F466940

General Info

Members Datasets Scaffolds Average Seq Length
590 262 1180 207

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100426980|Ga0068868_1004269801
Length 235
Sequence MAKKEAPLDYLRQFIPDVSAPLVLEYLNHYKVHLTITRERKSVLGDYRHATHANNHRISVNGNLNKYSFLITLIHELAHLVTFMEHGNQVQSHGKEWKQVYRKMLEEFLRLKVFPEDILAALKKNLHDLPASSCADEHLMRILKKYDKNAGGLMLVEQIAEGASFLLDDGRVFRKGKKLRKRFQCVELSTGKLYLFSAIYEVKPIQEPLKAVRPGPKGPDRGGASARSSDEGLRH

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
151 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
167 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
168 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
173 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
174 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
175 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
182 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
183 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
190 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
193 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
196 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
228 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
229 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
230 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
237 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
243 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
244 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
245 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
246 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
251 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
252 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
253 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
254 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
255 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
256 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
257 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
258 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.92
Nodule 0
Rhizoplane 0.85
Rhizosphere 88.47
Stem 0
Stem Tuber 0
Unclassified 13.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100426980 3300005338 Unclassified 1148
2 JGI24751J29686_10002957 3300002459 Bacteria 3426
3 rootH1_10109431 3300003316 Unclassified 3770
4 rootH2_10003679 3300003320 Bacteria 27278
5 rootH2_10020680 3300003320 Bacteria 12087
6 rootH2_10072325 3300003320 Bacteria 1796
7 rootH2_10074128 3300003320 Bacteria 8913
8 rootL2_10107609 3300003322 Unclassified 1226
9 rootL2_10124109 3300003322 Unclassified 1141
10 rootL2_10136350 3300003322 Bacteria 1645
11 rootL2_10204225 3300003322 Bacteria 1412
12 rootH1_10110681 3300003323 Bacteria 2626
13 rootH1_10119412 3300003323 Bacteria 3958
14 Ga0070658_10001461 3300005327 Bacteria 20135
15 Ga0070676_10000153 3300005328 Bacteria 27368
16 Ga0070676_10179580 3300005328 Bacteria 1375
17 Ga0070683_100016609 3300005329 Bacteria 6496
18 Ga0070690_100020538 3300005330 Bacteria 4024
19 Ga0070670_100008495 3300005331 Bacteria 8759
20 Ga0070670_100067020 3300005331 Bacteria 3081
21 Ga0070670_100097778 3300005331 Bacteria 2525
22 Ga0070670_100390012 3300005331 Bacteria 1228
23 Ga0070670_100449897 3300005331 Bacteria 1141
24 Ga0068869_100005195 3300005334 Bacteria 8174
25 Ga0068869_100005944 3300005334 Bacteria 7712
26 Ga0068869_100041627 3300005334 Bacteria 3291
27 Ga0070666_10000074 3300005335 Bacteria 72739
28 Ga0070666_10000209 3300005335 Bacteria 40151
29 Ga0070666_10100142 3300005335 Bacteria 1996
30 Ga0070680_100000076 3300005336 Bacteria 53273
31 Ga0070682_100000717 3300005337 Bacteria 19844
32 Ga0068868_100001336 3300005338 Bacteria 17019
33 Ga0068868_100006670 3300005338 Bacteria 8192
34 Ga0068868_100051402 3300005338 Bacteria 3241
35 Ga0068868_100065934 3300005338 Bacteria 2878
36 Ga0070689_100106285 3300005340 Bacteria 2227
37 Ga0070691_10001594 3300005341 Bacteria 9806
38 Ga0070691_10023779 3300005341 Bacteria 2846
39 Ga0070691_10097560 3300005341 Bacteria 1456
40 Ga0070691_10134032 3300005341 Unclassified 1257
41 Ga0070687_100030823 3300005343 Bacteria 2625
42 Ga0070661_100138644 3300005344 Bacteria 1832
43 Ga0070661_100427580 3300005344 Bacteria 1050
44 Ga0070668_100000556 3300005347 Bacteria 24937
45 Ga0070669_100173835 3300005353 Bacteria 1681
46 Ga0070669_100857641 3300005353 Bacteria 774
47 Ga0070675_100008396 3300005354 Bacteria 8014
48 Ga0070675_100030472 3300005354 Bacteria 4356
49 Ga0070671_100032781 3300005355 Bacteria 4293
50 Ga0070671_100072503 3300005355 Bacteria 2876
51 Ga0070674_100030788 3300005356 Bacteria 3549
52 Ga0070674_100289624 3300005356 Bacteria 1301
53 Ga0070673_100000867 3300005364 Bacteria 17013
54 Ga0070673_100030743 3300005364 Bacteria 4024
55 Ga0070673_100034889 3300005364 Bacteria 3811
56 Ga0070673_100359145 3300005364 Bacteria 1295
57 Ga0070673_100807756 3300005364 Bacteria 866
58 Ga0070667_100000812 3300005367 Bacteria 29157
59 Ga0070667_100011346 3300005367 Bacteria 7367
60 Ga0070667_100024194 3300005367 Bacteria 5044
61 Ga0070667_100240218 3300005367 Bacteria 1617
62 Ga0070713_100211725 3300005436 Bacteria 1755
63 Ga0070701_10350731 3300005438 Bacteria 922
64 Ga0070663_100988873 3300005455 Unclassified 731
65 Ga0070678_100188922 3300005456 Bacteria 1692
66 Ga0070678_100236791 3300005456 Bacteria 1524
67 Ga0070662_100001017 3300005457 Bacteria 17158
68 Ga0070662_100288850 3300005457 Bacteria 1329
69 Ga0070681_10010611 3300005458 Bacteria 9102
70 Ga0068867_100001726 3300005459 Bacteria 15219
71 Ga0070685_10087676 3300005466 Bacteria 1878
72 Ga0070685_10250571 3300005466 Bacteria 1173
73 Ga0070685_10552019 3300005466 Unclassified 822
74 Ga0070698_100859695 3300005471 Unclassified 852
75 Ga0070679_100001661 3300005530 Bacteria 20056
