F466917

General Info

Members Datasets Scaffolds Average Seq Length
589 289 1178 237

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_43834_c2|nmdc:mga0a205_43834_c2_606_1454
Length 276
Sequence LAEAVAVDLEASAVEEAARAGNDAVQARRFHIPDSRFPMSMTLDELVAQLQKVYGTKLRSVVLYGSAAAGEHIPKRSDYNILVIVDELTMQHLRTGAAVARAWGEEGNPPPLTLTLDEWRGSSDIFPMEYADILERHRVLYGSPPFDGIAVERRNLRLQLEHEAMGKLLKLRQGVLASGGDPKAQIELLAASLSTIMVIFRAAERMHEAVPSTDYERLSREVALRMGFNAEPFVRVVRHVRGTEKIGSSDVSTVLAGYLDGMYQLVSYLDRYQPES

Samples

Sample ID Description Type Environment
1 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
183 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
195 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
208 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
219 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
222 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
226 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
240 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
241 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
247 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
248 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
259 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
260 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
261 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
262 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
263 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
264 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
265 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
266 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
267 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
268 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
269 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
270 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
271 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
272 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
273 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
274 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
281 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
282 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
283 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
284 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.02
Rhizosphere 98.81
Stem 0
Stem Tuber 0
Unclassified 14.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0a205_43834_c2 3300050515 Bacteria 2466
2 Ga0065707_10129182 3300005295 Bacteria 1952
3 Ga0065707_10135730 3300005295 Bacteria 1845
4 Ga0070658_10006351 3300005327 Bacteria 9579
5 Ga0070658_10022567 3300005327 Bacteria 5051
6 Ga0070658_10182417 3300005327 Bacteria 1766
7 Ga0070676_10024644 3300005328 Bacteria 3391
8 Ga0070683_100000870 3300005329 Bacteria 22361
9 Ga0070683_100027040 3300005329 Bacteria 5171
10 Ga0070683_100156254 3300005329 Bacteria 2163
11 Ga0070683_100179899 3300005329 Bacteria 2007
12 Ga0070690_100087951 3300005330 Bacteria 2042
13 Ga0070670_100001355 3300005331 Bacteria 19630
14 Ga0070670_100004550 3300005331 Bacteria 11628
15 Ga0070677_10130832 3300005333 Bacteria 1145
16 Ga0070680_100024669 3300005336 Bacteria 4806
17 Ga0070680_100063221 3300005336 Bacteria 3031
18 Ga0070680_100079817 3300005336 Bacteria 2697
19 Ga0070680_100218152 3300005336 Bacteria 1610
20 Ga0070680_100472973 3300005336 Bacteria 1071
21 Ga0070682_100000534 3300005337 Bacteria 23681
22 Ga0070682_100001078 3300005337 Bacteria 15730
23 Ga0068868_100010776 3300005338 Bacteria 6629
24 Ga0068868_100025566 3300005338 Bacteria 4494
25 Ga0068868_100148718 3300005338 Unclassified 1928
26 Ga0070660_100223376 3300005339 Bacteria 1531
27 Ga0070691_10026302 3300005341 Bacteria 2712
28 Ga0070687_100055560 3300005343 Bacteria 2068
29 Ga0070687_100089797 3300005343 Unclassified 1697
