F466940
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 590 | 262 | 1180 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100426980|Ga0068868_1004269801 |
| Length | 235 |
| Sequence | MAKKEAPLDYLRQFIPDVSAPLVLEYLNHYKVHLTITRERKSVLGDYRHATHANNHRISVNGNLNKYSFLITLIHELAHLVTFMEHGNQVQSHGKEWKQVYRKMLEEFLRLKVFPEDILAALKKNLHDLPASSCADEHLMRILKKYDKNAGGLMLVEQIAEGASFLLDDGRVFRKGKKLRKRFQCVELSTGKLYLFSAIYEVKPIQEPLKAVRPGPKGPDRGGASARSSDEGLRH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 91 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 92 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 143 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 144 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 145 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 146 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 151 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 153 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 156 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 161 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 165 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 166 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 167 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 168 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 169 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 170 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 171 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 172 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 173 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 174 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 175 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 176 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 177 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 178 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 179 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 180 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 181 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 182 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 183 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 184 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 185 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 209 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 228 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 229 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 230 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 234 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 237 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 238 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 243 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 244 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 245 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 246 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 247 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 248 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 249 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 250 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 251 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 252 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 253 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 254 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 255 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 256 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 257 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 262 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.92 |
| Nodule | 0 |
| Rhizoplane | 0.85 |
| Rhizosphere | 88.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.73 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068868_100426980 | 3300005338 | Unclassified | 1148 |
| 2 | JGI24751J29686_10002957 | 3300002459 | Bacteria | 3426 |
| 3 | rootH1_10109431 | 3300003316 | Unclassified | 3770 |
| 4 | rootH2_10003679 | 3300003320 | Bacteria | 27278 |
| 5 | rootH2_10020680 | 3300003320 | Bacteria | 12087 |
| 6 | rootH2_10072325 | 3300003320 | Bacteria | 1796 |
| 7 | rootH2_10074128 | 3300003320 | Bacteria | 8913 |
| 8 | rootL2_10107609 | 3300003322 | Unclassified | 1226 |
| 9 | rootL2_10124109 | 3300003322 | Unclassified | 1141 |
| 10 | rootL2_10136350 | 3300003322 | Bacteria | 1645 |
| 11 | rootL2_10204225 | 3300003322 | Bacteria | 1412 |
| 12 | rootH1_10110681 | 3300003323 | Bacteria | 2626 |
| 13 | rootH1_10119412 | 3300003323 | Bacteria | 3958 |
| 14 | Ga0070658_10001461 | 3300005327 | Bacteria | 20135 |
| 15 | Ga0070676_10000153 | 3300005328 | Bacteria | 27368 |
| 16 | Ga0070676_10179580 | 3300005328 | Bacteria | 1375 |
| 17 | Ga0070683_100016609 | 3300005329 | Bacteria | 6496 |
| 18 | Ga0070690_100020538 | 3300005330 | Bacteria | 4024 |
| 19 | Ga0070670_100008495 | 3300005331 | Bacteria | 8759 |
| 20 | Ga0070670_100067020 | 3300005331 | Bacteria | 3081 |
| 21 | Ga0070670_100097778 | 3300005331 | Bacteria | 2525 |
| 22 | Ga0070670_100390012 | 3300005331 | Bacteria | 1228 |
| 23 | Ga0070670_100449897 | 3300005331 | Bacteria | 1141 |
| 24 | Ga0068869_100005195 | 3300005334 | Bacteria | 8174 |
| 25 | Ga0068869_100005944 | 3300005334 | Bacteria | 7712 |
| 26 | Ga0068869_100041627 | 3300005334 | Bacteria | 3291 |
| 27 | Ga0070666_10000074 | 3300005335 | Bacteria | 72739 |
| 28 | Ga0070666_10000209 | 3300005335 | Bacteria | 40151 |
| 29 | Ga0070666_10100142 | 3300005335 | Bacteria | 1996 |
| 30 | Ga0070680_100000076 | 3300005336 | Bacteria | 53273 |
| 31 | Ga0070682_100000717 | 3300005337 | Bacteria | 19844 |
| 32 | Ga0068868_100001336 | 3300005338 | Bacteria | 17019 |
| 33 | Ga0068868_100006670 | 3300005338 | Bacteria | 8192 |
| 34 | Ga0068868_100051402 | 3300005338 | Bacteria | 3241 |
| 35 | Ga0068868_100065934 | 3300005338 | Bacteria | 2878 |
| 36 | Ga0070689_100106285 | 3300005340 | Bacteria | 2227 |
| 37 | Ga0070691_10001594 | 3300005341 | Bacteria | 9806 |
| 38 | Ga0070691_10023779 | 3300005341 | Bacteria | 2846 |
| 39 | Ga0070691_10097560 | 3300005341 | Bacteria | 1456 |
| 40 | Ga0070691_10134032 | 3300005341 | Unclassified | 1257 |
| 41 | Ga0070687_100030823 | 3300005343 | Bacteria | 2625 |
| 42 | Ga0070661_100138644 | 3300005344 | Bacteria | 1832 |
| 43 | Ga0070661_100427580 | 3300005344 | Bacteria | 1050 |
| 44 | Ga0070668_100000556 | 3300005347 | Bacteria | 24937 |
| 45 | Ga0070669_100173835 | 3300005353 | Bacteria | 1681 |
| 46 | Ga0070669_100857641 | 3300005353 | Bacteria | 774 |
| 47 | Ga0070675_100008396 | 3300005354 | Bacteria | 8014 |
| 48 | Ga0070675_100030472 | 3300005354 | Bacteria | 4356 |
| 49 | Ga0070671_100032781 | 3300005355 | Bacteria | 4293 |
| 50 | Ga0070671_100072503 | 3300005355 | Bacteria | 2876 |
| 51 | Ga0070674_100030788 | 3300005356 | Bacteria | 3549 |
| 52 | Ga0070674_100289624 | 3300005356 | Bacteria | 1301 |
| 53 | Ga0070673_100000867 | 3300005364 | Bacteria | 17013 |
| 54 | Ga0070673_100030743 | 3300005364 | Bacteria | 4024 |
| 55 | Ga0070673_100034889 | 3300005364 | Bacteria | 3811 |
| 56 | Ga0070673_100359145 | 3300005364 | Bacteria | 1295 |
| 57 | Ga0070673_100807756 | 3300005364 | Bacteria | 866 |
| 58 | Ga0070667_100000812 | 3300005367 | Bacteria | 29157 |
| 59 | Ga0070667_100011346 | 3300005367 | Bacteria | 7367 |
| 60 | Ga0070667_100024194 | 3300005367 | Bacteria | 5044 |
| 61 | Ga0070667_100240218 | 3300005367 | Bacteria | 1617 |
| 62 | Ga0070713_100211725 | 3300005436 | Bacteria | 1755 |
| 63 | Ga0070701_10350731 | 3300005438 | Bacteria | 922 |
| 64 | Ga0070663_100988873 | 3300005455 | Unclassified | 731 |
