0183779 3300061734 Bacteria 1551
589 Ga0530510_0570897 3300061734 Bacteria 860
590 Ga0530510_1442066 3300061734 Bacteria 528
591 Ga0070708_100574080
592 JGI24738J21930_10065240
593 Ga0070683_100001516
594 Ga0070683_100007917
595 Ga0070683_100376993
596 Ga0070683_100741418
597 Ga0070690_100081063
598 Ga0070670_101142307
599 Ga0070680_100005813
600 Ga0070680_100173949
601 Ga0070682_100217587
602 Ga0068868_100065453
603 Ga0068868_100088992
604 Ga0070660_100015965
605 Ga0070691_10021850
606 Ga0070691_10039783
607 Ga0070692_10084571
608 Ga0070668_100001897
609 Ga0070668_100022054
610 Ga0070668_101035213
611 Ga0070669_100836792
612 Ga0070671_100124626
613 Ga0070671_101737296
614 Ga0070674_100048532
615 Ga0070674_100569485
616 Ga0070673_100488163
617 Ga0070703_10025976
618 Ga0070709_10038320
619 Ga0070714_100038774
620 Ga0070714_100058933
621 Ga0070713_100316843
622 Ga0070713_100862525
623 Ga0070710_10140116
624 Ga0070701_10120679
625 Ga0070711_100375081
626 Ga0070711_100493528
627 Ga0070705_100012844
628 Ga0070705_100094774
629 Ga0070678_100034499
630 Ga0070678_100058257
631 Ga0070678_100250934
632 Ga0070662_100017440
633 Ga0070662_100175470
634 Ga0070681_11048806
635 Ga0068867_100244821
636 Ga0068867_100261645
637 Ga0070685_10514802
638 Ga0070685_11360429
639 Ga0070706_100004250
640 Ga0070706_100054991
641 Ga0070706_100202169
642 Ga0070707_100120260
643 Ga0070698_100057209
644 Ga0070698_100393156
645 Ga0070699_100046359
646 Ga0070679_100104029
647 Ga0070684_100150601
648 Ga0070686_100030082
649 Ga0070686_100032945
650 Ga0070686_100313245
651 Ga0070695_100038132
652 Ga0070695_100111170
653 Ga0070695_100200186
654 Ga0070696_100037188
655 Ga0070696_100042301
656 Ga0070696_100188589
657 Ga0070693_100000955
658 Ga0070693_100007441
659 Ga0070693_100010299
660 Ga0070704_100058140
661 Ga0070704_100684813
662 Ga0068855_100069343
663 Ga0068855_100408531
664 Ga0070664_100610719
665 Ga0068857_100019226
666 Ga0068857_100236780
667 Ga0068854_100017986
668 Ga0068854_100925255
669 Ga0068856_100009373
670 Ga0068856_100161498
671 Ga0068856_100381180
672 Ga0068856_100478688
673 Ga0070702_100004649
674 Ga0070702_100186553
675 Ga0070702_101362140
676 Ga0068864_100282740
677 Ga0068866_10168088
678 Ga0068861_100002424
679 Ga0068861_100132517
680 Ga0068861_100275749
681 Ga0068860_100143821
682 Ga0068862_100097810
683 Ga0081455_10005540
684 Ga0081455_10021298
685 Ga0081455_10022045
686 Ga0081455_10213171
687 Ga0081455_10442688
688 Ga0081538_10012318
689 Ga0081540_1003067
690 Ga0081540_1004245
691 Ga0081540_1009431
692 Ga0081540_1012281
693 Ga0081539_10002640
694 Ga0081539_10047032
695 Ga0070717_10070065
696 Ga0070717_10137945
697 Ga0070717_10154396
698 Ga0075432_10006518
699 Ga0070715_10001178
700 Ga0070716_100041743
701 Ga0070712_100029726
702 Ga0070712_100942637
703 Ga0097621_100739601
704 Ga0068871_100162195
705 Ga0075428_100001593
706 Ga0075428_100206539
707 Ga0075428_100229808
708 Ga0075428_100382211
709 Ga0075428_100500271
710 Ga0075430_100032871
711 Ga0075430_100375172
712 Ga0075431_100162719
713 Ga0075431_100488740
714 Ga0075433_10116251
715 Ga0075433_10203761
716 Ga0075433_10321164
717 Ga0075433_10495187
718 Ga0075434_100157152
719 Ga0075434_100331639
720 Ga0075434_100627193
721 Ga0075429_100048775
722 Ga0075429_100368976
723 Ga0068865_100008938
724 Ga0075435_100085601
725 Ga0075435_100086158
726 Ga0075435_100101240
727 Ga0105250_10094105
728 Ga0105240_10170198
729 Ga0105240_11290606
730 Ga0105240_12102069
731 Ga0111539_10187041