30 Ga0070687_100131601 3300005343 Unclassified 1445
31 Ga0070661_100007976 3300005344 Bacteria 7310
32 Ga0070661_100044014 3300005344 Bacteria 3261
33 Ga0070661_100044520 3300005344 Bacteria 3242
34 Ga0070661_100058425 3300005344 Bacteria 2826
35 Ga0070692_10002668 3300005345 Bacteria 6988
36 Ga0070692_10024638 3300005345 Bacteria 2959
37 Ga0070692_10118099 3300005345 Bacteria 1475
38 Ga0070692_10142141 3300005345 Unclassified 1359
39 Ga0070692_10310148 3300005345 Bacteria 966
40 Ga0070668_100006883 3300005347 Bacteria 8426
41 Ga0070669_100005328 3300005353 Bacteria 9287
42 Ga0070669_100010822 3300005353 Bacteria 6475
43 Ga0070669_100166083 3300005353 Bacteria 1718
44 Ga0070675_100000384 3300005354 Bacteria 29945
45 Ga0070675_100004326 3300005354 Bacteria 10828
46 Ga0070671_100072534 3300005355 Bacteria 2876
47 Ga0070674_100047966 3300005356 Bacteria 2929
48 Ga0070674_100261803 3300005356 Bacteria 1363
49 Ga0070674_100281495 3300005356 Bacteria 1318
50 Ga0070674_100607630 3300005356 Bacteria 925
51 Ga0070673_100031177 3300005364 Bacteria 3999
52 Ga0070673_100388854 3300005364 Bacteria 1245
53 Ga0070688_100159294 3300005365 Bacteria 1549
54 Ga0070659_100038580 3300005366 Bacteria 3726
55 Ga0070659_100083109 3300005366 Bacteria 2559
56 Ga0070667_100040304 3300005367 Bacteria 3916
57 Ga0070667_100143983 3300005367 Bacteria 2089
58 Ga0070667_100549705 3300005367 Bacteria 1061
59 Ga0070703_10185020 3300005406 Bacteria 807
60 Ga0070709_10026432 3300005434 Bacteria 3440
61 Ga0070709_10059637 3300005434 Unclassified 2424
62 Ga0070709_10062909 3300005434 Bacteria 2368
63 Ga0070714_100010440 3300005435 Bacteria 7340
64 Ga0070714_100053239 3300005435 Bacteria 3454
65 Ga0070714_100428354 3300005435 Unclassified 1254
66 Ga0070713_100000317 3300005436 Bacteria 31612
67 Ga0070713_100117303 3300005436 Bacteria 2329
68 Ga0070713_100936598 3300005436 Bacteria 834
69 Ga0070710_10024370 3300005437 Bacteria 3191
70 Ga0070701_10093715 3300005438 Bacteria 1651
71 Ga0070701_10097468 3300005438 Bacteria 1622
72 Ga0070711_100009321 3300005439 Bacteria 6042
73 Ga0070711_100342446 3300005439 Bacteria 1200
74 Ga0070711_100368127 3300005439 Bacteria 1159
75 Ga0070700_100009068 3300005441 Bacteria 5452
76 Ga0070700_100035423 3300005441 Bacteria 3020
77 Ga0070700_100118973 3300005441 Unclassified 1767
78 Ga0070700_100209771 3300005441 Bacteria 1374
79 Ga0070694_100112021 3300005444 Unclassified 1945
80 Ga0070694_100113505 3300005444 Bacteria 1933
81 Ga0070694_100461622 3300005444 Bacteria 1004
82 Ga0070708_100002236 3300005445 Bacteria 14962
83 Ga0070708_100040977 3300005445 Unclassified 4058
84 Ga0070708_100521572 3300005445 Bacteria 1121
85 Ga0070663_100304751 3300005455 Bacteria 1276
86 Ga0070678_100081880 3300005456 Unclassified 2449
87 Ga0070678_100757101 3300005456 Bacteria 879
88 Ga0070662_100000842 3300005457 Bacteria 18859
89 Ga0070662_100030786 3300005457 Bacteria 3759
90 Ga0070662_100139643 3300005457 Bacteria 1876
91 Ga0070681_10000800 3300005458 Bacteria 26235
92 Ga0070681_10001771 3300005458 Bacteria 19367
93 Ga0070681_10003098 3300005458 Bacteria 15444
94 Ga0070681_10037114 3300005458 Archaea 4891
95 Ga0070681_10038562 3300005458 Unclassified 4790
96 Ga0070681_10077799 3300005458 Unclassified 3274
97 Ga0070681_10223704 3300005458 Bacteria 1797
98 Ga0070681_10694172 3300005458 Unclassified 933
99 Ga0068867_100037305 3300005459 Unclassified 3533
100 Ga0068867_100042857 3300005459 Bacteria 3312
101 Ga0068867_100249121 3300005459 Bacteria 1444
102 Ga0070706_100177057 3300005467 Bacteria 1991
103 Ga0070707_100000654 3300005468 Bacteria 34528
104 Ga0070698_100002034 3300005471 Bacteria 22485
105 Ga0070698_100195051 3300005471 Bacteria 1962
106 Ga0070698_100433346 3300005471 Bacteria 1249
107 Ga0070699_100020189 3300005518 Bacteria 5743