| 65 | Ga0070678_100188922 | 3300005456 | Bacteria | 1692 |
| 66 | Ga0070678_100236791 | 3300005456 | Bacteria | 1524 |
| 67 | Ga0070662_100001017 | 3300005457 | Bacteria | 17158 |
| 68 | Ga0070662_100288850 | 3300005457 | Bacteria | 1329 |
| 69 | Ga0070681_10010611 | 3300005458 | Bacteria | 9102 |
| 70 | Ga0068867_100001726 | 3300005459 | Bacteria | 15219 |
| 71 | Ga0070685_10087676 | 3300005466 | Bacteria | 1878 |
| 72 | Ga0070685_10250571 | 3300005466 | Bacteria | 1173 |
| 73 | Ga0070685_10552019 | 3300005466 | Unclassified | 822 |
| 74 | Ga0070698_100859695 | 3300005471 | Unclassified | 852 |
| 75 | Ga0070679_100001661 | 3300005530 | Bacteria | 20056 |
| 76 | Ga0070679_100466867 | 3300005530 | Bacteria | 1207 |
| 77 | Ga0070684_100000495 | 3300005535 | Bacteria | 27122 |
| 78 | Ga0068853_100003018 | 3300005539 | Bacteria | 12852 |
| 79 | Ga0068853_100009002 | 3300005539 | Bacteria | 8041 |
| 80 | Ga0068853_100041566 | 3300005539 | Bacteria | 3928 |
| 81 | Ga0068853_100044583 | 3300005539 | Bacteria | 3797 |
| 82 | Ga0068853_100314240 | 3300005539 | Unclassified | 1451 |
| 83 | Ga0068853_100635602 | 3300005539 | Bacteria | 1015 |
| 84 | Ga0070672_100000738 | 3300005543 | Bacteria | 19396 |
| 85 | Ga0070672_100037754 | 3300005543 | Bacteria | 3686 |
| 86 | Ga0070672_100216840 | 3300005543 | Unclassified | 1604 |
| 87 | Ga0070686_100688350 | 3300005544 | Bacteria | 814 |
| 88 | Ga0070665_100000001 | 3300005548 | Bacteria | 1083363 |
| 89 | Ga0070665_100000486 | 3300005548 | Bacteria | 57134 |
| 90 | Ga0070665_100135109 | 3300005548 | Bacteria | 2468 |
| 91 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 92 | Ga0068855_100015722 | 3300005563 | Bacteria | 9103 |
| 93 | Ga0068855_100021118 | 3300005563 | Bacteria | 7807 |
| 94 | Ga0068855_100037687 | 3300005563 | Bacteria | 5747 |
| 95 | Ga0068855_100087390 | 3300005563 | Bacteria | 3603 |
| 96 | Ga0068855_100606291 | 3300005563 | Bacteria | 1180 |
| 97 | Ga0068855_100649447 | 3300005563 | Unclassified | 1133 |
| 98 | Ga0070664_100003411 | 3300005564 | Bacteria | 12829 |
| 99 | Ga0070664_100007338 | 3300005564 | Bacteria | 8885 |
| 100 | Ga0070664_100023463 | 3300005564 | Bacteria | 5097 |
| 101 | Ga0068857_100000416 | 3300005577 | Bacteria | 30150 |
| 102 | Ga0068857_100028459 | 3300005577 | Bacteria | 4932 |
| 103 | Ga0068857_100237949 | 3300005577 | Bacteria | 1666 |
| 104 | Ga0068857_100272624 | 3300005577 | Unclassified | 1555 |
| 105 | Ga0068856_100019180 | 3300005614 | Bacteria | 6640 |
| 106 | Ga0068856_100032809 | 3300005614 | Bacteria | 5085 |
| 107 | Ga0068856_100135432 | 3300005614 | Bacteria | 2468 |
| 108 | Ga0070702_100031443 | 3300005615 | Bacteria | 2904 |
| 109 | Ga0068852_100001789 | 3300005616 | Bacteria | 14595 |
| 110 | Ga0068852_100020739 | 3300005616 | Bacteria | 5229 |
| 111 | Ga0068852_100041015 | 3300005616 | Bacteria | 3909 |
| 112 | Ga0068852_100120012 | 3300005616 | Bacteria | 2405 |
| 113 | Ga0068852_100305751 | 3300005616 | Bacteria | 1540 |
| 114 | Ga0068852_100468356 | 3300005616 | Bacteria | 1250 |
| 115 | Ga0068852_100604334 | 3300005616 | Bacteria | 1101 |
| 116 | Ga0068852_100844370 | 3300005616 | Unclassified | 931 |
| 117 | Ga0068852_101177689 | 3300005616 | Unclassified | 787 |
| 118 | Ga0068859_100000064 | 3300005617 | Bacteria | 104971 |
| 119 | Ga0068859_100050734 | 3300005617 | Bacteria | 4168 |
| 120 | Ga0068859_100251870 | 3300005617 | Bacteria | 1856 |
| 121 | Ga0068859_100300907 | 3300005617 | Bacteria | 1697 |
| 122 | Ga0068864_100002330 | 3300005618 | Bacteria | 15704 |
| 123 | Ga0068864_100003479 | 3300005618 | Bacteria | 13008 |
| 124 | Ga0068864_100039621 | 3300005618 | Bacteria | 4027 |
| 125 | Ga0068864_100170306 | 3300005618 | Bacteria | 1985 |
| 126 | Ga0068861_100011630 | 3300005719 | Bacteria | 6123 |
| 127 | Ga0068851_10022342 | 3300005834 | Bacteria | 3080 |
| 128 | Ga0068863_100000858 | 3300005841 | Bacteria | 30354 |
| 129 | Ga0068863_100012459 | 3300005841 | Bacteria | 8209 |
| 130 | Ga0068863_100024789 | 3300005841 | Bacteria | 5721 |
| 131 | Ga0068863_100852885 | 3300005841 | Bacteria | 910 |
| 132 | Ga0068858_100002789 | 3300005842 | Bacteria | 17554 |
| 133 | Ga0068858_100661505 | 3300005842 | Bacteria | 1015 |
| 134 | Ga0068860_100000046 | 3300005843 | Bacteria | 214800 |
| 135 | Ga0068860_100007897 | 3300005843 | Bacteria | 10623 |
| 136 | Ga0068860_100011746 | 3300005843 | Bacteria | 8629 |
| 137 | Ga0068860_100012477 | 3300005843 | Bacteria | 8369 |
| 138 | Ga0068860_100012918 | 3300005843 | Bacteria | 8203 |
| 139 | Ga0068860_100015187 | 3300005843 | Bacteria | 7522 |
| 140 | Ga0068860_100136613 | 3300005843 | Bacteria | 2355 |
| 141 | Ga0068862_100167700 | 3300005844 | Unclassified | 1964 |
| 142 | Ga0081540_1022784 | 3300005983 | Bacteria | 3689 |
| 143 | Ga0075366_10185249 | 3300006195 | Bacteria | 1265 |
| 144 | Ga0097621_100004653 | 3300006237 | Bacteria | 9582 |
| 145 | Ga0097621_100019318 | 3300006237 | Bacteria | 5228 |
| 146 | Ga0097621_100163339 | 3300006237 | Unclassified | 1915 |
| 147 | Ga0097621_100190479 | 3300006237 | Bacteria | 1776 |
| 148 | Ga0068871_100008209 | 3300006358 | Bacteria | 7499 |
| 149 | Ga0068871_100011119 | 3300006358 | Bacteria | 6598 |
| 150 | Ga0068871_100116764 | 3300006358 | Unclassified | 2250 |
| 151 | Ga0068871_100387629 | 3300006358 | Unclassified | 1242 |
| 152 | Ga0068871_100462975 | 3300006358 | Unclassified | 1138 |
| 153 | Ga0068871_100664275 | 3300006358 | Bacteria | 952 |
| 154 | Ga0068865_100016233 | 3300006881 | Bacteria | 4760 |
| 155 | Ga0068865_100388273 | 3300006881 | Bacteria | 1140 |
| 156 | Ga0097620_100000064 | 3300006931 | Bacteria | 104971 |
| 157 | Ga0097620_100050731 | 3300006931 | Bacteria | 4168 |
| 158 | Ga0097620_100251886 | 3300006931 | Bacteria | 1856 |
| 159 | Ga0097620_100300914 | 3300006931 | Bacteria | 1697 |
| 160 | Ga0105240_10000074 | 3300009093 | Bacteria | 199611 |
| 161 | Ga0105240_10000598 | 3300009093 | Bacteria | 67006 |
| 162 | Ga0105240_10000626 | 3300009093 | Bacteria | 65179 |
| 163 | Ga0105240_10002252 | 3300009093 | Bacteria | 31329 |
| 164 | Ga0105240_10002663 | 3300009093 | Bacteria | 28411 |
| 165 | Ga0105240_10045603 | 3300009093 | Bacteria | 5559 |
| 166 | Ga0105240_10087658 | 3300009093 | Bacteria | 3811 |
| 167 | Ga0105240_10107501 | 3300009093 | Bacteria | 3382 |
| 168 | Ga0105240_10241179 | 3300009093 | Bacteria | 2095 |
| 169 | Ga0105240_10502159 | 3300009093 | Bacteria | 1348 |
| 170 | Ga0105240_10652329 | 3300009093 | Bacteria | 1153 |
| 171 | Ga0105240_10705661 | 3300009093 | Unclassified | 1101 |
| 172 | Ga0105240_11206926 | 3300009093 | Unclassified | 801 |
| 173 | Ga0111539_10019384 | 3300009094 | Bacteria | 8397 |
| 174 | Ga0111539_10019555 | 3300009094 | Bacteria | 8355 |
| 175 | Ga0105245_10199051 | 3300009098 | Bacteria | 1923 |
| 176 | Ga0105245_10684098 | 3300009098 | Bacteria | 1058 |
| 177 | Ga0105247_10028400 | 3300009101 | Unclassified | 3385 |
| 178 | Ga0114129_10001869 | 3300009147 | Bacteria | 28696 |
| 179 | Ga0105243_10135792 | 3300009148 | Bacteria | 2092 |
| 180 | Ga0105241_10000224 | 3300009174 | Bacteria | 42685 |
| 181 | Ga0105241_10000286 | 3300009174 | Bacteria | 37584 |
| 182 | Ga0105241_10001283 | 3300009174 | Bacteria | 19188 |
| 183 | Ga0105241_10131934 | 3300009174 | Unclassified | 2024 |
| 184 | Ga0105241_10171658 | 3300009174 | Bacteria | 1791 |
| 185 | Ga0105241_10194207 | 3300009174 | Bacteria | 1691 |
| 186 | Ga0105241_10333532 | 3300009174 | Bacteria | 1312 |
| 187 | Ga0105241_10488332 | 3300009174 | Bacteria | 1096 |
| 188 | Ga0105242_10026095 | 3300009176 | Bacteria | 4629 |