76 Ga0070679_100466867 3300005530 Bacteria 1207
77 Ga0070684_100000495 3300005535 Bacteria 27122
78 Ga0068853_100003018 3300005539 Bacteria 12852
79 Ga0068853_100009002 3300005539 Bacteria 8041
80 Ga0068853_100041566 3300005539 Bacteria 3928
81 Ga0068853_100044583 3300005539 Bacteria 3797
82 Ga0068853_100314240 3300005539 Unclassified 1451
83 Ga0068853_100635602 3300005539 Bacteria 1015
84 Ga0070672_100000738 3300005543 Bacteria 19396
85 Ga0070672_100037754 3300005543 Bacteria 3686
86 Ga0070672_100216840 3300005543 Unclassified 1604
87 Ga0070686_100688350 3300005544 Bacteria 814
88 Ga0070665_100000001 3300005548 Bacteria 1083363
89 Ga0070665_100000486 3300005548 Bacteria 57134
90 Ga0070665_100135109 3300005548 Bacteria 2468
91 Ga0068855_100000089 3300005563 Bacteria 110845
92 Ga0068855_100015722 3300005563 Bacteria 9103
93 Ga0068855_100021118 3300005563 Bacteria 7807
94 Ga0068855_100037687 3300005563 Bacteria 5747
95 Ga0068855_100087390 3300005563 Bacteria 3603
96 Ga0068855_100606291 3300005563 Bacteria 1180
97 Ga0068855_100649447 3300005563 Unclassified 1133
98 Ga0070664_100003411 3300005564 Bacteria 12829
99 Ga0070664_100007338 3300005564 Bacteria 8885
100 Ga0070664_100023463 3300005564 Bacteria 5097
101 Ga0068857_100000416 3300005577 Bacteria 30150
102 Ga0068857_100028459 3300005577 Bacteria 4932
103 Ga0068857_100237949 3300005577 Bacteria 1666
104 Ga0068857_100272624 3300005577 Unclassified 1555
105 Ga0068856_100019180 3300005614 Bacteria 6640
106 Ga0068856_100032809 3300005614 Bacteria 5085
107 Ga0068856_100135432 3300005614 Bacteria 2468
108 Ga0070702_100031443 3300005615 Bacteria 2904
109 Ga0068852_100001789 3300005616 Bacteria 14595
110 Ga0068852_100020739 3300005616 Bacteria 5229
111 Ga0068852_100041015 3300005616 Bacteria 3909
112 Ga0068852_100120012 3300005616 Bacteria 2405
113 Ga0068852_100305751 3300005616 Bacteria 1540
114 Ga0068852_100468356 3300005616 Bacteria 1250
115 Ga0068852_100604334 3300005616 Bacteria 1101
116 Ga0068852_100844370 3300005616 Unclassified 931
117 Ga0068852_101177689 3300005616 Unclassified 787
118 Ga0068859_100000064 3300005617 Bacteria 104971
119 Ga0068859_100050734 3300005617 Bacteria 4168
120 Ga0068859_100251870 3300005617 Bacteria 1856
121 Ga0068859_100300907 3300005617 Bacteria 1697
122 Ga0068864_100002330 3300005618 Bacteria 15704
123 Ga0068864_100003479 3300005618 Bacteria 13008
124 Ga0068864_100039621 3300005618 Bacteria 4027
125 Ga0068864_100170306 3300005618 Bacteria 1985
126 Ga0068861_100011630 3300005719 Bacteria 6123
127 Ga0068851_10022342 3300005834 Bacteria 3080
128 Ga0068863_100000858 3300005841 Bacteria 30354
129 Ga0068863_100012459 3300005841 Bacteria 8209
130 Ga0068863_100024789 3300005841 Bacteria 5721
131 Ga0068863_100852885 3300005841 Bacteria 910
132 Ga0068858_100002789 3300005842 Bacteria 17554
133 Ga0068858_100661505 3300005842 Bacteria 1015
134 Ga0068860_100000046 3300005843 Bacteria 214800
135 Ga0068860_100007897 3300005843 Bacteria 10623
136 Ga0068860_100011746 3300005843 Bacteria 8629
137 Ga0068860_100012477 3300005843 Bacteria 8369
138 Ga0068860_100012918 3300005843 Bacteria 8203
139 Ga0068860_100015187 3300005843 Bacteria 7522
140 Ga0068860_100136613 3300005843 Bacteria 2355
141 Ga0068862_100167700 3300005844 Unclassified 1964
142 Ga0081540_1022784 3300005983 Bacteria 3689
143 Ga0075366_10185249 3300006195 Bacteria 1265
144 Ga0097621_100004653 3300006237 Bacteria 9582
145 Ga0097621_100019318 3300006237 Bacteria 5228
146 Ga0097621_100163339 3300006237 Unclassified 1915
147 Ga0097621_100190479 3300006237 Bacteria 1776
148 Ga0068871_100008209 3300006358 Bacteria 7499
149 Ga0068871_100011119 3300006358 Bacteria 6598
150 Ga0068871_100116764 3300006358 Unclassified 2250
151 Ga0068871_100387629 3300006358 Unclassified 1242
152 Ga0068871_100462975 3300006358 Unclassified 1138
153 Ga0068871_100664275 3300006358 Bacteria 952
154 Ga0068865_100016233 3300006881 Bacteria 4760
155 Ga0068865_100388273 3300006881 Bacteria 1140
156 Ga0097620_100000064 3300006931 Bacteria 104971
157 Ga0097620_100050731 3300006931 Bacteria 4168
158 Ga0097620_100251886 3300006931 Bacteria 1856
159 Ga0097620_100300914 3300006931 Bacteria 1697
160 Ga0105240_10000074 3300009093 Bacteria 199611
161 Ga0105240_10000598 3300009093 Bacteria 67006
162 Ga0105240_10000626 3300009093 Bacteria 65179
163 Ga0105240_10002252 3300009093 Bacteria 31329
164 Ga0105240_10002663 3300009093 Bacteria 28411
165 Ga0105240_10045603 3300009093 Bacteria 5559
166 Ga0105240_10087658 3300009093 Bacteria 3811
167 Ga0105240_10107501 3300009093 Bacteria 3382
168 Ga0105240_10241179 3300009093 Bacteria 2095
169 Ga0105240_10502159 3300009093 Bacteria 1348
170 Ga0105240_10652329 3300009093 Bacteria 1153
171 Ga0105240_10705661 3300009093 Unclassified 1101
172 Ga0105240_11206926 3300009093 Unclassified 801
173 Ga0111539_10019384 3300009094 Bacteria 8397
174 Ga0111539_10019555 3300009094 Bacteria 8355
175 Ga0105245_10199051 3300009098 Bacteria 1923
176 Ga0105245_10684098 3300009098 Bacteria 1058
177 Ga0105247_10028400 3300009101 Unclassified 3385
178 Ga0114129_10001869 3300009147 Bacteria 28696
179 Ga0105243_10135792 3300009148 Bacteria 2092
180 Ga0105241_10000224 3300009174 Bacteria 42685
181 Ga0105241_10000286 3300009174 Bacteria 37584
182 Ga0105241_10001283 3300009174 Bacteria 19188
183 Ga0105241_10131934 3300009174 Unclassified 2024
184 Ga0105241_10171658 3300009174 Bacteria 1791
185 Ga0105241_10194207 3300009174 Bacteria 1691
186 Ga0105241_10333532 3300009174 Bacteria 1312
187 Ga0105241_10488332 3300009174 Bacteria 1096
188 Ga0105242_10026095 3300009176 Bacteria 4629
189 Ga0105242_10195105 3300009176 Bacteria 1795
190 Ga0105248_10036285 3300009177 Bacteria 5514
191 Ga0105248_10341691 3300009177 Unclassified 1685
192 Ga0105237_10001565 3300009545 Bacteria 29826