732 Ga0111539_10297333
733 Ga0111539_10397129
734 Ga0111539_10528664
735 Ga0111539_10640642
736 Ga0111539_12927553
737 Ga0105245_10017950
738 Ga0105245_10022625
739 Ga0105245_10149154
740 Ga0105245_10724411
741 Ga0105247_10420855
742 Ga0114129_10015135
743 Ga0114129_10057375
744 Ga0114129_10117145
745 Ga0114129_10311272
746 Ga0114129_10725377
747 Ga0114129_11648562
748 Ga0114129_12748472
749 Ga0105243_10034643
750 Ga0105243_10065198
751 Ga0105243_10066701
752 Ga0105243_10502910
753 Ga0105243_11373590
754 Ga0105241_10042890
755 Ga0105241_10510505
756 Ga0105242_10242478
757 Ga0105242_10959849
758 Ga0105242_11054320
759 Ga0105248_10175944
760 Ga0105248_10389205
761 Ga0105248_11340796
762 Ga0105237_10425164
763 Ga0105238_10515923
764 Ga0105238_11743223
765 Ga0105249_10013812
766 Ga0105249_10117370
767 Ga0105239_10037996
768 Ga0105239_10178693
769 Ga0105239_10574805
770 Ga0105239_10617444
771 Ga0105239_11595200
772 Ga0105246_10053206
773 Ga0157341_1011297
774 Ga0157342_1000270
775 Ga0157373_10020182
776 Ga0157373_10219963
777 Ga0157371_10182566
778 Ga0157369_10456603
779 Ga0157374_10436140
780 Ga0157374_10457349
781 Ga0157378_10173988
782 Ga0157378_10667399
783 Ga0163162_10028521
784 Ga0157372_10614588
785 Ga0157372_11580435
786 Ga0157375_10097561
787 Ga0157375_10575665
788 Ga0157375_11085653
789 Ga0157375_11939021
790 Ga0163163_10008456
791 Ga0163163_10214949
792 Ga0157380_10208951
793 Ga0157380_10899353
794 Ga0157380_11167239
795 Ga0157377_10419705
796 Ga0157376_10114798
797 Ga0157376_10251140
798 Ga0157376_11341003
799 Ga0163161_10033749
800 Ga0163161_10915832
801 Ga0207642_10315477
802 Ga0207688_10374761
803 Ga0207647_10212274
804 Ga0207685_10020731
805 Ga0207685_10645979
806 Ga0207699_10167213
807 Ga0207699_10335890
808 Ga0207699_10677413
809 Ga0207645_10230647
810 Ga0207684_10162337
811 Ga0207654_10071489
812 Ga0207693_10035327
813 Ga0207693_10035435
814 Ga0207663_10016959
815 Ga0207663_10061493
816 Ga0207663_10178383
817 Ga0207662_10065156
818 Ga0207657_10041998
819 Ga0207649_11179002
820 Ga0207652_10095362
821 Ga0207681_10173579
822 Ga0207681_10926447
823 Ga0207650_11052633
824 Ga0207687_10020549
825 Ga0207687_10043574
826 Ga0207687_10090885
827 Ga0207687_10153985
828 Ga0207700_10215706
829 Ga0207700_10548358
830 Ga0207700_10905293
831 Ga0207664_10016122
832 Ga0207664_10177447
833 Ga0207644_10027581
834 Ga0207644_10360065
835 Ga0207706_10008012
836 Ga0207706_10019932
837 Ga0207706_10080270
838 Ga0207706_10203018
839 Ga0207686_10207222
840 Ga0207686_10536912
841 Ga0207709_10229256
842 Ga0207669_10017321
843 Ga0207669_10533464
844 Ga0207704_10290615
845 Ga0207704_10394074
846 Ga0207665_10006983
847 Ga0207691_10193540
848 Ga0207661_10034633
849 Ga0207679_10568144
850 Ga0207651_10377329
851 Ga0207651_10575271
852 Ga0207651_10657851
853 Ga0207712_10067741
854 Ga0207712_10169852
855 Ga0207668_10004402
856 Ga0207668_11343085
857 Ga0207640_10105951
858 Ga0207677_10379890
859 Ga0207677_10437493
860 Ga0207678_10129262
861 Ga0207708_10004374
862 Ga0207702_10009726
863 Ga0207702_10084216
864 Ga0207702_11639783
865 Ga0207641_10470832
866 Ga0207648_10013296
867 Ga0207648_10152368
868 Ga0207648_10259553
869 Ga0207676_10789883
870 Ga0207674_10011255
871 Ga0207675_100000913
872 Ga0207675_100043372
873 Ga0207675_100465796
874 Ga0207683_10000626
875 Ga0207683_10054538
876 Ga0207683_10425824
877 Ga0209966_1023460
878 Ga0209974_10247879
879 Ga0207428_10003755
880 Ga0207428_10231458
881 Ga0307408_100066364
882 Ga0307413_10059138