| 189 | Ga0105242_10195105 | 3300009176 | Bacteria | 1795 |
| 190 | Ga0105248_10036285 | 3300009177 | Bacteria | 5514 |
| 191 | Ga0105248_10341691 | 3300009177 | Unclassified | 1685 |
| 192 | Ga0105237_10001565 | 3300009545 | Bacteria | 29826 |
| 193 | Ga0105237_10002860 | 3300009545 | Bacteria | 20998 |
| 194 | Ga0105237_10011674 | 3300009545 | Bacteria | 9296 |
| 195 | Ga0105237_10029888 | 3300009545 | Bacteria | 5535 |
| 196 | Ga0105237_10061220 | 3300009545 | Bacteria | 3764 |
| 197 | Ga0105237_10092356 | 3300009545 | Bacteria | 3016 |
| 198 | Ga0105237_10093460 | 3300009545 | Bacteria | 2996 |
| 199 | Ga0105237_10121919 | 3300009545 | Bacteria | 2602 |
| 200 | Ga0105238_10004027 | 3300009551 | Bacteria | 14580 |
| 201 | Ga0105238_10043224 | 3300009551 | Bacteria | 4559 |
| 202 | Ga0105238_10061333 | 3300009551 | Unclassified | 3763 |
| 203 | Ga0105249_10004940 | 3300009553 | Bacteria | 11508 |
| 204 | Ga0105249_10075570 | 3300009553 | Bacteria | 3121 |
| 205 | Ga0105249_10586737 | 3300009553 | Bacteria | 1168 |
| 206 | Ga0105239_10000048 | 3300010375 | Bacteria | 177855 |
| 207 | Ga0105239_10000785 | 3300010375 | Bacteria | 45044 |
| 208 | Ga0105239_10001973 | 3300010375 | Bacteria | 26693 |
| 209 | Ga0105239_10002090 | 3300010375 | Bacteria | 25893 |
| 210 | Ga0105239_10020299 | 3300010375 | Bacteria | 7329 |
| 211 | Ga0105239_10029540 | 3300010375 | Bacteria | 6027 |
| 212 | Ga0105239_10069892 | 3300010375 | Bacteria | 3856 |
| 213 | Ga0105239_10901527 | 3300010375 | Bacteria | 1015 |
| 214 | Ga0105239_11139023 | 3300010375 | Unclassified | 898 |
| 215 | Ga0105246_10052134 | 3300011119 | Bacteria | 2811 |
| 216 | Ga0105246_10126760 | 3300011119 | Bacteria | 1900 |
| 217 | Ga0157371_10179444 | 3300013102 | Bacteria | 1514 |
| 218 | Ga0157370_10001393 | 3300013104 | Bacteria | 29968 |
| 219 | Ga0157370_10006375 | 3300013104 | Bacteria | 13020 |
| 220 | Ga0157370_10012696 | 3300013104 | Bacteria | 8718 |
| 221 | Ga0157369_10020756 | 3300013105 | Bacteria | 7343 |
| 222 | Ga0157369_10043244 | 3300013105 | Bacteria | 4911 |
| 223 | Ga0157369_10306893 | 3300013105 | Bacteria | 1650 |
| 224 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 225 | Ga0157374_10000841 | 3300013296 | Bacteria | 26835 |
| 226 | Ga0157374_10032047 | 3300013296 | Bacteria | 4783 |
| 227 | Ga0157374_10032367 | 3300013296 | Bacteria | 4760 |
| 228 | Ga0157374_10086125 | 3300013296 | Bacteria | 2988 |
| 229 | Ga0157374_10448217 | 3300013296 | Bacteria | 1292 |
| 230 | Ga0157374_10859032 | 3300013296 | Bacteria | 924 |
| 231 | Ga0157378_10003436 | 3300013297 | Bacteria | 14052 |
| 232 | Ga0157378_10009439 | 3300013297 | Bacteria | 8502 |
| 233 | Ga0157378_10074449 | 3300013297 | Bacteria | 3056 |
| 234 | Ga0157378_10239492 | 3300013297 | Bacteria | 1733 |
| 235 | Ga0157378_10357675 | 3300013297 | Bacteria | 1428 |
| 236 | Ga0163162_10000100 | 3300013306 | Bacteria | 78269 |
| 237 | Ga0163162_10000190 | 3300013306 | Bacteria | 56892 |
| 238 | Ga0163162_10004813 | 3300013306 | Bacteria | 13027 |
| 239 | Ga0163162_10004838 | 3300013306 | Bacteria | 12998 |
| 240 | Ga0163162_10023347 | 3300013306 | Bacteria | 6104 |
| 241 | Ga0157372_10002055 | 3300013307 | Bacteria | 21888 |
| 242 | Ga0157372_10004228 | 3300013307 | Bacteria | 15351 |
| 243 | Ga0157372_10122684 | 3300013307 | Bacteria | 2986 |
| 244 | Ga0157372_10166948 | 3300013307 | Bacteria | 2546 |
| 245 | Ga0157372_10226026 | 3300013307 | Bacteria | 2170 |
| 246 | Ga0157372_10279973 | 3300013307 | Bacteria | 1939 |
| 247 | Ga0157372_10284341 | 3300013307 | Bacteria | 1923 |
| 248 | Ga0157372_10378024 | 3300013307 | Bacteria | 1651 |
| 249 | Ga0157372_11084510 | 3300013307 | Bacteria | 927 |
| 250 | Ga0157372_11218690 | 3300013307 | Bacteria | 869 |
| 251 | Ga0157375_10000057 | 3300013308 | Bacteria | 122654 |
| 252 | Ga0157375_10514729 | 3300013308 | Bacteria | 1360 |
| 253 | Ga0157375_10604520 | 3300013308 | Bacteria | 1255 |
| 254 | Ga0157375_10740041 | 3300013308 | Bacteria | 1135 |
| 255 | Ga0157375_11904272 | 3300013308 | Bacteria | 706 |
| 256 | Ga0163163_10000254 | 3300014325 | Bacteria | 54049 |
| 257 | Ga0163163_10005051 | 3300014325 | Bacteria | 11371 |
| 258 | Ga0163163_10050798 | 3300014325 | Bacteria | 4085 |
| 259 | Ga0163163_10153674 | 3300014325 | Unclassified | 2345 |
| 260 | Ga0163163_10271475 | 3300014325 | Bacteria | 1747 |
| 261 | Ga0163163_10317958 | 3300014325 | Bacteria | 1610 |
| 262 | Ga0163163_11690078 | 3300014325 | Unclassified | 694 |
| 263 | Ga0157380_10308871 | 3300014326 | Bacteria | 1460 |
| 264 | Ga0157380_10354634 | 3300014326 | Bacteria | 1374 |
| 265 | Ga0157380_10468554 | 3300014326 | Bacteria | 1215 |
| 266 | Ga0157380_10473084 | 3300014326 | Bacteria | 1210 |
| 267 | Ga0157380_11166912 | 3300014326 | Bacteria | 812 |
| 268 | Ga0157377_10010308 | 3300014745 | Bacteria | 4619 |
| 269 | Ga0157377_10045068 | 3300014745 | Bacteria | 2462 |
| 270 | Ga0157377_10223269 | 3300014745 | Unclassified | 1207 |
| 271 | Ga0157379_10000367 | 3300014968 | Bacteria | 36246 |
| 272 | Ga0157379_10022101 | 3300014968 | Bacteria | 5637 |
| 273 | Ga0157379_10355958 | 3300014968 | Bacteria | 1341 |
| 274 | Ga0157376_10000135 | 3300014969 | Bacteria | 50667 |
| 275 | Ga0157376_10000721 | 3300014969 | Bacteria | 21396 |
| 276 | Ga0157376_10001835 | 3300014969 | Bacteria | 14153 |
| 277 | Ga0157376_10168854 | 3300014969 | Bacteria | 1990 |
| 278 | Ga0157376_10221346 | 3300014969 | Bacteria | 1753 |
| 279 | Ga0157376_10288534 | 3300014969 | Bacteria | 1548 |
| 280 | Ga0157376_10366121 | 3300014969 | Bacteria | 1384 |
| 281 | Ga0163161_10028055 | 3300017792 | Bacteria | 3996 |
| 282 | Ga0213876_10000584 | 3300021384 | Bacteria | 27185 |
| 283 | Ga0209646_1003045 | 3300025246 | Bacteria | 3436 |
| 284 | Ga0207656_10001696 | 3300025321 | Bacteria | 7317 |
| 285 | Ga0207656_10122717 | 3300025321 | Bacteria | 1211 |
| 286 | Ga0207682_10035070 | 3300025893 | Bacteria | 2025 |
| 287 | Ga0207680_10000034 | 3300025903 | Bacteria | 74519 |
| 288 | Ga0207680_10003138 | 3300025903 | Bacteria | 7759 |
| 289 | Ga0207680_10060155 | 3300025903 | Bacteria | 2311 |
| 290 | Ga0207647_10010415 | 3300025904 | Bacteria | 6566 |
| 291 | Ga0207647_10031138 | 3300025904 | Bacteria | 3435 |
| 292 | Ga0207647_10083179 | 3300025904 | Unclassified | 1917 |
| 293 | Ga0207647_10105783 | 3300025904 | Bacteria | 1667 |
| 294 | Ga0207645_10114173 | 3300025907 | Bacteria | 1750 |
| 295 | Ga0207705_10102421 | 3300025909 | Bacteria | 2107 |
| 296 | Ga0207705_10371010 | 3300025909 | Bacteria | 1105 |
| 297 | Ga0207654_10000259 | 3300025911 | Bacteria | 32195 |
| 298 | Ga0207654_10001139 | 3300025911 | Bacteria | 14349 |
| 299 | Ga0207654_10001938 | 3300025911 | Bacteria | 10731 |
| 300 | Ga0207654_10055778 | 3300025911 | Unclassified | 2289 |
| 301 | Ga0207654_10180630 | 3300025911 | Bacteria | 1376 |
| 302 | Ga0207654_10264253 | 3300025911 | Unclassified | 1158 |
| 303 | Ga0207707_10000574 | 3300025912 | Bacteria | 37317 |
| 304 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 305 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 306 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 307 | Ga0207695_10002490 | 3300025913 | Bacteria | 27118 |
| 308 | Ga0207695_10008950 | 3300025913 | Bacteria | 12463 |
| 309 | Ga0207695_10011843 | 3300025913 | Bacteria | 10520 |
| 310 | Ga0207695_10013620 | 3300025913 | Bacteria | 9683 |
| 311 | Ga0207695_10056828 | 3300025913 | Unclassified | 4070 |
| 312 | Ga0207695_10062793 | 3300025913 | Unclassified | 3832 |
| 313 | Ga0207695_10263796 | 3300025913 | Bacteria | 1619 |