193 Ga0105237_10002860 3300009545 Bacteria 20998
194 Ga0105237_10011674 3300009545 Bacteria 9296
195 Ga0105237_10029888 3300009545 Bacteria 5535
196 Ga0105237_10061220 3300009545 Bacteria 3764
197 Ga0105237_10092356 3300009545 Bacteria 3016
198 Ga0105237_10093460 3300009545 Bacteria 2996
199 Ga0105237_10121919 3300009545 Bacteria 2602
200 Ga0105238_10004027 3300009551 Bacteria 14580
201 Ga0105238_10043224 3300009551 Bacteria 4559
202 Ga0105238_10061333 3300009551 Unclassified 3763
203 Ga0105249_10004940 3300009553 Bacteria 11508
204 Ga0105249_10075570 3300009553 Bacteria 3121
205 Ga0105249_10586737 3300009553 Bacteria 1168
206 Ga0105239_10000048 3300010375 Bacteria 177855
207 Ga0105239_10000785 3300010375 Bacteria 45044
208 Ga0105239_10001973 3300010375 Bacteria 26693
209 Ga0105239_10002090 3300010375 Bacteria 25893
210 Ga0105239_10020299 3300010375 Bacteria 7329
211 Ga0105239_10029540 3300010375 Bacteria 6027
212 Ga0105239_10069892 3300010375 Bacteria 3856
213 Ga0105239_10901527 3300010375 Bacteria 1015
214 Ga0105239_11139023 3300010375 Unclassified 898
215 Ga0105246_10052134 3300011119 Bacteria 2811
216 Ga0105246_10126760 3300011119 Bacteria 1900
217 Ga0157371_10179444 3300013102 Bacteria 1514
218 Ga0157370_10001393 3300013104 Bacteria 29968
219 Ga0157370_10006375 3300013104 Bacteria 13020
220 Ga0157370_10012696 3300013104 Bacteria 8718
221 Ga0157369_10020756 3300013105 Bacteria 7343
222 Ga0157369_10043244 3300013105 Bacteria 4911
223 Ga0157369_10306893 3300013105 Bacteria 1650
224 Ga0157374_10000001 3300013296 Bacteria 1077351
225 Ga0157374_10000841 3300013296 Bacteria 26835
226 Ga0157374_10032047 3300013296 Bacteria 4783
227 Ga0157374_10032367 3300013296 Bacteria 4760
228 Ga0157374_10086125 3300013296 Bacteria 2988
229 Ga0157374_10448217 3300013296 Bacteria 1292
230 Ga0157374_10859032 3300013296 Bacteria 924
231 Ga0157378_10003436 3300013297 Bacteria 14052
232 Ga0157378_10009439 3300013297 Bacteria 8502
233 Ga0157378_10074449 3300013297 Bacteria 3056
234 Ga0157378_10239492 3300013297 Bacteria 1733
235 Ga0157378_10357675 3300013297 Bacteria 1428
236 Ga0163162_10000100 3300013306 Bacteria 78269
237 Ga0163162_10000190 3300013306 Bacteria 56892
238 Ga0163162_10004813 3300013306 Bacteria 13027
239 Ga0163162_10004838 3300013306 Bacteria 12998
240 Ga0163162_10023347 3300013306 Bacteria 6104
241 Ga0157372_10002055 3300013307 Bacteria 21888
242 Ga0157372_10004228 3300013307 Bacteria 15351
243 Ga0157372_10122684 3300013307 Bacteria 2986
244 Ga0157372_10166948 3300013307 Bacteria 2546
245 Ga0157372_10226026 3300013307 Bacteria 2170
246 Ga0157372_10279973 3300013307 Bacteria 1939
247 Ga0157372_10284341 3300013307 Bacteria 1923
248 Ga0157372_10378024 3300013307 Bacteria 1651
249 Ga0157372_11084510 3300013307 Bacteria 927
250 Ga0157372_11218690 3300013307 Bacteria 869
251 Ga0157375_10000057 3300013308 Bacteria 122654
252 Ga0157375_10514729 3300013308 Bacteria 1360
253 Ga0157375_10604520 3300013308 Bacteria 1255
254 Ga0157375_10740041 3300013308 Bacteria 1135
255 Ga0157375_11904272 3300013308 Bacteria 706
256 Ga0163163_10000254 3300014325 Bacteria 54049
257 Ga0163163_10005051 3300014325 Bacteria 11371
258 Ga0163163_10050798 3300014325 Bacteria 4085
259 Ga0163163_10153674 3300014325 Unclassified 2345
260 Ga0163163_10271475 3300014325 Bacteria 1747
261 Ga0163163_10317958 3300014325 Bacteria 1610
262 Ga0163163_11690078 3300014325 Unclassified 694
263 Ga0157380_10308871 3300014326 Bacteria 1460
264 Ga0157380_10354634 3300014326 Bacteria 1374
265 Ga0157380_10468554 3300014326 Bacteria 1215
266 Ga0157380_10473084 3300014326 Bacteria 1210
267 Ga0157380_11166912 3300014326 Bacteria 812
268 Ga0157377_10010308 3300014745 Bacteria 4619
269 Ga0157377_10045068 3300014745 Bacteria 2462
270 Ga0157377_10223269 3300014745 Unclassified 1207
271 Ga0157379_10000367 3300014968 Bacteria 36246
272 Ga0157379_10022101 3300014968 Bacteria 5637
273 Ga0157379_10355958 3300014968 Bacteria 1341
274 Ga0157376_10000135 3300014969 Bacteria 50667
275 Ga0157376_10000721 3300014969 Bacteria 21396
276 Ga0157376_10001835 3300014969 Bacteria 14153
277 Ga0157376_10168854 3300014969 Bacteria 1990
278 Ga0157376_10221346 3300014969 Bacteria 1753
279 Ga0157376_10288534 3300014969 Bacteria 1548
280 Ga0157376_10366121 3300014969 Bacteria 1384
281 Ga0163161_10028055 3300017792 Bacteria 3996
282 Ga0213876_10000584 3300021384 Bacteria 27185
283 Ga0209646_1003045 3300025246 Bacteria 3436
284 Ga0207656_10001696 3300025321 Bacteria 7317
285 Ga0207656_10122717 3300025321 Bacteria 1211
286 Ga0207682_10035070 3300025893 Bacteria 2025
287 Ga0207680_10000034 3300025903 Bacteria 74519
288 Ga0207680_10003138 3300025903 Bacteria 7759
289 Ga0207680_10060155 3300025903 Bacteria 2311
290 Ga0207647_10010415 3300025904 Bacteria 6566
291 Ga0207647_10031138 3300025904 Bacteria 3435
292 Ga0207647_10083179 3300025904 Unclassified 1917
293 Ga0207647_10105783 3300025904 Bacteria 1667
294 Ga0207645_10114173 3300025907 Bacteria 1750
295 Ga0207705_10102421 3300025909 Bacteria 2107
296 Ga0207705_10371010 3300025909 Bacteria 1105
297 Ga0207654_10000259 3300025911 Bacteria 32195
298 Ga0207654_10001139 3300025911 Bacteria 14349
299 Ga0207654_10001938 3300025911 Bacteria 10731
300 Ga0207654_10055778 3300025911 Unclassified 2289
301 Ga0207654_10180630 3300025911 Bacteria 1376
302 Ga0207654_10264253 3300025911 Unclassified 1158
303 Ga0207707_10000574 3300025912 Bacteria 37317
304 Ga0207695_10000071 3300025913 Bacteria 315568
305 Ga0207695_10000084 3300025913 Bacteria 282392
306 Ga0207695_10000323 3300025913 Bacteria 114265
307 Ga0207695_10002490 3300025913 Bacteria 27118
308 Ga0207695_10008950 3300025913 Bacteria 12463
309 Ga0207695_10011843 3300025913 Bacteria 10520
310 Ga0207695_10013620 3300025913 Bacteria 9683