883 Ga0307410_10039370
884 Ga0307410_10420580
885 Ga0307407_10111105
886 Ga0307412_10027022
887 Ga0307416_100253679
888 Ga0307416_100394210
889 Ga0307416_102201915
890 Ga0307415_100302507
891 Ga0373930_0060512
892 Ga0373948_0004859
893 Ga0373950_0140280
894 Ga0373958_0151960
895 Ga0373959_0033447
896 Ga0373938_0045347
897 Ga0373944_0026194
898 Ga0373952_0011758
899 Ga0373939_0067474
900 Ga0373945_0001474
901 Ga0373956_0204759
902 Ga0373960_0019823
903 Ga0373960_0094735
904 Ga0373943_0015075
905 Ga0373943_0209481
906 Ga0373943_0428946
907 Ga0373943_0478523
908 Ga0373946_0631405
909 Ga0373961_0026166
910 Ga0373962_0019718
911 Ga0373962_0117339
912 Ga0373931_0024664
913 Ga0373931_0053632
914 Ga0373927_0481858
915 Ga0373947_0021881
916 Ga0373947_0162284
917 Ga0373937_0572590
918 Ga0373925_0011304
919 Ga0373925_0200907
920 Ga0373925_0388034
921 Ga0395899_0002231
922 Ga0395899_0013460
923 Ga0395899_0017949
924 Ga0395899_0020886
925 Ga0395899_0086100
926 Ga0395899_0135136
927 Ga0395899_0135739
928 Ga0395899_0156689
929 Ga0395899_0573466
930 Ga0395900_0005039
931 Ga0395900_0016906
932 Ga0395900_0025474
933 Ga0395900_0031286
934 Ga0395900_0062293
935 Ga0395900_0076257
936 Ga0395900_0160369
937 Ga0395900_0184594
938 Ga0395900_0287272
939 Ga0395900_0487739
940 Ga0395898_0007564
941 Ga0395898_0012453
942 Ga0395898_0020414
943 Ga0395898_0020929
944 Ga0395898_0054569
945 Ga0395898_0171864
946 Ga0395898_0328377
947 Ga0395898_0492577
948 Ga0395898_0525055
949 Ga0395898_0566405
950 Ga0395905_0008121
951 Ga0395905_0013654
952 Ga0395905_0021885
953 Ga0395905_0028429
954 Ga0395905_0054704
955 Ga0395905_0057239
956 Ga0395905_0156721
957 Ga0395905_0391842
958 Ga0395905_0657559
959 Ga0395901_0030335
960 Ga0395901_0045321
961 Ga0395901_0049742
962 Ga0395901_0069638
963 Ga0395901_0078528
964 Ga0395901_0090168
965 Ga0395901_0197312
966 Ga0395901_0204260
967 Ga0395901_0285998
968 Ga0395901_0331838
969 Ga0395901_0403504
970 Ga0395901_0438860
971 Ga0395901_0453131
972 Ga0395901_0617372
973 Ga0395901_0637461
974 Ga0395901_0764910
975 Ga0395901_1856037
976 Ga0242420_051978
977 Ga0451807_0266489
978 Ga0451855_1203666
979 Ga0451853_1542749
980 Ga0439448_0027734
981 Ga0439448_0155315
982 Ga0439458_0037321
983 Ga0466964_0085815
984 Ga0466964_0224908
985 Ga0451576_0070035
986 Ga0466967_0013205
987 Ga0466967_0094238
988 Ga0495592_0199485
989 Ga0495603_0003409
990 Ga0495603_0019238
991 Ga0495603_0119620
992 Ga0495641_0001038
993 Ga0495641_0026985
994 Ga0495641_0030587
995 Ga0495641_0232063
996 Ga0495651_0715719
997 Ga0495580_0065763
998 Ga0495582_0005453
999 Ga0495582_0026667
1000 Ga0495582_0042154
1001 Ga0495582_0248780
1002 Ga0495582_0263571
1003 Ga0495582_0298475
1004 Ga0495605_0030298
1005 Ga0495639_0132547
1006 Ga0495584_0126291
1007 Ga0495584_0625486
1008 Ga0495585_0157184
1009 Ga0495585_0230556
1010 Ga0495594_0000335
1011 Ga0495607_0283280
1012 Ga0495583_0106484
1013 Ga0495630_0014685
1014 Ga0495630_0429723
1015 Ga0495631_0390677
1016 Ga0495637_0220714
1017 Ga0495663_0119660
1018 Ga0495663_0169657
1019 Ga0495663_0190291
1020 Ga0495642_0143615
1021 Ga0495652_0237551
1022 Ga0495665_0030829
1023 Ga0495640_0097263
1024 Ga0495667_0074632
1025 Ga0495656_0139021
1026 Ga0495656_0635933
1027 Ga0495588_0001807
1028 Ga0495599_0236367
1029 Ga0495646_0626272
1030 Ga0495647_0007861
1031 Ga0495647_0141007
1032 Ga0495658_0010122
1033 Ga0495658_0058534
1034 Ga0495658_0756751
1035 Ga0495613_0027711
1036 Ga0495613_0498647
1037 Ga0495624_0140727