| 314 | Ga0207695_10556019 | 3300025913 | Bacteria | 1029 |
| 315 | Ga0207671_10001497 | 3300025914 | Bacteria | 26937 |
| 316 | Ga0207671_10003026 | 3300025914 | Bacteria | 17227 |
| 317 | Ga0207671_10014962 | 3300025914 | Bacteria | 6099 |
| 318 | Ga0207671_10016015 | 3300025914 | Bacteria | 5844 |
| 319 | Ga0207671_10033385 | 3300025914 | Bacteria | 3828 |
| 320 | Ga0207671_10034358 | 3300025914 | Bacteria | 3768 |
| 321 | Ga0207671_10065850 | 3300025914 | Bacteria | 2695 |
| 322 | Ga0207660_10015280 | 3300025917 | Bacteria | 5064 |
| 323 | Ga0207662_10060441 | 3300025918 | Bacteria | 2273 |
| 324 | Ga0207649_10043912 | 3300025920 | Bacteria | 2735 |
| 325 | Ga0207649_10083835 | 3300025920 | Bacteria | 2070 |
| 326 | Ga0207652_10001002 | 3300025921 | Bacteria | 26045 |
| 327 | Ga0207681_10119581 | 3300025923 | Bacteria | 1930 |
| 328 | Ga0207681_10130910 | 3300025923 | Bacteria | 1855 |
| 329 | Ga0207694_10002468 | 3300025924 | Bacteria | 15055 |
| 330 | Ga0207694_10077298 | 3300025924 | Bacteria | 2608 |
| 331 | Ga0207694_10185812 | 3300025924 | Bacteria | 1687 |
| 332 | Ga0207650_10103691 | 3300025925 | Bacteria | 2193 |
| 333 | Ga0207650_10124757 | 3300025925 | Bacteria | 2009 |
| 334 | Ga0207650_10281047 | 3300025925 | Bacteria | 1355 |
| 335 | Ga0207659_10127332 | 3300025926 | Bacteria | 1960 |
| 336 | Ga0207659_10212000 | 3300025926 | Bacteria | 1553 |
| 337 | Ga0207644_10548126 | 3300025931 | Bacteria | 957 |
| 338 | Ga0207706_10041013 | 3300025933 | Bacteria | 4104 |
| 339 | Ga0207706_10194362 | 3300025933 | Bacteria | 1780 |
| 340 | Ga0207706_10245924 | 3300025933 | Bacteria | 1563 |
| 341 | Ga0207686_10053654 | 3300025934 | Unclassified | 2521 |
| 342 | Ga0207670_10126414 | 3300025936 | Bacteria | 1866 |
| 343 | Ga0207669_10118403 | 3300025937 | Unclassified | 1792 |
| 344 | Ga0207669_10241620 | 3300025937 | Bacteria | 1339 |
| 345 | Ga0207704_10377978 | 3300025938 | Bacteria | 1111 |
| 346 | Ga0207691_10002120 | 3300025940 | Bacteria | 19396 |
| 347 | Ga0207691_10261109 | 3300025940 | Bacteria | 1493 |
| 348 | Ga0207691_11013884 | 3300025940 | Bacteria | 692 |
| 349 | Ga0207711_10401283 | 3300025941 | Unclassified | 1274 |
| 350 | Ga0207689_10000835 | 3300025942 | Bacteria | 29733 |
| 351 | Ga0207689_10056715 | 3300025942 | Bacteria | 3224 |
| 352 | Ga0207689_10507115 | 3300025942 | Unclassified | 1011 |
| 353 | Ga0207661_10018759 | 3300025944 | Bacteria | 5145 |
| 354 | Ga0207661_10045478 | 3300025944 | Bacteria | 3475 |
| 355 | Ga0207661_10989508 | 3300025944 | Unclassified | 775 |
| 356 | Ga0207679_10005876 | 3300025945 | Bacteria | 7713 |
| 357 | Ga0207679_10502587 | 3300025945 | Bacteria | 1082 |
| 358 | Ga0207667_10000135 | 3300025949 | Bacteria | 111565 |
| 359 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 360 | Ga0207667_10027144 | 3300025949 | Bacteria | 6241 |
| 361 | Ga0207667_10049014 | 3300025949 | Bacteria | 4463 |
| 362 | Ga0207667_10154317 | 3300025949 | Bacteria | 2363 |
| 363 | Ga0207667_10174910 | 3300025949 | Bacteria | 2206 |
| 364 | Ga0207667_10488968 | 3300025949 | Bacteria | 1249 |
| 365 | Ga0207651_10057961 | 3300025960 | Bacteria | 2674 |
| 366 | Ga0207651_10154808 | 3300025960 | Bacteria | 1789 |
| 367 | Ga0207651_10605799 | 3300025960 | Unclassified | 958 |
| 368 | Ga0207712_10521950 | 3300025961 | Bacteria | 1018 |
| 369 | Ga0207668_10001106 | 3300025972 | Bacteria | 16044 |
| 370 | Ga0207668_10268256 | 3300025972 | Unclassified | 1394 |
| 371 | Ga0207640_10018184 | 3300025981 | Unclassified | 4126 |
| 372 | Ga0207658_10000847 | 3300025986 | Bacteria | 25559 |
| 373 | Ga0207658_10050105 | 3300025986 | Bacteria | 3071 |
| 374 | Ga0207658_10150587 | 3300025986 | Unclassified | 1895 |
| 375 | Ga0207677_10002069 | 3300026023 | Bacteria | 10566 |
| 376 | Ga0207677_10282537 | 3300026023 | Bacteria | 1363 |
| 377 | Ga0207703_10005435 | 3300026035 | Bacteria | 10253 |
| 378 | Ga0207703_10027567 | 3300026035 | Bacteria | 4473 |
| 379 | Ga0207703_11229141 | 3300026035 | Unclassified | 720 |
| 380 | Ga0207639_10001126 | 3300026041 | Bacteria | 18166 |
| 381 | Ga0207639_10108934 | 3300026041 | Unclassified | 2253 |
| 382 | Ga0207639_10436163 | 3300026041 | Unclassified | 1187 |
| 383 | Ga0207639_10624048 | 3300026041 | Bacteria | 996 |
| 384 | Ga0207708_10196430 | 3300026075 | Bacteria | 1608 |
| 385 | Ga0207708_10580926 | 3300026075 | Unclassified | 947 |
| 386 | Ga0207702_10015346 | 3300026078 | Bacteria | 6348 |
| 387 | Ga0207702_10034469 | 3300026078 | Bacteria | 4232 |
| 388 | Ga0207641_10000082 | 3300026088 | Bacteria | 138385 |
| 389 | Ga0207641_10004489 | 3300026088 | Bacteria | 12072 |
| 390 | Ga0207641_10018114 | 3300026088 | Bacteria | 5771 |
| 391 | Ga0207641_10067188 | 3300026088 | Bacteria | 3071 |
| 392 | Ga0207648_10006588 | 3300026089 | Bacteria | 11528 |
| 393 | Ga0207648_10228812 | 3300026089 | Bacteria | 1654 |
| 394 | Ga0207676_10003890 | 3300026095 | Bacteria | 10549 |
| 395 | Ga0207676_10048772 | 3300026095 | Bacteria | 3289 |
| 396 | Ga0207676_10146539 | 3300026095 | Bacteria | 2028 |
| 397 | Ga0207674_10004100 | 3300026116 | Bacteria | 17648 |
| 398 | Ga0207674_10017645 | 3300026116 | Bacteria | 7784 |
| 399 | Ga0207674_10060265 | 3300026116 | Bacteria | 3838 |
| 400 | Ga0207674_10162745 | 3300026116 | Bacteria | 2186 |
| 401 | Ga0207675_100018238 | 3300026118 | Bacteria | 6543 |
| 402 | Ga0207683_10363586 | 3300026121 | Bacteria | 1329 |
| 403 | Ga0207683_10481148 | 3300026121 | Bacteria | 1146 |
| 404 | Ga0207698_10003175 | 3300026142 | Bacteria | 9858 |
| 405 | Ga0207698_10035724 | 3300026142 | Bacteria | 3639 |
| 406 | Ga0207698_10072886 | 3300026142 | Bacteria | 2732 |
| 407 | Ga0207698_10162986 | 3300026142 | Bacteria | 1953 |
| 408 | Ga0207698_10204917 | 3300026142 | Bacteria | 1770 |
| 409 | Ga0207698_10526679 | 3300026142 | Bacteria | 1154 |
| 410 | Ga0207428_10383096 | 3300027907 | Bacteria | 1031 |
| 411 | Ga0268266_10000049 | 3300028379 | Bacteria | 307763 |
| 412 | Ga0268266_10052022 | 3300028379 | Bacteria | 3516 |
| 413 | Ga0268264_10000041 | 3300028381 | Bacteria | 372501 |
| 414 | Ga0268264_10007632 | 3300028381 | Bacteria | 9016 |
| 415 | Ga0268264_10009632 | 3300028381 | Bacteria | 8003 |
| 416 | Ga0268264_10010772 | 3300028381 | Bacteria | 7554 |
| 417 | Ga0268264_10015145 | 3300028381 | Bacteria | 6325 |
| 418 | Ga0268264_10022898 | 3300028381 | Bacteria | 5098 |
| 419 | Ga0307517_10002048 | 3300028786 | Bacteria | 32795 |
| 420 | Ga0307517_10111481 | 3300028786 | Unclassified | 2079 |
| 421 | Ga0307515_10000412 | 3300028794 | Bacteria | 103361 |
| 422 | Ga0307515_10287936 | 3300028794 | Bacteria | 1342 |
| 423 | Ga0307511_10000042 | 3300030521 | Bacteria | 102114 |
| 424 | Ga0265328_10065155 | 3300031239 | Unclassified | 1338 |
| 425 | Ga0265331_10069401 | 3300031250 | Unclassified | 1651 |
| 426 | Ga0265327_10019937 | 3300031251 | Unclassified | 4105 |
| 427 | Ga0265327_10034648 | 3300031251 | Bacteria | 2799 |
| 428 | Ga0265316_10174620 | 3300031344 | Unclassified | 1602 |
| 429 | Ga0307513_10717081 | 3300031456 | Unclassified | 706 |
| 430 | Ga0307509_10043286 | 3300031507 | Bacteria | 4873 |
| 431 | Ga0307509_10089103 | 3300031507 | Bacteria | 3165 |
| 432 | Ga0307509_10123637 | 3300031507 | Unclassified | 2559 |
| 433 | Ga0265313_10018685 | 3300031595 | Bacteria | 3884 |
| 434 | Ga0265313_10209541 | 3300031595 | Bacteria | 808 |
| 435 | Ga0307508_10032628 | 3300031616 | Bacteria | 4704 |
| 436 | Ga0265314_10026919 | 3300031711 | Bacteria | 4314 |
| 437 | Ga0307516_10001770 | 3300031730 | Bacteria | 29691 |