311 Ga0207695_10056828 3300025913 Unclassified 4070
312 Ga0207695_10062793 3300025913 Unclassified 3832
313 Ga0207695_10263796 3300025913 Bacteria 1619
314 Ga0207695_10556019 3300025913 Bacteria 1029
315 Ga0207671_10001497 3300025914 Bacteria 26937
316 Ga0207671_10003026 3300025914 Bacteria 17227
317 Ga0207671_10014962 3300025914 Bacteria 6099
318 Ga0207671_10016015 3300025914 Bacteria 5844
319 Ga0207671_10033385 3300025914 Bacteria 3828
320 Ga0207671_10034358 3300025914 Bacteria 3768
321 Ga0207671_10065850 3300025914 Bacteria 2695
322 Ga0207660_10015280 3300025917 Bacteria 5064
323 Ga0207662_10060441 3300025918 Bacteria 2273
324 Ga0207649_10043912 3300025920 Bacteria 2735
325 Ga0207649_10083835 3300025920 Bacteria 2070
326 Ga0207652_10001002 3300025921 Bacteria 26045
327 Ga0207681_10119581 3300025923 Bacteria 1930
328 Ga0207681_10130910 3300025923 Bacteria 1855
329 Ga0207694_10002468 3300025924 Bacteria 15055
330 Ga0207694_10077298 3300025924 Bacteria 2608
331 Ga0207694_10185812 3300025924 Bacteria 1687
332 Ga0207650_10103691 3300025925 Bacteria 2193
333 Ga0207650_10124757 3300025925 Bacteria 2009
334 Ga0207650_10281047 3300025925 Bacteria 1355
335 Ga0207659_10127332 3300025926 Bacteria 1960
336 Ga0207659_10212000 3300025926 Bacteria 1553
337 Ga0207644_10548126 3300025931 Bacteria 957
338 Ga0207706_10041013 3300025933 Bacteria 4104
339 Ga0207706_10194362 3300025933 Bacteria 1780
340 Ga0207706_10245924 3300025933 Bacteria 1563
341 Ga0207686_10053654 3300025934 Unclassified 2521
342 Ga0207670_10126414 3300025936 Bacteria 1866
343 Ga0207669_10118403 3300025937 Unclassified 1792
344 Ga0207669_10241620 3300025937 Bacteria 1339
345 Ga0207704_10377978 3300025938 Bacteria 1111
346 Ga0207691_10002120 3300025940 Bacteria 19396
347 Ga0207691_10261109 3300025940 Bacteria 1493
348 Ga0207691_11013884 3300025940 Bacteria 692
349 Ga0207711_10401283 3300025941 Unclassified 1274
350 Ga0207689_10000835 3300025942 Bacteria 29733
351 Ga0207689_10056715 3300025942 Bacteria 3224
352 Ga0207689_10507115 3300025942 Unclassified 1011
353 Ga0207661_10018759 3300025944 Bacteria 5145
354 Ga0207661_10045478 3300025944 Bacteria 3475
355 Ga0207661_10989508 3300025944 Unclassified 775
356 Ga0207679_10005876 3300025945 Bacteria 7713
357 Ga0207679_10502587 3300025945 Bacteria 1082
358 Ga0207667_10000135 3300025949 Bacteria 111565
359 Ga0207667_10000177 3300025949 Bacteria 92852
360 Ga0207667_10027144 3300025949 Bacteria 6241
361 Ga0207667_10049014 3300025949 Bacteria 4463
362 Ga0207667_10154317 3300025949 Bacteria 2363
363 Ga0207667_10174910 3300025949 Bacteria 2206
364 Ga0207667_10488968 3300025949 Bacteria 1249
365 Ga0207651_10057961 3300025960 Bacteria 2674
366 Ga0207651_10154808 3300025960 Bacteria 1789
367 Ga0207651_10605799 3300025960 Unclassified 958
368 Ga0207712_10521950 3300025961 Bacteria 1018
369 Ga0207668_10001106 3300025972 Bacteria 16044
370 Ga0207668_10268256 3300025972 Unclassified 1394
371 Ga0207640_10018184 3300025981 Unclassified 4126
372 Ga0207658_10000847 3300025986 Bacteria 25559
373 Ga0207658_10050105 3300025986 Bacteria 3071
374 Ga0207658_10150587 3300025986 Unclassified 1895
375 Ga0207677_10002069 3300026023 Bacteria 10566
376 Ga0207677_10282537 3300026023 Bacteria 1363
377 Ga0207703_10005435 3300026035 Bacteria 10253
378 Ga0207703_10027567 3300026035 Bacteria 4473
379 Ga0207703_11229141 3300026035 Unclassified 720
380 Ga0207639_10001126 3300026041 Bacteria 18166
381 Ga0207639_10108934 3300026041 Unclassified 2253
382 Ga0207639_10436163 3300026041 Unclassified 1187
383 Ga0207639_10624048 3300026041 Bacteria 996
384 Ga0207708_10196430 3300026075 Bacteria 1608
385 Ga0207708_10580926 3300026075 Unclassified 947
386 Ga0207702_10015346 3300026078 Bacteria 6348
387 Ga0207702_10034469 3300026078 Bacteria 4232
388 Ga0207641_10000082 3300026088 Bacteria 138385
389 Ga0207641_10004489 3300026088 Bacteria 12072
390 Ga0207641_10018114 3300026088 Bacteria 5771
391 Ga0207641_10067188 3300026088 Bacteria 3071
392 Ga0207648_10006588 3300026089 Bacteria 11528
393 Ga0207648_10228812 3300026089 Bacteria 1654
394 Ga0207676_10003890 3300026095 Bacteria 10549
395 Ga0207676_10048772 3300026095 Bacteria 3289
396 Ga0207676_10146539 3300026095 Bacteria 2028
397 Ga0207674_10004100 3300026116 Bacteria 17648
398 Ga0207674_10017645 3300026116 Bacteria 7784
399 Ga0207674_10060265 3300026116 Bacteria 3838
400 Ga0207674_10162745 3300026116 Bacteria 2186
401 Ga0207675_100018238 3300026118 Bacteria 6543
402 Ga0207683_10363586 3300026121 Bacteria 1329
403 Ga0207683_10481148 3300026121 Bacteria 1146
404 Ga0207698_10003175 3300026142 Bacteria 9858
405 Ga0207698_10035724 3300026142 Bacteria 3639
406 Ga0207698_10072886 3300026142 Bacteria 2732
407 Ga0207698_10162986 3300026142 Bacteria 1953
408 Ga0207698_10204917 3300026142 Bacteria 1770
409 Ga0207698_10526679 3300026142 Bacteria 1154
410 Ga0207428_10383096 3300027907 Bacteria 1031
411 Ga0268266_10000049 3300028379 Bacteria 307763
412 Ga0268266_10052022 3300028379 Bacteria 3516
413 Ga0268264_10000041 3300028381 Bacteria 372501
414 Ga0268264_10007632 3300028381 Bacteria 9016
415 Ga0268264_10009632 3300028381 Bacteria 8003
416 Ga0268264_10010772 3300028381 Bacteria 7554
417 Ga0268264_10015145 3300028381 Bacteria 6325
418 Ga0268264_10022898 3300028381 Bacteria 5098
419 Ga0307517_10002048 3300028786 Bacteria 32795
420 Ga0307517_10111481 3300028786 Unclassified 2079
421 Ga0307515_10000412 3300028794 Bacteria 103361
422 Ga0307515_10287936 3300028794 Bacteria 1342
423 Ga0307511_10000042 3300030521 Bacteria 102114
424 Ga0265328_10065155 3300031239 Unclassified 1338
425 Ga0265331_10069401 3300031250 Unclassified 1651
426 Ga0265327_10019937 3300031251 Unclassified 4105
427 Ga0265327_10034648 3300031251 Bacteria 2799
428 Ga0265316_10174620 3300031344 Unclassified 1602