1038 Ga0495670_0092039
1039 Ga0495589_0088493
1040 Ga0495589_0267689
1041 Ga0495581_0002157
1042 Ga0495581_0062252
1043 Ga0495674_0823015
1044 Ga0495676_0013466
1045 Ga0495676_0028678
1046 Ga0495676_0048973
1047 Ga0495676_0134533
1048 Ga0495676_0963115
1049 Ga0495680_0382193
1050 Ga0495675_0823595
1051 Ga0495677_0124167
1052 Ga0495679_160343
1053 Ga0495684_0335246
1054 Ga0495684_0750525
1055 Ga0495626_0278724
1056 Ga0496100_0177129
1057 Ga0496100_0524552
1058 Ga0496100_0623522
1059 Ga0496100_1148270
1060 Ga0496101_0157344
1061 Ga0496101_0178372
1062 Ga0496102_0015057
1063 Ga0496102_0055258
1064 Ga0496103_0040829
1065 Ga0496103_0096233
1066 Ga0496104_0000772
1067 Ga0496104_0007557
1068 Ga0496104_0052321
1069 Ga0496105_0000542
1070 Ga0496105_0072837
1071 Ga0496105_0077575
1072 Ga0496105_0142981
1073 Ga0496105_0436669
1074 Ga0496106_0060727
1075 Ga0496106_0949080
1076 Ga0496107_0026371
1077 Ga0496107_0341842
1078 Ga0496107_0391114
1079 Ga0496107_0549708
1080 Ga0496107_0735324
1081 Ga0496108_0004136
1082 Ga0496108_0005130
1083 Ga0496108_0011514
1084 Ga0496108_0578461
1085 Ga0496109_0004123
1086 Ga0496109_0008161
1087 Ga0496109_0014812
1088 Ga0496109_0687854
1089 Ga0496109_0922409
1090 Ga0496109_1003453
1091 Ga0496110_0002626
1092 Ga0496110_0003110
1093 Ga0496110_0006858
1094 Ga0496110_0063412
1095 Ga0496110_0485646
1096 Ga0496111_0003211
1097 Ga0496111_0012472
1098 Ga0496111_0019344
1099 Ga0496111_0189320
1100 Ga0496111_0259282
1101 Ga0496111_0389582
1102 Ga0496111_0948860
1103 Ga0496111_1055200
1104 Ga0496112_0040085
1105 Ga0496112_0055298
1106 Ga0496112_0108701
1107 Ga0496112_0236102
1108 Ga0496112_0472924
1109 Ga0496112_0482704
1110 Ga0496112_0636248
1111 Ga0496112_1251987
1112 Ga0496113_0003511
1113 Ga0496113_0008566
1114 Ga0496113_0098075
1115 Ga0496114_0143343
1116 Ga0496114_0212917
1117 Ga0496114_0312320
1118 Ga0496115_0020984
1119 Ga0501032_0327016
1120 Ga0501038_1273249
1121 Ga0501040_0868171
1122 Ga0501041_0044670
1123 Ga0501041_0627709
1124 Ga0501048_1310142
1125 Ga0501067_0014258
1126 Ga0501067_0068115
1127 Ga0501067_0566480
1128 Ga0501068_0203203
1129 Ga0501069_0006339
1130 Ga0501070_0100033
1131 Ga0501071_1221390
1132 Ga0501072_0323573
1133 Ga0501075_0086657
1134 Ga0501075_0624288
1135 Ga0501077_0339093
1136 Ga0501077_0486387
1137 Ga0501217_183050
1138 Ga0501081_0971884
1139 Ga0501045_0222723
1140 nmdc:mga05p37_10413_c1
1141 nmdc:mga05p37_308233_c1
1142 nmdc:mga05p37_377420_c1
1143 nmdc:mga05p37_385928_c1
1144 nmdc:mga05p37_44713_c1
1145 nmdc:mga09592_394194_c1
1146 nmdc:mga09592_449417_c1
1147 nmdc:mga0qj67_143598_c1
1148 nmdc:mga06r32_211251_c1
1149 nmdc:mga08y16_233740_c1
1150 nmdc:mga08y16_264377_c1
1151 nmdc:mga08y16_3967_c1
1152 nmdc:mga08y16_520639_c1
1153 nmdc:mga0n895_1076154_c1
1154 nmdc:mga0n895_21569_c1
1155 nmdc:mga0n895_51009_c1
1156 nmdc:mga0n895_69449_c1
1157 nmdc:mga0n895_861826_c1
1158 nmdc:mga0rr50_131748_c1
1159 nmdc:mga0rr50_17069_c1
1160 nmdc:mga0rr50_41457_c1
1161 nmdc:mga08x19_335795_c1
1162 nmdc:mga08x19_88024_c1
1163 nmdc:mga0a205_129469_c1
1164 nmdc:mga0a205_1322683_c1
1165 nmdc:mga0a205_154113_c1
1166 nmdc:mga0a205_163016_c1
1167 nmdc:mga0a205_241456_c1
1168 nmdc:mga0a205_572458_c1
1169 nmdc:mga0a205_628214_c1
1170 nmdc:mga0a205_788798_c1
1171 Ga0495601_0020364
1172 Ga0495601_0228999
1173 Ga0495601_0328473
1174 Ga0495595_0073042
1175 Ga0495619_0115924
1176 Ga0501084_0130322
1177 Ga0530510_0109283
1178 Ga0530510_0183779
1179 Ga0530510_0570897
1180 Ga0530510_1442066