| 438 | Ga0307516_10392332 | 3300031730 | Bacteria | 1048 |
| 439 | Ga0307414_10867993 | 3300032004 | Bacteria | 826 |
| 440 | Ga0307415_100753825 | 3300032126 | Unclassified | 884 |
| 441 | Ga0307510_10000091 | 3300033180 | Bacteria | 68694 |
| 442 | Ga0307510_10212567 | 3300033180 | Bacteria | 1455 |
| 443 | Ga0373923_0320373 | 3300035111 | Bacteria | 736 |
| 444 | Ga0373953_0099937 | 3300035117 | Bacteria | 1220 |
| 445 | Ga0373955_0004303 | 3300035172 | Bacteria | 6290 |
| 446 | Ga0373933_0384958 | 3300035724 | Bacteria | 914 |
| 447 | Ga0373937_0077855 | 3300036401 | Bacteria | 3064 |
| 448 | Ga0373937_0334704 | 3300036401 | Bacteria | 1433 |
| 449 | Ga0373937_0834719 | 3300036401 | Unclassified | 870 |
| 450 | Ga0373925_0106299 | 3300037068 | Bacteria | 2164 |
| 451 | Ga0436365_0012565 | 3300039437 | Bacteria | 1000 |
| 452 | Ga0436365_0585774 | 3300039437 | Bacteria | 54587 |
| 453 | Ga0436365_1500732 | 3300039437 | Bacteria | 3172 |
| 454 | Ga0439439_0008322 | 3300041406 | Bacteria | 2448 |
| 455 | Ga0451807_2736319 | 3300041486 | Bacteria | 718 |
| 456 | Ga0451839_0130283 | 3300041496 | Bacteria | 750 |
| 457 | Ga0451849_0977074 | 3300041505 | Bacteria | 2242 |
| 458 | Ga0451853_3257709 | 3300041512 | Bacteria | 1022 |
| 459 | Ga0439448_0119532 | 3300042005 | Bacteria | 904 |
| 460 | Ga0439449_0023445 | 3300042007 | Unclassified | 2308 |
| 461 | Ga0439449_0068874 | 3300042007 | Bacteria | 1304 |
| 462 | Ga0439457_000387 | 3300042014 | Bacteria | 12448 |
| 463 | Ga0439462_0001399 | 3300042015 | Bacteria | 5350 |
| 464 | Ga0451577_0015230 | 3300042876 | Bacteria | 7155 |
| 465 | Ga0466969_0000238 | 3300044656 | Bacteria | 30098 |
| 466 | Ga0466972_0000003 | 3300044658 | Bacteria | 391452 |
| 467 | Ga0466972_0000039 | 3300044658 | Bacteria | 135618 |
| 468 | Ga0466972_0008991 | 3300044658 | Bacteria | 5015 |
| 469 | Ga0466972_0010280 | 3300044658 | Bacteria | 4700 |
| 470 | Ga0466966_0000136 | 3300044684 | Bacteria | 47038 |
| 471 | Ga0466961_0022937 | 3300044693 | Unclassified | 4015 |
| 472 | Ga0466964_0030938 | 3300044706 | Unclassified | 2121 |
| 473 | Ga0466964_0255969 | 3300044706 | Bacteria | 865 |
| 474 | Ga0466968_0106664 | 3300044735 | Unclassified | 1256 |
| 475 | Ga0466970_0000460 | 3300044765 | Bacteria | 20110 |
| 476 | Ga0466957_0001467 | 3300044842 | Bacteria | 12361 |
| 477 | Ga0466957_0017717 | 3300044842 | Bacteria | 4177 |
| 478 | Ga0466957_0119980 | 3300044842 | Unclassified | 1676 |
| 479 | Ga0466960_0073614 | 3300044901 | Bacteria | 1705 |
| 480 | Ga0466959_0000002 | 3300045049 | Bacteria | 362671 |
| 481 | Ga0466959_0464966 | 3300045049 | Unclassified | 857 |
| 482 | Ga0495638_0031102 | 3300046460 | Bacteria | 3432 |
| 483 | Ga0495638_0065639 | 3300046460 | Bacteria | 2233 |
| 484 | Ga0495638_0235955 | 3300046460 | Bacteria | 1015 |
| 485 | Ga0495651_0417216 | 3300046462 | Bacteria | 873 |
| 486 | Ga0495580_0021316 | 3300046472 | Bacteria | 4782 |
| 487 | Ga0495639_0069846 | 3300046475 | Bacteria | 1621 |
| 488 | Ga0495606_0002804 | 3300046507 | Bacteria | 19399 |
| 489 | Ga0495630_0025789 | 3300046517 | Bacteria | 4348 |
| 490 | Ga0495587_0162352 | 3300046536 | Bacteria | 1271 |
| 491 | Ga0495622_0091426 | 3300046557 | Bacteria | 1398 |
| 492 | Ga0495633_0093572 | 3300046558 | Bacteria | 1397 |
| 493 | Ga0495668_0000751 | 3300046616 | Bacteria | 38311 |
| 494 | Ga0495611_0000844 | 3300046648 | Bacteria | 16812 |
| 495 | Ga0495611_0115505 | 3300046648 | Bacteria | 1250 |
| 496 | Ga0495658_0019280 | 3300046683 | Unclassified | 3558 |
| 497 | Ga0495613_0061650 | 3300046689 | Bacteria | 2746 |
| 498 | Ga0495600_0188599 | 3300046809 | Bacteria | 1327 |
| 499 | Ga0495674_0573799 | 3300047319 | Bacteria | 896 |
| 500 | Ga0495672_0011784 | 3300047320 | Bacteria | 6143 |
| 501 | Ga0495672_0081473 | 3300047320 | Bacteria | 1802 |
| 502 | Ga0495676_0486960 | 3300047321 | Bacteria | 811 |
| 503 | Ga0495687_000001 | 3300047443 | Bacteria | 1215582 |
| 504 | Ga0495684_0339644 | 3300047471 | Unclassified | 1069 |
| 505 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 506 | Ga0496104_0561522 | 3300048907 | Bacteria | 1052 |
| 507 | Ga0496108_0342244 | 3300048911 | Bacteria | 1305 |
| 508 | Ga0496109_0036055 | 3300048912 | Bacteria | 4465 |
| 509 | Ga0496110_0070127 | 3300048913 | Bacteria | 3105 |
| 510 | Ga0495682_0056835 | 3300049460 | Unclassified | 1418 |
| 511 | Ga0501032_0337941 | 3300049569 | Unclassified | 971 |
| 512 | Ga0501033_0250189 | 3300049570 | Unclassified | 1256 |
| 513 | Ga0501034_0013958 | 3300049571 | Bacteria | 8270 |
| 514 | Ga0501034_0245885 | 3300049571 | Bacteria | 1734 |
| 515 | Ga0501034_0497168 | 3300049571 | Unclassified | 1133 |
| 516 | Ga0501036_0156041 | 3300049572 | Bacteria | 1925 |
| 517 | Ga0501037_0226549 | 3300049573 | Bacteria | 1313 |
| 518 | Ga0501038_0192490 | 3300049574 | Bacteria | 1640 |
| 519 | Ga0501038_0413973 | 3300049574 | Unclassified | 1041 |
| 520 | Ga0501039_0037341 | 3300049575 | Bacteria | 3749 |
| 521 | Ga0501043_0156384 | 3300049579 | Bacteria | 1783 |
| 522 | Ga0501043_0744388 | 3300049579 | Bacteria | 713 |
| 523 | Ga0501047_0038244 | 3300049581 | Bacteria | 4642 |
| 524 | Ga0501047_0075707 | 3300049581 | Bacteria | 3239 |
| 525 | Ga0501047_0174796 | 3300049581 | Bacteria | 2015 |
| 526 | Ga0501047_0633173 | 3300049581 | Bacteria | 890 |
| 527 | Ga0501048_0258440 | 3300049582 | Bacteria | 1237 |
| 528 | Ga0501067_0009978 | 3300049583 | Bacteria | 5257 |
| 529 | Ga0501068_0231624 | 3300049584 | Unclassified | 1175 |
| 530 | Ga0501069_0304208 | 3300049585 | Unclassified | 935 |
| 531 | Ga0501070_0095029 | 3300049586 | Bacteria | 2466 |
| 532 | Ga0501070_0291712 | 3300049586 | Unclassified | 1329 |
| 533 | Ga0501071_0441402 | 3300049587 | Unclassified | 996 |
| 534 | Ga0501073_0032583 | 3300049589 | Bacteria | 3715 |
| 535 | Ga0501074_0272251 | 3300049590 | Unclassified | 1204 |
| 536 | Ga0501217_035753 | 3300049661 | Bacteria | 1244 |
| 537 | Ga0501257_005498 | 3300049686 | Bacteria | 2796 |
| 538 | Ga0501219_000120 | 3300049703 | Bacteria | 13824 |
| 539 | Ga0501225_0084524 | 3300049705 | Bacteria | 914 |
| 540 | Ga0501080_0127374 | 3300049742 | Bacteria | 2357 |
| 541 | Ga0501080_0418616 | 3300049742 | Bacteria | 1204 |
| 542 | Ga0501080_0576143 | 3300049742 | Unclassified | 1001 |
| 543 | Ga0501080_0743590 | 3300049742 | Bacteria | 863 |
| 544 | Ga0501080_0843484 | 3300049742 | Unclassified | 801 |
| 545 | Ga0501083_0020759 | 3300049744 | Bacteria | 4566 |
| 546 | Ga0501241_001569 | 3300049758 | Bacteria | 4589 |
| 547 | Ga0501035_0026939 | 3300049822 | Bacteria | 5256 |
| 548 | Ga0501035_0541089 | 3300049822 | Unclassified | 955 |
| 549 | Ga0501044_0056805 | 3300049823 | Bacteria | 4018 |
| 550 | Ga0501044_0173085 | 3300049823 | Bacteria | 2129 |
| 551 | Ga0501044_0247887 | 3300049823 | Bacteria | 1723 |
| 552 | Ga0501044_0725374 | 3300049823 | Unclassified | 878 |
| 553 | Ga0501284_00011 | 3300050005 | Bacteria | 131008 |
| 554 | nmdc:mga0k408_94516_c1 | 3300050493 | Bacteria | 1758 |
| 555 | nmdc:mga05p37_1503_c1 | 3300050507 | Bacteria | 27101 |
| 556 | nmdc:mga09592_47659_c1 | 3300050508 | Bacteria | 3612 |
| 557 | nmdc:mga06r32_118684_c1 | 3300050510 | Bacteria | 2608 |
| 558 | nmdc:mga08y16_226613_c1 | 3300050511 | Bacteria | 1934 |
| 559 | nmdc:mga08y16_410994_c1 | 3300050511 | Bacteria | 1384 |
| 560 | Ga0500578_0000034 | 3300053086 | Bacteria | 136582 |
| 561 | Ga0500646_0007435 | 3300053090 | Bacteria | 2800 |
| 562 | Ga0500646_0022442 | 3300053090 | Bacteria | 1688 |
| 563 | Ga0500646_0197316 | 3300053090 | Bacteria | 689 |
| 564 | Ga0500583_0000059 | 3300053092 | Bacteria | 68222 |