429 Ga0307513_10717081 3300031456 Unclassified 706
430 Ga0307509_10043286 3300031507 Bacteria 4873
431 Ga0307509_10089103 3300031507 Bacteria 3165
432 Ga0307509_10123637 3300031507 Unclassified 2559
433 Ga0265313_10018685 3300031595 Bacteria 3884
434 Ga0265313_10209541 3300031595 Bacteria 808
435 Ga0307508_10032628 3300031616 Bacteria 4704
436 Ga0265314_10026919 3300031711 Bacteria 4314
437 Ga0307516_10001770 3300031730 Bacteria 29691
438 Ga0307516_10392332 3300031730 Bacteria 1048
439 Ga0307414_10867993 3300032004 Bacteria 826
440 Ga0307415_100753825 3300032126 Unclassified 884
441 Ga0307510_10000091 3300033180 Bacteria 68694
442 Ga0307510_10212567 3300033180 Bacteria 1455
443 Ga0373923_0320373 3300035111 Bacteria 736
444 Ga0373953_0099937 3300035117 Bacteria 1220
445 Ga0373955_0004303 3300035172 Bacteria 6290
446 Ga0373933_0384958 3300035724 Bacteria 914
447 Ga0373937_0077855 3300036401 Bacteria 3064
448 Ga0373937_0334704 3300036401 Bacteria 1433
449 Ga0373937_0834719 3300036401 Unclassified 870
450 Ga0373925_0106299 3300037068 Bacteria 2164
451 Ga0436365_0012565 3300039437 Bacteria 1000
452 Ga0436365_0585774 3300039437 Bacteria 54587
453 Ga0436365_1500732 3300039437 Bacteria 3172
454 Ga0439439_0008322 3300041406 Bacteria 2448
455 Ga0451807_2736319 3300041486 Bacteria 718
456 Ga0451839_0130283 3300041496 Bacteria 750
457 Ga0451849_0977074 3300041505 Bacteria 2242
458 Ga0451853_3257709 3300041512 Bacteria 1022
459 Ga0439448_0119532 3300042005 Bacteria 904
460 Ga0439449_0023445 3300042007 Unclassified 2308
461 Ga0439449_0068874 3300042007 Bacteria 1304
462 Ga0439457_000387 3300042014 Bacteria 12448
463 Ga0439462_0001399 3300042015 Bacteria 5350
464 Ga0451577_0015230 3300042876 Bacteria 7155
465 Ga0466969_0000238 3300044656 Bacteria 30098
466 Ga0466972_0000003 3300044658 Bacteria 391452
467 Ga0466972_0000039 3300044658 Bacteria 135618
468 Ga0466972_0008991 3300044658 Bacteria 5015
469 Ga0466972_0010280 3300044658 Bacteria 4700
470 Ga0466966_0000136 3300044684 Bacteria 47038
471 Ga0466961_0022937 3300044693 Unclassified 4015
472 Ga0466964_0030938 3300044706 Unclassified 2121
473 Ga0466964_0255969 3300044706 Bacteria 865
474 Ga0466968_0106664 3300044735 Unclassified 1256
475 Ga0466970_0000460 3300044765 Bacteria 20110
476 Ga0466957_0001467 3300044842 Bacteria 12361
477 Ga0466957_0017717 3300044842 Bacteria 4177
478 Ga0466957_0119980 3300044842 Unclassified 1676
479 Ga0466960_0073614 3300044901 Bacteria 1705
480 Ga0466959_0000002 3300045049 Bacteria 362671
481 Ga0466959_0464966 3300045049 Unclassified 857
482 Ga0495638_0031102 3300046460 Bacteria 3432
483 Ga0495638_0065639 3300046460 Bacteria 2233
484 Ga0495638_0235955 3300046460 Bacteria 1015
485 Ga0495651_0417216 3300046462 Bacteria 873
486 Ga0495580_0021316 3300046472 Bacteria 4782
487 Ga0495639_0069846 3300046475 Bacteria 1621
488 Ga0495606_0002804 3300046507 Bacteria 19399
489 Ga0495630_0025789 3300046517 Bacteria 4348
490 Ga0495587_0162352 3300046536 Bacteria 1271
491 Ga0495622_0091426 3300046557 Bacteria 1398
492 Ga0495633_0093572 3300046558 Bacteria 1397
493 Ga0495668_0000751 3300046616 Bacteria 38311
494 Ga0495611_0000844 3300046648 Bacteria 16812
495 Ga0495611_0115505 3300046648 Bacteria 1250
496 Ga0495658_0019280 3300046683 Unclassified 3558
497 Ga0495613_0061650 3300046689 Bacteria 2746
498 Ga0495600_0188599 3300046809 Bacteria 1327
499 Ga0495674_0573799 3300047319 Bacteria 896
500 Ga0495672_0011784 3300047320 Bacteria 6143
501 Ga0495672_0081473 3300047320 Bacteria 1802
502 Ga0495676_0486960 3300047321 Bacteria 811
503 Ga0495687_000001 3300047443 Bacteria 1215582
504 Ga0495684_0339644 3300047471 Unclassified 1069
505 Ga0495686_0000004 3300047472 Bacteria 869019
506 Ga0496104_0561522 3300048907 Bacteria 1052
507 Ga0496108_0342244 3300048911 Bacteria 1305
508 Ga0496109_0036055 3300048912 Bacteria 4465
509 Ga0496110_0070127 3300048913 Bacteria 3105
510 Ga0495682_0056835 3300049460 Unclassified 1418
511 Ga0501032_0337941 3300049569 Unclassified 971
512 Ga0501033_0250189 3300049570 Unclassified 1256
513 Ga0501034_0013958 3300049571 Bacteria 8270
514 Ga0501034_0245885 3300049571 Bacteria 1734
515 Ga0501034_0497168 3300049571 Unclassified 1133
516 Ga0501036_0156041 3300049572 Bacteria 1925
517 Ga0501037_0226549 3300049573 Bacteria 1313
518 Ga0501038_0192490 3300049574 Bacteria 1640
519 Ga0501038_0413973 3300049574 Unclassified 1041
520 Ga0501039_0037341 3300049575 Bacteria 3749
521 Ga0501043_0156384 3300049579 Bacteria 1783
522 Ga0501043_0744388 3300049579 Bacteria 713
523 Ga0501047_0038244 3300049581 Bacteria 4642
524 Ga0501047_0075707 3300049581 Bacteria 3239
525 Ga0501047_0174796 3300049581 Bacteria 2015
526 Ga0501047_0633173 3300049581 Bacteria 890
527 Ga0501048_0258440 3300049582 Bacteria 1237
528 Ga0501067_0009978 3300049583 Bacteria 5257
529 Ga0501068_0231624 3300049584 Unclassified 1175
530 Ga0501069_0304208 3300049585 Unclassified 935
531 Ga0501070_0095029 3300049586 Bacteria 2466
532 Ga0501070_0291712 3300049586 Unclassified 1329
533 Ga0501071_0441402 3300049587 Unclassified 996
534 Ga0501073_0032583 3300049589 Bacteria 3715
535 Ga0501074_0272251 3300049590 Unclassified 1204
536 Ga0501217_035753 3300049661 Bacteria 1244
537 Ga0501257_005498 3300049686 Bacteria 2796
538 Ga0501219_000120 3300049703 Bacteria 13824
539 Ga0501225_0084524 3300049705 Bacteria 914
540 Ga0501080_0127374 3300049742 Bacteria 2357
541 Ga0501080_0418616 3300049742 Bacteria 1204
542 Ga0501080_0576143 3300049742 Unclassified 1001
543 Ga0501080_0743590 3300049742 Bacteria 863
544 Ga0501080_0843484 3300049742 Unclassified 801
545 Ga0501083_0020759 3300049744 Bacteria 4566
546 Ga0501241_001569 3300049758 Bacteria 4589
547 Ga0501035_0026939 3300049822 Bacteria 5256