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00498

FHA

FHA domain

85

149

0.98

PF13240

zinc_ribbon_2

zinc-ribbon domain

5

27

0.96

PF16697

Yop-YscD_cpl

Inner membrane component of T3SS, cytoplasmic domain

69

158

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i2r-assembly1.cif.gz_D crystal structure of the suca domain of mycobacterium smegmatis kgd (alpha-ketoglutarate decarboxylase), mutant r802a, in complex with gara 0.9867 63 153
6i2p-assembly1.cif.gz_D crystal structure of the mycobacterium tuberculosis pknb kinase domain (l33e mutant) in complex with its substrate gara 0.9773 60 155
7rj3-assembly3.cif.gz_C crystal structure of the forkhead associated (fha) domain of the glycogen accumulation regulator (gara) from mycobacterium tuberculosis 0.9753 60 155
8p5r-assembly1.cif.gz_H crystal structure of full-length, homohexameric 2-oxoglutarate dehydrogenase kgd from mycobacterium smegmatis in complex with gara 0.9736 60 153
8p5x-assembly1.cif.gz_G single particle cryo-em structure of the complex between corynebacterium glutamicum homohexameric 2-oxoglutarate dehydrogenase odha and the fha-protein inhibitor odhi 0.9728 60 155
ID Description Score Start End Superfamily
6i2sB01 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9839 62 153 2.60.200.20
2ff4B03 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9541 61 153 2.60.200.20
3poaA00 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9533 60 155 2.60.200.20
6i2sB01 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9528 62 153 2.60.200.20
af_P9WJB5_49_154_2.60.200.20 Mainly Beta;Sandwich;Tumour Suppressor Smad4; 0.9381 62 151 2.60.200.20
ID Description Score Start End GO Terms
AF-A0A1V5Q940-F1-model_v4 Glycogen accumulation regulator GarA 0.9871 61 155 GO:0016020
AF-A0A3M1F670-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9855 61 155 GO:0000155
AF-A0A6I2ZW49-F1-model_v4 FHA domain-containing protein 0.9852 60 154
AF-A0A1F3SKH5-F1-model_v4 FHA domain-containing protein 0.9852 60 153
AF-A0A419EN77-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.9843 60 155 GO:0000155

Map