| 565 | Ga0500583_0000533 | 3300053092 | Bacteria | 11541 |
| 566 | Ga0500583_0002199 | 3300053092 | Bacteria | 5793 |
| 567 | Ga0500583_0353513 | 3300053092 | Bacteria | 712 |
| 568 | Ga0500650_0169182 | 3300053098 | Bacteria | 1005 |
| 569 | Ga0500556_0098349 | 3300053104 | Bacteria | 1125 |
| 570 | Ga0500562_042713 | 3300053108 | Bacteria | 1206 |
| 571 | Ga0500642_0017989 | 3300053130 | Bacteria | 2722 |
| 572 | Ga0500642_0297796 | 3300053130 | Bacteria | 729 |
| 573 | Ga0500652_024549 | 3300053131 | Bacteria | 2302 |
| 574 | Ga0500573_0095924 | 3300053140 | Bacteria | 1672 |
| 575 | Ga0500577_0254691 | 3300053142 | Bacteria | 763 |
| 576 | Ga0500588_0087704 | 3300053146 | Bacteria | 1052 |
| 577 | Ga0500588_0142404 | 3300053146 | Bacteria | 862 |
| 578 | Ga0500589_011097 | 3300053147 | Bacteria | 3885 |
| 579 | Ga0500604_0003482 | 3300053151 | Bacteria | 4243 |
| 580 | Ga0500616_0008274 | 3300053153 | Bacteria | 6479 |
| 581 | Ga0500616_0182477 | 3300053153 | Unclassified | 944 |
| 582 | Ga0500622_0010888 | 3300053156 | Bacteria | 4968 |
| 583 | Ga0500622_0042857 | 3300053156 | Bacteria | 2349 |
| 584 | Ga0500622_0251890 | 3300053156 | Bacteria | 775 |
| 585 | Ga0500636_0021994 | 3300053177 | Bacteria | 3774 |
| 586 | Ga0500637_0025029 | 3300053178 | Bacteria | 3276 |
| 587 | Ga0501084_0015987 | 3300054114 | Bacteria | 6228 |
| 588 | Ga0501082_0479251 | 3300060353 | Unclassified | 1087 |
| 589 | Ga0466962_0025543 | 3300061719 | Unclassified | 2836 |
| 590 | 2738727077 | 2738541278 | Bacteria | 9755573 |
| 591 | Ga0068868_100426980 | |||
| 592 | JGI24751J29686_10002957 | |||
| 593 | rootH1_10109431 | |||
| 594 | rootH2_10003679 | |||
| 595 | rootH2_10020680 | |||
| 596 | rootH2_10072325 | |||
| 597 | rootH2_10074128 | |||
| 598 | rootL2_10107609 | |||
| 599 | rootL2_10124109 | |||
| 600 | rootL2_10136350 | |||
| 601 | rootL2_10204225 | |||
| 602 | rootH1_10110681 | |||
| 603 | rootH1_10119412 | |||
| 604 | Ga0070658_10001461 | |||
| 605 | Ga0070676_10000153 | |||
| 606 | Ga0070676_10179580 | |||
| 607 | Ga0070683_100016609 | |||
| 608 | Ga0070690_100020538 | |||
| 609 | Ga0070670_100008495 | |||
| 610 | Ga0070670_100067020 | |||
| 611 | Ga0070670_100097778 | |||
| 612 | Ga0070670_100390012 | |||
| 613 | Ga0070670_100449897 | |||
| 614 | Ga0068869_100005195 | |||
| 615 | Ga0068869_100005944 | |||
| 616 | Ga0068869_100041627 | |||
| 617 | Ga0070666_10000074 | |||
| 618 | Ga0070666_10000209 | |||
| 619 | Ga0070666_10100142 | |||
| 620 | Ga0070680_100000076 | |||
| 621 | Ga0070682_100000717 | |||
| 622 | Ga0068868_100001336 | |||
| 623 | Ga0068868_100006670 | |||
| 624 | Ga0068868_100051402 | |||
| 625 | Ga0068868_100065934 | |||
| 626 | Ga0070689_100106285 | |||
| 627 | Ga0070691_10001594 | |||
| 628 | Ga0070691_10023779 | |||
| 629 | Ga0070691_10097560 | |||
| 630 | Ga0070691_10134032 | |||
| 631 | Ga0070687_100030823 | |||
| 632 | Ga0070661_100138644 | |||
| 633 | Ga0070661_100427580 | |||
| 634 | Ga0070668_100000556 | |||
| 635 | Ga0070669_100173835 | |||
| 636 | Ga0070669_100857641 | |||
| 637 | Ga0070675_100008396 | |||
| 638 | Ga0070675_100030472 | |||
| 639 | Ga0070671_100032781 | |||
| 640 | Ga0070671_100072503 | |||
| 641 | Ga0070674_100030788 | |||
| 642 | Ga0070674_100289624 | |||
| 643 | Ga0070673_100000867 | |||
| 644 | Ga0070673_100030743 | |||
| 645 | Ga0070673_100034889 | |||
| 646 | Ga0070673_100359145 | |||
| 647 | Ga0070673_100807756 | |||
| 648 | Ga0070667_100000812 | |||
| 649 | Ga0070667_100011346 | |||
| 650 | Ga0070667_100024194 | |||
| 651 | Ga0070667_100240218 | |||
| 652 | Ga0070713_100211725 | |||
| 653 | Ga0070701_10350731 | |||
| 654 | Ga0070663_100988873 | |||
| 655 | Ga0070678_100188922 | |||
| 656 | Ga0070678_100236791 | |||
| 657 | Ga0070662_100001017 | |||
| 658 | Ga0070662_100288850 | |||
| 659 | Ga0070681_10010611 | |||
| 660 | Ga0068867_100001726 | |||
| 661 | Ga0070685_10087676 | |||
| 662 | Ga0070685_10250571 | |||
| 663 | Ga0070685_10552019 | |||
| 664 | Ga0070698_100859695 | |||
| 665 | Ga0070679_100001661 | |||
| 666 | Ga0070679_100466867 | |||
| 667 | Ga0070684_100000495 | |||
| 668 | Ga0068853_100003018 | |||
| 669 | Ga0068853_100009002 | |||
| 670 | Ga0068853_100041566 | |||
| 671 | Ga0068853_100044583 | |||
| 672 | Ga0068853_100314240 | |||
| 673 | Ga0068853_100635602 | |||
| 674 | Ga0070672_100000738 | |||
| 675 | Ga0070672_100037754 | |||
| 676 | Ga0070672_100216840 | |||
| 677 | Ga0070686_100688350 | |||
| 678 | Ga0070665_100000001 | |||
| 679 | Ga0070665_100000486 | |||
| 680 | Ga0070665_100135109 | |||
| 681 | Ga0068855_100000089 | |||
| 682 | Ga0068855_100015722 | |||
| 683 | Ga0068855_100021118 | |||
| 684 | Ga0068855_100037687 | |||
| 685 | Ga0068855_100087390 | |||
| 686 | Ga0068855_100606291 | |||
| 687 | Ga0068855_100649447 | |||
| 688 | Ga0070664_100003411 | |||
| 689 | Ga0070664_100007338 | |||
| 690 | Ga0070664_100023463 | |||
| 691 | Ga0068857_100000416 | |||
| 692 | Ga0068857_100028459 | |||
| 693 | Ga0068857_100237949 | |||
| 694 | Ga0068857_100272624 | |||
| 695 | Ga0068856_100019180 | |||
| 696 | Ga0068856_100032809 | |||
| 697 | Ga0068856_100135432 | |||
| 698 | Ga0070702_100031443 | |||
| 699 | Ga0068852_100001789 | |||
| 700 | Ga0068852_100020739 | |||
| 701 | Ga0068852_100041015 | |||
| 702 | Ga0068852_100120012 | |||
| 703 | Ga0068852_100305751 | |||
| 704 | Ga0068852_100468356 | |||
| 705 | Ga0068852_100604334 | |||
| 706 | Ga0068852_100844370 | |||
| 707 | Ga0068852_101177689 | |||
| 708 | Ga0068859_100000064 | |||
| 709 | Ga0068859_100050734 | |||
| 710 | Ga0068859_100251870 | |||
| 711 | Ga0068859_100300907 | |||
| 712 | Ga0068864_100002330 | |||
| 713 | Ga0068864_100003479 | |||
| 714 | Ga0068864_100039621 | |||
| 715 | Ga0068864_100170306 | |||
| 716 | Ga0068861_100011630 | |||
| 717 | Ga0068851_10022342 | |||
| 718 | Ga0068863_100000858 | |||
| 719 | Ga0068863_100012459 | |||
| 720 | Ga0068863_100024789 | |||
| 721 | Ga0068863_100852885 | |||
| 722 | Ga0068858_100002789 | |||
| 723 | Ga0068858_100661505 | |||
| 724 | Ga0068860_100000046 | |||
| 725 | Ga0068860_100007897 | |||
| 726 | Ga0068860_100011746 | |||
| 727 | Ga0068860_100012477 | |||
| 728 | Ga0068860_100012918 | |||
| 729 | Ga0068860_100015187 | |||
| 730 | Ga0068860_100136613 | |||
| 731 | Ga0068862_100167700 | |||
| 732 | Ga0081540_1022784 | |||
| 733 | Ga0075366_10185249 | |||
| 734 | Ga0097621_100004653 | |||
| 735 | Ga0097621_100019318 | |||
| 736 | Ga0097621_100163339 | |||
| 737 | Ga0097621_100190479 | |||
| 738 | Ga0068871_100008209 | |||
| 739 | Ga0068871_100011119 | |||
| 740 | Ga0068871_100116764 | |||
| 741 | Ga0068871_100387629 | |||
| 742 | Ga0068871_100462975 | |||
| 743 | Ga0068871_100664275 | |||
| 744 | Ga0068865_100016233 | |||
| 745 | Ga0068865_100388273 | |||
| 746 | Ga0097620_100000064 | |||
| 747 | Ga0097620_100050731 | |||
| 748 | Ga0097620_100251886 | |||
| 749 | Ga0097620_100300914 | |||
| 750 | Ga0105240_10000074 | |||
| 751 | Ga0105240_10000598 | |||
| 752 | Ga0105240_10000626 | |||
| 753 | Ga0105240_10002252 | |||
| 754 | Ga0105240_10002663 | |||
| 755 | Ga0105240_10045603 | |||
| 756 | Ga0105240_10087658 | |||
| 757 | Ga0105240_10107501 | |||
| 758 | Ga0105240_10241179 | |||
| 759 | Ga0105240_10502159 | |||
| 760 | Ga0105240_10652329 | |||
| 761 | Ga0105240_10705661 | |||
| 762 | Ga0105240_11206926 | |||
| 763 | Ga0111539_10019384 | |||
| 764 | Ga0111539_10019555 | |||
| 765 | Ga0105245_10199051 | |||
| 766 | Ga0105245_10684098 | |||
| 767 | Ga0105247_10028400 | |||
| 768 | Ga0114129_10001869 | |||
| 769 | Ga0105243_10135792 | |||
| 770 | Ga0105241_10000224 | |||