548 Ga0501035_0541089 3300049822 Unclassified 955
549 Ga0501044_0056805 3300049823 Bacteria 4018
550 Ga0501044_0173085 3300049823 Bacteria 2129
551 Ga0501044_0247887 3300049823 Bacteria 1723
552 Ga0501044_0725374 3300049823 Unclassified 878
553 Ga0501284_00011 3300050005 Bacteria 131008
554 nmdc:mga0k408_94516_c1 3300050493 Bacteria 1758
555 nmdc:mga05p37_1503_c1 3300050507 Bacteria 27101
556 nmdc:mga09592_47659_c1 3300050508 Bacteria 3612
557 nmdc:mga06r32_118684_c1 3300050510 Bacteria 2608
558 nmdc:mga08y16_226613_c1 3300050511 Bacteria 1934
559 nmdc:mga08y16_410994_c1 3300050511 Bacteria 1384
560 Ga0500578_0000034 3300053086 Bacteria 136582
561 Ga0500646_0007435 3300053090 Bacteria 2800
562 Ga0500646_0022442 3300053090 Bacteria 1688
563 Ga0500646_0197316 3300053090 Bacteria 689
564 Ga0500583_0000059 3300053092 Bacteria 68222
565 Ga0500583_0000533 3300053092 Bacteria 11541
566 Ga0500583_0002199 3300053092 Bacteria 5793
567 Ga0500583_0353513 3300053092 Bacteria 712
568 Ga0500650_0169182 3300053098 Bacteria 1005
569 Ga0500556_0098349 3300053104 Bacteria 1125
570 Ga0500562_042713 3300053108 Bacteria 1206
571 Ga0500642_0017989 3300053130 Bacteria 2722
572 Ga0500642_0297796 3300053130 Bacteria 729
573 Ga0500652_024549 3300053131 Bacteria 2302
574 Ga0500573_0095924 3300053140 Bacteria 1672
575 Ga0500577_0254691 3300053142 Bacteria 763
576 Ga0500588_0087704 3300053146 Bacteria 1052
577 Ga0500588_0142404 3300053146 Bacteria 862
578 Ga0500589_011097 3300053147 Bacteria 3885
579 Ga0500604_0003482 3300053151 Bacteria 4243
580 Ga0500616_0008274 3300053153 Bacteria 6479
581 Ga0500616_0182477 3300053153 Unclassified 944
582 Ga0500622_0010888 3300053156 Bacteria 4968
583 Ga0500622_0042857 3300053156 Bacteria 2349
584 Ga0500622_0251890 3300053156 Bacteria 775
585 Ga0500636_0021994 3300053177 Bacteria 3774
586 Ga0500637_0025029 3300053178 Bacteria 3276
587 Ga0501084_0015987 3300054114 Bacteria 6228
588 Ga0501082_0479251 3300060353 Unclassified 1087
589 Ga0466962_0025543 3300061719 Unclassified 2836
590 2738727077 2738541278 Bacteria 9755573
591 Ga0068868_100426980
592 JGI24751J29686_10002957
593 rootH1_10109431
594 rootH2_10003679
595 rootH2_10020680
596 rootH2_10072325
597 rootH2_10074128
598 rootL2_10107609
599 rootL2_10124109
600 rootL2_10136350
601 rootL2_10204225
602 rootH1_10110681
603 rootH1_10119412
604 Ga0070658_10001461
605 Ga0070676_10000153
606 Ga0070676_10179580
607 Ga0070683_100016609
608 Ga0070690_100020538
609 Ga0070670_100008495
610 Ga0070670_100067020
611 Ga0070670_100097778
612 Ga0070670_100390012
613 Ga0070670_100449897
614 Ga0068869_100005195
615 Ga0068869_100005944
616 Ga0068869_100041627
617 Ga0070666_10000074
618 Ga0070666_10000209
619 Ga0070666_10100142
620 Ga0070680_100000076
621 Ga0070682_100000717
622 Ga0068868_100001336
623 Ga0068868_100006670
624 Ga0068868_100051402
625 Ga0068868_100065934
626 Ga0070689_100106285
627 Ga0070691_10001594
628 Ga0070691_10023779
629 Ga0070691_10097560
630 Ga0070691_10134032
631 Ga0070687_100030823
632 Ga0070661_100138644
633 Ga0070661_100427580
634 Ga0070668_100000556
635 Ga0070669_100173835
636 Ga0070669_100857641
637 Ga0070675_100008396
638 Ga0070675_100030472
639 Ga0070671_100032781
640 Ga0070671_100072503
641 Ga0070674_100030788
642 Ga0070674_100289624
643 Ga0070673_100000867
644 Ga0070673_100030743
645 Ga0070673_100034889
646 Ga0070673_100359145
647 Ga0070673_100807756
648 Ga0070667_100000812
649 Ga0070667_100011346
650 Ga0070667_100024194
651 Ga0070667_100240218
652 Ga0070713_100211725
653 Ga0070701_10350731
654 Ga0070663_100988873
655 Ga0070678_100188922
656 Ga0070678_100236791
657 Ga0070662_100001017
658 Ga0070662_100288850
659 Ga0070681_10010611
660 Ga0068867_100001726
661 Ga0070685_10087676
662 Ga0070685_10250571
663 Ga0070685_10552019
664 Ga0070698_100859695
665 Ga0070679_100001661
666 Ga0070679_100466867
667 Ga0070684_100000495
668 Ga0068853_100003018
669 Ga0068853_100009002
670 Ga0068853_100041566
671 Ga0068853_100044583
672 Ga0068853_100314240
673 Ga0068853_100635602
674 Ga0070672_100000738
675 Ga0070672_100037754
676 Ga0070672_100216840
677 Ga0070686_100688350
678 Ga0070665_100000001
679 Ga0070665_100000486
680 Ga0070665_100135109
681 Ga0068855_100000089
682 Ga0068855_100015722
683 Ga0068855_100021118
684 Ga0068855_100037687
685 Ga0068855_100087390
686 Ga0068855_100606291
687 Ga0068855_100649447
688 Ga0070664_100003411
689 Ga0070664_100007338
690 Ga0070664_100023463
691 Ga0068857_100000416
692 Ga0068857_100028459
693 Ga0068857_100237949
694 Ga0068857_100272624
695 Ga0068856_100019180
696 Ga0068856_100032809
697 Ga0068856_100135432
698 Ga0070702_100031443
699 Ga0068852_100001789
700 Ga0068852_100020739
701 Ga0068852_100041015
702 Ga0068852_100120012
703 Ga0068852_100305751
704 Ga0068852_100468356
705 Ga0068852_100604334
706 Ga0068852_100844370
707 Ga0068852_101177689
708 Ga0068859_100000064
709 Ga0068859_100050734
710 Ga0068859_100251870
711 Ga0068859_100300907
712 Ga0068864_100002330
713 Ga0068864_100003479
714 Ga0068864_100039621
715 Ga0068864_100170306
716 Ga0068861_100011630
717 Ga0068851_10022342
718 Ga0068863_100000858
719 Ga0068863_100012459
720 Ga0068863_100024789
721 Ga0068863_100852885
722 Ga0068858_100002789
723 Ga0068858_100661505
724 Ga0068860_100000046
725 Ga0068860_100007897
726 Ga0068860_100011746
727 Ga0068860_100012477
728 Ga0068860_100012918
729 Ga0068860_100015187
730 Ga0068860_100136613
731 Ga0068862_100167700
732 Ga0081540_1022784
733 Ga0075366_10185249
734 Ga0097621_100004653
735 Ga0097621_100019318
736 Ga0097621_100163339
737 Ga0097621_100190479
738 Ga0068871_100008209
739 Ga0068871_100011119
740 Ga0068871_100116764
741 Ga0068871_100387629
742 Ga0068871_100462975
743 Ga0068871_100664275
744 Ga0068865_100016233
745 Ga0068865_100388273
746 Ga0097620_100000064
747 Ga0097620_100050731
748 Ga0097620_100251886
749 Ga0097620_100300914
750 Ga0105240_10000074
751 Ga0105240_10000598
752 Ga0105240_10000626
753 Ga0105240_10002252
754 Ga0105240_10002663
755 Ga0105240_10045603
756 Ga0105240_10087658
757 Ga0105240_10107501
758 Ga0105240_10241179
759 Ga0105240_10502159
760 Ga0105240_10652329
761 Ga0105240_10705661
762 Ga0105240_11206926
763 Ga0111539_10019384
764 Ga0111539_10019555
765 Ga0105245_10199051
766 Ga0105245_10684098
767 Ga0105247_10028400
768 Ga0114129_10001869
769 Ga0105243_10135792
770 Ga0105241_10000224
771 Ga0105241_10000286
772 Ga0105241_10001283
773 Ga0105241_10131934
774 Ga0105241_10171658
775 Ga0105241_10194207
776 Ga0105241_10333532
777 Ga0105241_10488332
778 Ga0105242_10026095
779 Ga0105242_10195105
780 Ga0105248_10036285
781 Ga0105248_10341691
782 Ga0105237_10001565
783 Ga0105237_10002860
784 Ga0105237_10011674
785 Ga0105237_10029888
786 Ga0105237_10061220
787 Ga0105237_10092356
788 Ga0105237_10093460
789 Ga0105237_10121919
790 Ga0105238_10004027
791 Ga0105238_10043224
792 Ga0105238_10061333
793 Ga0105249_10004940
794 Ga0105249_10075570
795 Ga0105249_10586737
796 Ga0105239_10000048
797 Ga0105239_10000785
798 Ga0105239_10001973
799 Ga0105239_10002090
800 Ga0105239_10020299
801 Ga0105239_10029540
802 Ga0105239_10069892
803 Ga0105239_10901527
804 Ga0105239_11139023
805 Ga0105246_10052134
806 Ga0105246_10126760
807 Ga0157371_10179444
808 Ga0157370_10001393
809 Ga0157370_10006375
810 Ga0157370_10012696
811 Ga0157369_10020756
812 Ga0157369_10043244
813 Ga0157369_10306893
814 Ga0157374_10000001
815 Ga0157374_10000841
816 Ga0157374_10032047
817 Ga0157374_10032367
818 Ga0157374_10086125
819 Ga0157374_10448217
820 Ga0157374_10859032
821 Ga0157378_10003436
822 Ga0157378_10009439
823 Ga0157378_10074449
824 Ga0157378_10239492
825 Ga0157378_10357675
826 Ga0163162_10000100
827 Ga0163162_10000190
828 Ga0163162_10004813
829 Ga0163162_10004838
830 Ga0163162_10023347
831 Ga0157372_10002055
832 Ga0157372_10004228
833 Ga0157372_10122684
834 Ga0157372_10166948
835 Ga0157372_10226026
836 Ga0157372_10279973
837 Ga0157372_10284341
838 Ga0157372_10378024
839 Ga0157372_11084510
840 Ga0157372_11218690
841 Ga0157375_10000057
842 Ga0157375_10514729
843 Ga0157375_10604520
844 Ga0157375_10740041
845 Ga0157375_11904272
846 Ga0163163_10000254
847 Ga0163163_10005051
848 Ga0163163_10050798
849 Ga0163163_10153674
850 Ga0163163_10271475
851 Ga0163163_10317958
852 Ga0163163_11690078
853 Ga0157380_10308871
854 Ga0157380_10354634
855 Ga0157380_10468554
856 Ga0157380_10473084
857 Ga0157380_11166912
858 Ga0157377_10010308
859 Ga0157377_10045068
860 Ga0157377_10223269
861 Ga0157379_10000367
862 Ga0157379_10022101
863 Ga0157379_10355958
864 Ga0157376_10000135
865 Ga0157376_10000721
866 Ga0157376_10001835
867 Ga0157376_10168854
868 Ga0157376_10221346
869 Ga0157376_10288534
870 Ga0157376_10366121
871 Ga0163161_10028055
872 Ga0213876_10000584
873 Ga0209646_1003045
874 Ga0207656_10001696
875 Ga0207656_10122717
876 Ga0207682_10035070
877 Ga0207680_10000034
878 Ga0207680_10003138
879 Ga0207680_10060155
880 Ga0207647_10010415
881 Ga0207647_10031138
882 Ga0207647_10083179
883 Ga0207647_10105783
884 Ga0207645_10114173
885 Ga0207705_10102421
886 Ga0207705_10371010
887 Ga0207654_10000259
888 Ga0207654_10001139
889 Ga0207654_10001938
890 Ga0207654_10055778
891 Ga0207654_10180630
892 Ga0207654_10264253
893 Ga0207707_10000574
894 Ga0207695_10000071
895 Ga0207695_10000084
896 Ga0207695_10000323
897 Ga0207695_10002490
898 Ga0207695_10008950
899 Ga0207695_10011843
900 Ga0207695_10013620
901 Ga0207695_10056828
902 Ga0207695_10062793
903 Ga0207695_10263796
904 Ga0207695_10556019
905 Ga0207671_10001497
906 Ga0207671_10003026
907 Ga0207671_10014962
908 Ga0207671_10016015
909 Ga0207671_10033385
910 Ga0207671_10034358
911 Ga0207671_10065850
912 Ga0207660_10015280
913 Ga0207662_10060441
914 Ga0207649_10043912
915 Ga0207649_10083835
916 Ga0207652_10001002
917 Ga0207681_10119581
918 Ga0207681_10130910
919 Ga0207694_10002468
920 Ga0207694_10077298
921 Ga0207694_10185812
922 Ga0207650_10103691
923 Ga0207650_10124757
924 Ga0207650_10281047
925 Ga0207659_10127332
926 Ga0207659_10212000
927 Ga0207644_10548126
928 Ga0207706_10041013
929 Ga0207706_10194362
930 Ga0207706_10245924
931 Ga0207686_10053654
932 Ga0207670_10126414
933 Ga0207669_10118403
934 Ga0207669_10241620
935 Ga0207704_10377978
936 Ga0207691_10002120
937 Ga0207691_10261109
938 Ga0207691_11013884
939 Ga0207711_10401283
940 Ga0207689_10000835
941 Ga0207689_10056715
942 Ga0207689_10507115
943 Ga0207661_10018759
944 Ga0207661_10045478
945 Ga0207661_10989508
946 Ga0207679_10005876
947 Ga0207679_10502587
948 Ga0207667_10000135
949 Ga0207667_10000177
950 Ga0207667_10027144
951 Ga0207667_10049014
952 Ga0207667_10154317
953 Ga0207667_10174910
954 Ga0207667_10488968
955 Ga0207651_10057961
956 Ga0207651_10154808
957 Ga0207651_10605799
958 Ga0207712_10521950
959 Ga0207668_10001106
960 Ga0207668_10268256
961 Ga0207640_10018184
962 Ga0207658_10000847
963 Ga0207658_10050105
964 Ga0207658_10150587
965 Ga0207677_10002069
966 Ga0207677_10282537
967 Ga0207703_10005435
968 Ga0207703_10027567
969 Ga0207703_11229141
970 Ga0207639_10001126
971 Ga0207639_10108934
972 Ga0207639_10436163
973 Ga0207639_10624048
974 Ga0207708_10196430
975 Ga0207708_10580926
976 Ga0207702_10015346
977 Ga0207702_10034469
978 Ga0207641_10000082
979 Ga0207641_10004489
980 Ga0207641_10018114
981 Ga0207641_10067188
982 Ga0207648_10006588
983 Ga0207648_10228812
984 Ga0207676_10003890
985 Ga0207676_10048772
986 Ga0207676_10146539
987 Ga0207674_10004100
988 Ga0207674_10017645
989 Ga0207674_10060265
990 Ga0207674_10162745
991 Ga0207675_100018238
992 Ga0207683_10363586
993 Ga0207683_10481148
994 Ga0207698_10003175
995 Ga0207698_10035724
996 Ga0207698_10072886
997 Ga0207698_10162986