| 771 | Ga0105241_10000286 | |||
| 772 | Ga0105241_10001283 | |||
| 773 | Ga0105241_10131934 | |||
| 774 | Ga0105241_10171658 | |||
| 775 | Ga0105241_10194207 | |||
| 776 | Ga0105241_10333532 | |||
| 777 | Ga0105241_10488332 | |||
| 778 | Ga0105242_10026095 | |||
| 779 | Ga0105242_10195105 | |||
| 780 | Ga0105248_10036285 | |||
| 781 | Ga0105248_10341691 | |||
| 782 | Ga0105237_10001565 | |||
| 783 | Ga0105237_10002860 | |||
| 784 | Ga0105237_10011674 | |||
| 785 | Ga0105237_10029888 | |||
| 786 | Ga0105237_10061220 | |||
| 787 | Ga0105237_10092356 | |||
| 788 | Ga0105237_10093460 | |||
| 789 | Ga0105237_10121919 | |||
| 790 | Ga0105238_10004027 | |||
| 791 | Ga0105238_10043224 | |||
| 792 | Ga0105238_10061333 | |||
| 793 | Ga0105249_10004940 | |||
| 794 | Ga0105249_10075570 | |||
| 795 | Ga0105249_10586737 | |||
| 796 | Ga0105239_10000048 | |||
| 797 | Ga0105239_10000785 | |||
| 798 | Ga0105239_10001973 | |||
| 799 | Ga0105239_10002090 | |||
| 800 | Ga0105239_10020299 | |||
| 801 | Ga0105239_10029540 | |||
| 802 | Ga0105239_10069892 | |||
| 803 | Ga0105239_10901527 | |||
| 804 | Ga0105239_11139023 | |||
| 805 | Ga0105246_10052134 | |||
| 806 | Ga0105246_10126760 | |||
| 807 | Ga0157371_10179444 | |||
| 808 | Ga0157370_10001393 | |||
| 809 | Ga0157370_10006375 | |||
| 810 | Ga0157370_10012696 | |||
| 811 | Ga0157369_10020756 | |||
| 812 | Ga0157369_10043244 | |||
| 813 | Ga0157369_10306893 | |||
| 814 | Ga0157374_10000001 | |||
| 815 | Ga0157374_10000841 | |||
| 816 | Ga0157374_10032047 | |||
| 817 | Ga0157374_10032367 | |||
| 818 | Ga0157374_10086125 | |||
| 819 | Ga0157374_10448217 | |||
| 820 | Ga0157374_10859032 | |||
| 821 | Ga0157378_10003436 | |||
| 822 | Ga0157378_10009439 | |||
| 823 | Ga0157378_10074449 | |||
| 824 | Ga0157378_10239492 | |||
| 825 | Ga0157378_10357675 | |||
| 826 | Ga0163162_10000100 | |||
| 827 | Ga0163162_10000190 | |||
| 828 | Ga0163162_10004813 | |||
| 829 | Ga0163162_10004838 | |||
| 830 | Ga0163162_10023347 | |||
| 831 | Ga0157372_10002055 | |||
| 832 | Ga0157372_10004228 | |||
| 833 | Ga0157372_10122684 | |||
| 834 | Ga0157372_10166948 | |||
| 835 | Ga0157372_10226026 | |||
| 836 | Ga0157372_10279973 | |||
| 837 | Ga0157372_10284341 | |||
| 838 | Ga0157372_10378024 | |||
| 839 | Ga0157372_11084510 | |||
| 840 | Ga0157372_11218690 | |||
| 841 | Ga0157375_10000057 | |||
| 842 | Ga0157375_10514729 | |||
| 843 | Ga0157375_10604520 | |||
| 844 | Ga0157375_10740041 | |||
| 845 | Ga0157375_11904272 | |||
| 846 | Ga0163163_10000254 | |||
| 847 | Ga0163163_10005051 | |||
| 848 | Ga0163163_10050798 | |||
| 849 | Ga0163163_10153674 | |||
| 850 | Ga0163163_10271475 | |||
| 851 | Ga0163163_10317958 | |||
| 852 | Ga0163163_11690078 | |||
| 853 | Ga0157380_10308871 | |||
| 854 | Ga0157380_10354634 | |||
| 855 | Ga0157380_10468554 | |||
| 856 | Ga0157380_10473084 | |||
| 857 | Ga0157380_11166912 | |||
| 858 | Ga0157377_10010308 | |||
| 859 | Ga0157377_10045068 | |||
| 860 | Ga0157377_10223269 | |||
| 861 | Ga0157379_10000367 | |||
| 862 | Ga0157379_10022101 | |||
| 863 | Ga0157379_10355958 | |||
| 864 | Ga0157376_10000135 | |||
| 865 | Ga0157376_10000721 | |||
| 866 | Ga0157376_10001835 | |||
| 867 | Ga0157376_10168854 | |||
| 868 | Ga0157376_10221346 | |||
| 869 | Ga0157376_10288534 | |||
| 870 | Ga0157376_10366121 | |||
| 871 | Ga0163161_10028055 | |||
| 872 | Ga0213876_10000584 | |||
| 873 | Ga0209646_1003045 | |||
| 874 | Ga0207656_10001696 | |||
| 875 | Ga0207656_10122717 | |||
| 876 | Ga0207682_10035070 | |||
| 877 | Ga0207680_10000034 | |||
| 878 | Ga0207680_10003138 | |||
| 879 | Ga0207680_10060155 | |||
| 880 | Ga0207647_10010415 | |||
| 881 | Ga0207647_10031138 | |||
| 882 | Ga0207647_10083179 | |||
| 883 | Ga0207647_10105783 | |||
| 884 | Ga0207645_10114173 | |||
| 885 | Ga0207705_10102421 | |||
| 886 | Ga0207705_10371010 | |||
| 887 | Ga0207654_10000259 | |||
| 888 | Ga0207654_10001139 | |||
| 889 | Ga0207654_10001938 | |||
| 890 | Ga0207654_10055778 | |||
| 891 | Ga0207654_10180630 | |||
| 892 | Ga0207654_10264253 | |||
| 893 | Ga0207707_10000574 | |||
| 894 | Ga0207695_10000071 | |||
| 895 | Ga0207695_10000084 | |||
| 896 | Ga0207695_10000323 | |||
| 897 | Ga0207695_10002490 | |||
| 898 | Ga0207695_10008950 | |||
| 899 | Ga0207695_10011843 | |||
| 900 | Ga0207695_10013620 | |||
| 901 | Ga0207695_10056828 | |||
| 902 | Ga0207695_10062793 | |||
| 903 | Ga0207695_10263796 | |||
| 904 | Ga0207695_10556019 | |||
| 905 | Ga0207671_10001497 | |||
| 906 | Ga0207671_10003026 | |||
| 907 | Ga0207671_10014962 | |||
| 908 | Ga0207671_10016015 | |||
| 909 | Ga0207671_10033385 | |||
| 910 | Ga0207671_10034358 | |||
| 911 | Ga0207671_10065850 | |||
| 912 | Ga0207660_10015280 | |||
| 913 | Ga0207662_10060441 | |||
| 914 | Ga0207649_10043912 | |||
| 915 | Ga0207649_10083835 | |||
| 916 | Ga0207652_10001002 | |||
| 917 | Ga0207681_10119581 | |||
| 918 | Ga0207681_10130910 | |||
| 919 | Ga0207694_10002468 | |||
| 920 | Ga0207694_10077298 | |||
| 921 | Ga0207694_10185812 | |||
| 922 | Ga0207650_10103691 | |||
| 923 | Ga0207650_10124757 | |||
| 924 | Ga0207650_10281047 | |||
| 925 | Ga0207659_10127332 | |||
| 926 | Ga0207659_10212000 | |||
| 927 | Ga0207644_10548126 | |||
| 928 | Ga0207706_10041013 | |||
| 929 | Ga0207706_10194362 | |||
| 930 | Ga0207706_10245924 | |||
| 931 | Ga0207686_10053654 | |||
| 932 | Ga0207670_10126414 | |||
| 933 | Ga0207669_10118403 | |||
| 934 | Ga0207669_10241620 | |||
| 935 | Ga0207704_10377978 | |||
| 936 | Ga0207691_10002120 | |||
| 937 | Ga0207691_10261109 | |||
| 938 | Ga0207691_11013884 | |||
| 939 | Ga0207711_10401283 | |||
| 940 | Ga0207689_10000835 | |||
| 941 | Ga0207689_10056715 | |||
| 942 | Ga0207689_10507115 | |||
| 943 | Ga0207661_10018759 | |||
| 944 | Ga0207661_10045478 | |||
| 945 | Ga0207661_10989508 | |||
| 946 | Ga0207679_10005876 | |||
| 947 | Ga0207679_10502587 | |||
| 948 | Ga0207667_10000135 | |||
| 949 | Ga0207667_10000177 | |||
| 950 | Ga0207667_10027144 | |||
| 951 | Ga0207667_10049014 | |||
| 952 | Ga0207667_10154317 | |||
| 953 | Ga0207667_10174910 | |||
| 954 | Ga0207667_10488968 | |||
| 955 | Ga0207651_10057961 | |||
| 956 | Ga0207651_10154808 | |||
| 957 | Ga0207651_10605799 | |||
| 958 | Ga0207712_10521950 | |||
| 959 | Ga0207668_10001106 | |||
| 960 | Ga0207668_10268256 | |||
| 961 | Ga0207640_10018184 | |||
| 962 | Ga0207658_10000847 | |||
| 963 | Ga0207658_10050105 | |||
| 964 | Ga0207658_10150587 | |||
| 965 | Ga0207677_10002069 | |||
| 966 | Ga0207677_10282537 | |||
| 967 | Ga0207703_10005435 | |||
| 968 | Ga0207703_10027567 | |||
| 969 | Ga0207703_11229141 | |||
| 970 | Ga0207639_10001126 | |||
| 971 | Ga0207639_10108934 | |||
| 972 | Ga0207639_10436163 | |||
| 973 | Ga0207639_10624048 | |||
| 974 | Ga0207708_10196430 | |||
| 975 | Ga0207708_10580926 | |||
| 976 | Ga0207702_10015346 | |||
| 977 | Ga0207702_10034469 | |||
| 978 | Ga0207641_10000082 | |||
| 979 | Ga0207641_10004489 | |||
| 980 | Ga0207641_10018114 | |||
| 981 | Ga0207641_10067188 | |||
| 982 | Ga0207648_10006588 | |||
| 983 | Ga0207648_10228812 | |||
| 984 | Ga0207676_10003890 | |||
| 985 | Ga0207676_10048772 | |||
| 986 | Ga0207676_10146539 | |||
| 987 | Ga0207674_10004100 | |||
| 988 | Ga0207674_10017645 | |||
| 989 | Ga0207674_10060265 | |||
| 990 | Ga0207674_10162745 | |||
| 991 | Ga0207675_100018238 | |||
| 992 | Ga0207683_10363586 | |||
| 993 | Ga0207683_10481148 | |||
| 994 | Ga0207698_10003175 | |||
| 995 | Ga0207698_10035724 | |||
| 996 | Ga0207698_10072886 | |||
| 997 | Ga0207698_10162986 | |||
| 998 | Ga0207698_10204917 | |||
| 999 | Ga0207698_10526679 | |||