998 Ga0207698_10204917
999 Ga0207698_10526679
1000 Ga0207428_10383096
1001 Ga0268266_10000049
1002 Ga0268266_10052022
1003 Ga0268264_10000041
1004 Ga0268264_10007632
1005 Ga0268264_10009632
1006 Ga0268264_10010772
1007 Ga0268264_10015145
1008 Ga0268264_10022898
1009 Ga0307517_10002048
1010 Ga0307517_10111481
1011 Ga0307515_10000412
1012 Ga0307515_10287936
1013 Ga0307511_10000042
1014 Ga0265328_10065155
1015 Ga0265331_10069401
1016 Ga0265327_10019937
1017 Ga0265327_10034648
1018 Ga0265316_10174620
1019 Ga0307513_10717081
1020 Ga0307509_10043286
1021 Ga0307509_10089103
1022 Ga0307509_10123637
1023 Ga0265313_10018685
1024 Ga0265313_10209541
1025 Ga0307508_10032628
1026 Ga0265314_10026919
1027 Ga0307516_10001770
1028 Ga0307516_10392332
1029 Ga0307414_10867993
1030 Ga0307415_100753825
1031 Ga0307510_10000091
1032 Ga0307510_10212567
1033 Ga0373923_0320373
1034 Ga0373953_0099937
1035 Ga0373955_0004303
1036 Ga0373933_0384958
1037 Ga0373937_0077855
1038 Ga0373937_0334704
1039 Ga0373937_0834719
1040 Ga0373925_0106299
1041 Ga0436365_0012565
1042 Ga0436365_0585774
1043 Ga0436365_1500732
1044 Ga0439439_0008322
1045 Ga0451807_2736319
1046 Ga0451839_0130283
1047 Ga0451849_0977074
1048 Ga0451853_3257709
1049 Ga0439448_0119532
1050 Ga0439449_0023445
1051 Ga0439449_0068874
1052 Ga0439457_000387
1053 Ga0439462_0001399
1054 Ga0451577_0015230
1055 Ga0466969_0000238
1056 Ga0466972_0000003
1057 Ga0466972_0000039
1058 Ga0466972_0008991
1059 Ga0466972_0010280
1060 Ga0466966_0000136
1061 Ga0466961_0022937
1062 Ga0466964_0030938
1063 Ga0466964_0255969
1064 Ga0466968_0106664
1065 Ga0466970_0000460
1066 Ga0466957_0001467
1067 Ga0466957_0017717
1068 Ga0466957_0119980
1069 Ga0466960_0073614
1070 Ga0466959_0000002
1071 Ga0466959_0464966
1072 Ga0495638_0031102
1073 Ga0495638_0065639
1074 Ga0495638_0235955
1075 Ga0495651_0417216
1076 Ga0495580_0021316
1077 Ga0495639_0069846
1078 Ga0495606_0002804
1079 Ga0495630_0025789
1080 Ga0495587_0162352
1081 Ga0495622_0091426
1082 Ga0495633_0093572
1083 Ga0495668_0000751
1084 Ga0495611_0000844
1085 Ga0495611_0115505
1086 Ga0495658_0019280
1087 Ga0495613_0061650
1088 Ga0495600_0188599
1089 Ga0495674_0573799
1090 Ga0495672_0011784
1091 Ga0495672_0081473
1092 Ga0495676_0486960
1093 Ga0495687_000001
1094 Ga0495684_0339644
1095 Ga0495686_0000004
1096 Ga0496104_0561522
1097 Ga0496108_0342244
1098 Ga0496109_0036055
1099 Ga0496110_0070127
1100 Ga0495682_0056835
1101 Ga0501032_0337941
1102 Ga0501033_0250189
1103 Ga0501034_0013958
1104 Ga0501034_0245885
1105 Ga0501034_0497168
1106 Ga0501036_0156041
1107 Ga0501037_0226549
1108 Ga0501038_0192490
1109 Ga0501038_0413973
1110 Ga0501039_0037341
1111 Ga0501043_0156384
1112 Ga0501043_0744388
1113 Ga0501047_0038244
1114 Ga0501047_0075707
1115 Ga0501047_0174796
1116 Ga0501047_0633173
1117 Ga0501048_0258440
1118 Ga0501067_0009978
1119 Ga0501068_0231624
1120 Ga0501069_0304208
1121 Ga0501070_0095029
1122 Ga0501070_0291712
1123 Ga0501071_0441402
1124 Ga0501073_0032583
1125 Ga0501074_0272251
1126 Ga0501217_035753
1127 Ga0501257_005498
1128 Ga0501219_000120
1129 Ga0501225_0084524
1130 Ga0501080_0127374
1131 Ga0501080_0418616
1132 Ga0501080_0576143
1133 Ga0501080_0743590
1134 Ga0501080_0843484
1135 Ga0501083_0020759
1136 Ga0501241_001569
1137 Ga0501035_0026939
1138 Ga0501035_0541089
1139 Ga0501044_0056805
1140 Ga0501044_0173085
1141 Ga0501044_0247887
1142 Ga0501044_0725374
1143 Ga0501284_00011
1144 nmdc:mga0k408_94516_c1
1145 nmdc:mga05p37_1503_c1
1146 nmdc:mga09592_47659_c1
1147 nmdc:mga06r32_118684_c1
1148 nmdc:mga08y16_226613_c1
1149 nmdc:mga08y16_410994_c1
1150 Ga0500578_0000034
1151 Ga0500646_0007435
1152 Ga0500646_0022442
1153 Ga0500646_0197316
1154 Ga0500583_0000059
1155 Ga0500583_0000533
1156 Ga0500583_0002199
1157 Ga0500583_0353513
1158 Ga0500650_0169182
1159 Ga0500556_0098349
1160 Ga0500562_042713
1161 Ga0500642_0017989
1162 Ga0500642_0297796
1163 Ga0500652_024549
1164 Ga0500573_0095924
1165 Ga0500577_0254691
1166 Ga0500588_0087704
1167 Ga0500588_0142404
1168 Ga0500589_011097
1169 Ga0500604_0003482
1170 Ga0500616_0008274
1171 Ga0500616_0182477
1172 Ga0500622_0010888
1173 Ga0500622_0042857
1174 Ga0500622_0251890
1175 Ga0500636_0021994
1176 Ga0500637_0025029
1177 Ga0501084_0015987
1178 Ga0501082_0479251
1179 Ga0466962_0025543
1180 2738727077

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10263

SprT-like

SprT-like family

21

118

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oho-assembly2.cif.gz_B crystal structure of the kowx-kow4 domain of human dsif 0.8089 159 201
2v62-assembly2.cif.gz_B structure of vaccinia-related kinase 2 0.7806 159 190
8q1z-assembly1.cif.gz_A crystal structure of human vaccinia-related kinase 2 (vrk-2) bound to ja-296 0.7759 159 192
7sxi-assembly1.cif.gz_A solution structure of sds3 capped tudor domain 0.7698 160 206
6kco-assembly3.cif.gz_E shuguo pwwp in complex with ssdna 0.7684 158 201
ID Description Score Start End Superfamily
af_P9WNM3_64_126_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9178 171 197 2.40.50.140
af_Q8IIS3_1222_1271_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8459 159 197 2.30.30.60
af_A0A0R0ELK1_770_819_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8304 159 197 2.30.30.60
af_Q15047_344_410_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8155 159 198 2.30.30.140
af_Q69T55_240_282_2.30.30.30 Mainly Beta;Roll;SH3 type barrels.; 0.8143 159 197 2.30.30.30
ID Description Score Start End GO Terms
AF-A0A496MJX0-F1-model_v4 deleted 0.9769 159 209
AF-A0A496MJX0-F1-model_v4 deleted 0.9586 159 209
AF-A0A1Q3U027-F1-model_v4 SprT-like domain-containing protein 0.9572 3 202 GO:0033554
AF-A0A1E4EAS7-F1-model_v4 SprT-like domain-containing protein 0.9562 4 202 GO:0033554
AF-A0A4Q3Q2R9-F1-model_v4 deleted 0.9548 153 209

Map