| 1000 | Ga0207428_10383096 | |||
| 1001 | Ga0268266_10000049 | |||
| 1002 | Ga0268266_10052022 | |||
| 1003 | Ga0268264_10000041 | |||
| 1004 | Ga0268264_10007632 | |||
| 1005 | Ga0268264_10009632 | |||
| 1006 | Ga0268264_10010772 | |||
| 1007 | Ga0268264_10015145 | |||
| 1008 | Ga0268264_10022898 | |||
| 1009 | Ga0307517_10002048 | |||
| 1010 | Ga0307517_10111481 | |||
| 1011 | Ga0307515_10000412 | |||
| 1012 | Ga0307515_10287936 | |||
| 1013 | Ga0307511_10000042 | |||
| 1014 | Ga0265328_10065155 | |||
| 1015 | Ga0265331_10069401 | |||
| 1016 | Ga0265327_10019937 | |||
| 1017 | Ga0265327_10034648 | |||
| 1018 | Ga0265316_10174620 | |||
| 1019 | Ga0307513_10717081 | |||
| 1020 | Ga0307509_10043286 | |||
| 1021 | Ga0307509_10089103 | |||
| 1022 | Ga0307509_10123637 | |||
| 1023 | Ga0265313_10018685 | |||
| 1024 | Ga0265313_10209541 | |||
| 1025 | Ga0307508_10032628 | |||
| 1026 | Ga0265314_10026919 | |||
| 1027 | Ga0307516_10001770 | |||
| 1028 | Ga0307516_10392332 | |||
| 1029 | Ga0307414_10867993 | |||
| 1030 | Ga0307415_100753825 | |||
| 1031 | Ga0307510_10000091 | |||
| 1032 | Ga0307510_10212567 | |||
| 1033 | Ga0373923_0320373 | |||
| 1034 | Ga0373953_0099937 | |||
| 1035 | Ga0373955_0004303 | |||
| 1036 | Ga0373933_0384958 | |||
| 1037 | Ga0373937_0077855 | |||
| 1038 | Ga0373937_0334704 | |||
| 1039 | Ga0373937_0834719 | |||
| 1040 | Ga0373925_0106299 | |||
| 1041 | Ga0436365_0012565 | |||
| 1042 | Ga0436365_0585774 | |||
| 1043 | Ga0436365_1500732 | |||
| 1044 | Ga0439439_0008322 | |||
| 1045 | Ga0451807_2736319 | |||
| 1046 | Ga0451839_0130283 | |||
| 1047 | Ga0451849_0977074 | |||
| 1048 | Ga0451853_3257709 | |||
| 1049 | Ga0439448_0119532 | |||
| 1050 | Ga0439449_0023445 | |||
| 1051 | Ga0439449_0068874 | |||
| 1052 | Ga0439457_000387 | |||
| 1053 | Ga0439462_0001399 | |||
| 1054 | Ga0451577_0015230 | |||
| 1055 | Ga0466969_0000238 | |||
| 1056 | Ga0466972_0000003 | |||
| 1057 | Ga0466972_0000039 | |||
| 1058 | Ga0466972_0008991 | |||
| 1059 | Ga0466972_0010280 | |||
| 1060 | Ga0466966_0000136 | |||
| 1061 | Ga0466961_0022937 | |||
| 1062 | Ga0466964_0030938 | |||
| 1063 | Ga0466964_0255969 | |||
| 1064 | Ga0466968_0106664 | |||
| 1065 | Ga0466970_0000460 | |||
| 1066 | Ga0466957_0001467 | |||
| 1067 | Ga0466957_0017717 | |||
| 1068 | Ga0466957_0119980 | |||
| 1069 | Ga0466960_0073614 | |||
| 1070 | Ga0466959_0000002 | |||
| 1071 | Ga0466959_0464966 | |||
| 1072 | Ga0495638_0031102 | |||
| 1073 | Ga0495638_0065639 | |||
| 1074 | Ga0495638_0235955 | |||
| 1075 | Ga0495651_0417216 | |||
| 1076 | Ga0495580_0021316 | |||
| 1077 | Ga0495639_0069846 | |||
| 1078 | Ga0495606_0002804 | |||
| 1079 | Ga0495630_0025789 | |||
| 1080 | Ga0495587_0162352 | |||
| 1081 | Ga0495622_0091426 | |||
| 1082 | Ga0495633_0093572 | |||
| 1083 | Ga0495668_0000751 | |||
| 1084 | Ga0495611_0000844 | |||
| 1085 | Ga0495611_0115505 | |||
| 1086 | Ga0495658_0019280 | |||
| 1087 | Ga0495613_0061650 | |||
| 1088 | Ga0495600_0188599 | |||
| 1089 | Ga0495674_0573799 | |||
| 1090 | Ga0495672_0011784 | |||
| 1091 | Ga0495672_0081473 | |||
| 1092 | Ga0495676_0486960 | |||
| 1093 | Ga0495687_000001 | |||
| 1094 | Ga0495684_0339644 | |||
| 1095 | Ga0495686_0000004 | |||
| 1096 | Ga0496104_0561522 | |||
| 1097 | Ga0496108_0342244 | |||
| 1098 | Ga0496109_0036055 | |||
| 1099 | Ga0496110_0070127 | |||
| 1100 | Ga0495682_0056835 | |||
| 1101 | Ga0501032_0337941 | |||
| 1102 | Ga0501033_0250189 | |||
| 1103 | Ga0501034_0013958 | |||
| 1104 | Ga0501034_0245885 | |||
| 1105 | Ga0501034_0497168 | |||
| 1106 | Ga0501036_0156041 | |||
| 1107 | Ga0501037_0226549 | |||
| 1108 | Ga0501038_0192490 | |||
| 1109 | Ga0501038_0413973 | |||
| 1110 | Ga0501039_0037341 | |||
| 1111 | Ga0501043_0156384 | |||
| 1112 | Ga0501043_0744388 | |||
| 1113 | Ga0501047_0038244 | |||
| 1114 | Ga0501047_0075707 | |||
| 1115 | Ga0501047_0174796 | |||
| 1116 | Ga0501047_0633173 | |||
| 1117 | Ga0501048_0258440 | |||
| 1118 | Ga0501067_0009978 | |||
| 1119 | Ga0501068_0231624 | |||
| 1120 | Ga0501069_0304208 | |||
| 1121 | Ga0501070_0095029 | |||
| 1122 | Ga0501070_0291712 | |||
| 1123 | Ga0501071_0441402 | |||
| 1124 | Ga0501073_0032583 | |||
| 1125 | Ga0501074_0272251 | |||
| 1126 | Ga0501217_035753 | |||
| 1127 | Ga0501257_005498 | |||
| 1128 | Ga0501219_000120 | |||
| 1129 | Ga0501225_0084524 | |||
| 1130 | Ga0501080_0127374 | |||
| 1131 | Ga0501080_0418616 | |||
| 1132 | Ga0501080_0576143 | |||
| 1133 | Ga0501080_0743590 | |||
| 1134 | Ga0501080_0843484 | |||
| 1135 | Ga0501083_0020759 | |||
| 1136 | Ga0501241_001569 | |||
| 1137 | Ga0501035_0026939 | |||
| 1138 | Ga0501035_0541089 | |||
| 1139 | Ga0501044_0056805 | |||
| 1140 | Ga0501044_0173085 | |||
| 1141 | Ga0501044_0247887 | |||
| 1142 | Ga0501044_0725374 | |||
| 1143 | Ga0501284_00011 | |||
| 1144 | nmdc:mga0k408_94516_c1 | |||
| 1145 | nmdc:mga05p37_1503_c1 | |||
| 1146 | nmdc:mga09592_47659_c1 | |||
| 1147 | nmdc:mga06r32_118684_c1 | |||
| 1148 | nmdc:mga08y16_226613_c1 | |||
| 1149 | nmdc:mga08y16_410994_c1 | |||
| 1150 | Ga0500578_0000034 | |||
| 1151 | Ga0500646_0007435 | |||
| 1152 | Ga0500646_0022442 | |||
| 1153 | Ga0500646_0197316 | |||
| 1154 | Ga0500583_0000059 | |||
| 1155 | Ga0500583_0000533 | |||
| 1156 | Ga0500583_0002199 | |||
| 1157 | Ga0500583_0353513 | |||
| 1158 | Ga0500650_0169182 | |||
| 1159 | Ga0500556_0098349 | |||
| 1160 | Ga0500562_042713 | |||
| 1161 | Ga0500642_0017989 | |||
| 1162 | Ga0500642_0297796 | |||
| 1163 | Ga0500652_024549 | |||
| 1164 | Ga0500573_0095924 | |||
| 1165 | Ga0500577_0254691 | |||
| 1166 | Ga0500588_0087704 | |||
| 1167 | Ga0500588_0142404 | |||
| 1168 | Ga0500589_011097 | |||
| 1169 | Ga0500604_0003482 | |||
| 1170 | Ga0500616_0008274 | |||
| 1171 | Ga0500616_0182477 | |||
| 1172 | Ga0500622_0010888 | |||
| 1173 | Ga0500622_0042857 | |||
| 1174 | Ga0500622_0251890 | |||
| 1175 | Ga0500636_0021994 | |||
| 1176 | Ga0500637_0025029 | |||
| 1177 | Ga0501084_0015987 | |||
| 1178 | Ga0501082_0479251 | |||
| 1179 | Ga0466962_0025543 | |||
| 1180 | 2738727077 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oho-assembly2.cif.gz_B | crystal structure of the kowx-kow4 domain of human dsif | 0.8089 | 159 | 201 |
| 2v62-assembly2.cif.gz_B | structure of vaccinia-related kinase 2 | 0.7806 | 159 | 190 |
| 8q1z-assembly1.cif.gz_A | crystal structure of human vaccinia-related kinase 2 (vrk-2) bound to ja-296 | 0.7759 | 159 | 192 |
| 7sxi-assembly1.cif.gz_A | solution structure of sds3 capped tudor domain | 0.7698 | 160 | 206 |
| 6kco-assembly3.cif.gz_E | shuguo pwwp in complex with ssdna | 0.7684 | 158 | 201 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WNM3_64_126_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.9178 | 171 | 197 | 2.40.50.140 |
| af_Q8IIS3_1222_1271_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.8459 | 159 | 197 | 2.30.30.60 |
| af_A0A0R0ELK1_770_819_2.30.30.60 | Mainly Beta;Roll;SH3 type barrels.; | 0.8304 | 159 | 197 | 2.30.30.60 |
| af_Q15047_344_410_2.30.30.140 | Mainly Beta;Roll;SH3 type barrels.; | 0.8155 | 159 | 198 | 2.30.30.140 |
| af_Q69T55_240_282_2.30.30.30 | Mainly Beta;Roll;SH3 type barrels.; | 0.8143 | 159 | 197 | 2.30.30.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A496MJX0-F1-model_v4 | deleted | 0.9769 | 159 | 209 |
|
| AF-A0A496MJX0-F1-model_v4 | deleted | 0.9586 | 159 | 209 |
|
| AF-A0A1Q3U027-F1-model_v4 | SprT-like domain-containing protein | 0.9572 | 3 | 202 |
GO:0033554
|
| AF-A0A1E4EAS7-F1-model_v4 | SprT-like domain-containing protein | 0.9562 | 4 | 202 |
GO:0033554
|
| AF-A0A4Q3Q2R9-F1-model_v4 | deleted | 0.9548 | 153 | 209 |
|