108 Ga0070699_100030205 3300005518 Bacteria 4678
109 Ga0070699_100145972 3300005518 Bacteria 2090
110 Ga0070699_100461611 3300005518 Unclassified 1152
111 Ga0070699_100476029 3300005518 Bacteria 1133
112 Ga0070699_100928688 3300005518 Unclassified 797
113 Ga0070679_100001214 3300005530 Bacteria 22691
114 Ga0070679_100024161 3300005530 Bacteria 5954
115 Ga0070679_100039459 3300005530 Bacteria 4692
116 Ga0070679_100068594 3300005530 Bacteria 3537
117 Ga0070679_100341543 3300005530 Bacteria 1445
118 Ga0070679_100774341 3300005530 Unclassified 902
119 Ga0070684_100090693 3300005535 Bacteria 2718
120 Ga0070684_100160073 3300005535 Bacteria 2042
121 Ga0070697_100015262 3300005536 Bacteria 6028
122 Ga0070697_100236756 3300005536 Bacteria 1558
123 Ga0068853_100006414 3300005539 Bacteria 9348
124 Ga0068853_100023233 3300005539 Archaea 5188
125 Ga0068853_100177351 3300005539 Unclassified 1931
126 Ga0070672_100001480 3300005543 Bacteria 14584
127 Ga0070672_100025699 3300005543 Bacteria 4371
128 Ga0070672_100056071 3300005543 Bacteria 3089
129 Ga0070672_100164496 3300005543 Bacteria 1842
130 Ga0070672_100188756 3300005543 Bacteria 1720
131 Ga0070686_100018412 3300005544 Bacteria 4098
132 Ga0070695_100053110 3300005545 Unclassified 2605
133 Ga0070695_100074002 3300005545 Bacteria 2238
134 Ga0070696_100208128 3300005546 Bacteria 1463
135 Ga0070696_100631476 3300005546 Bacteria 866
136 Ga0070693_100037536 3300005547 Bacteria 2702
137 Ga0070693_100298991 3300005547 Unclassified 1084
138 Ga0070693_100413424 3300005547 Unclassified 938
139 Ga0070665_100010948 3300005548 Bacteria 9172
140 Ga0070665_100696889 3300005548 Bacteria 1029
141 Ga0070704_100296251 3300005549 Bacteria 1346
142 Ga0068855_100001191 3300005563 Bacteria 32320
143 Ga0068855_100112866 3300005563 Unclassified 3118
144 Ga0068855_100176908 3300005563 Bacteria 2414
145 Ga0068855_101032694 3300005563 Unclassified 862
146 Ga0070664_100003488 3300005564 Bacteria 12702
147 Ga0070664_100076999 3300005564 Bacteria 2867
148 Ga0070664_100177217 3300005564 Bacteria 1893
149 Ga0070664_100743382 3300005564 Bacteria 915
150 Ga0068857_100001055 3300005577 Bacteria 21351
151 Ga0068857_100005630 3300005577 Bacteria 10707
152 Ga0068857_100013153 3300005577 Bacteria 7212
153 Ga0068854_100243159 3300005578 Bacteria 1434
154 Ga0068854_100810636 3300005578 Unclassified 817
155 Ga0068856_100138620 3300005614 Bacteria 2439
156 Ga0070702_100240871 3300005615 Bacteria 1221
157 Ga0068852_100020977 3300005616 Bacteria 5204
158 Ga0068852_100449935 3300005616 Bacteria 1275
159 Ga0068859_100199798 3300005617 Bacteria 2084
160 Ga0068866_10011017 3300005718 Bacteria 3896
161 Ga0068866_10026518 3300005718 Bacteria 2738
162 Ga0068861_100003148 3300005719 Bacteria 10910
163 Ga0068861_100924621 3300005719 Bacteria 828
164 Ga0068863_100058488 3300005841 Bacteria 3647
165 Ga0068863_100097744 3300005841 Bacteria 2788
166 Ga0068858_100005394 3300005842 Bacteria 12533
167 Ga0068858_100402072 3300005842 Unclassified 1316
168 Ga0068858_100476219 3300005842 Unclassified 1205
169 Ga0068860_100617969 3300005843 Unclassified 1090
170 Ga0068862_100000767 3300005844 Bacteria 31967
171 Ga0068862_100369969 3300005844 Unclassified 1334
172 Ga0070717_10002758 3300006028 Bacteria 12420
173 Ga0070717_10173013 3300006028 Unclassified 1879
174 Ga0070716_100000394 3300006173 Bacteria 17879
175 Ga0070712_100069656 3300006175 Bacteria 2510
176 Ga0070712_100343156 3300006175 Bacteria 1220
177 Ga0075430_100008637 3300006846 Bacteria 8592
178 Ga0075430_100027221 3300006846 Unclassified 4861
179 Ga0075430_100069046 3300006846 Bacteria 2965
180 Ga0075430_100186312 3300006846 Unclassified 1726
181 Ga0075431_100007881 3300006847 Bacteria 10613
182 Ga0075431_100118525 3300006847 Bacteria 2731
183 Ga0075431_100152299 3300006847 Bacteria 2381
184 Ga0075431_100788726 3300006847 Bacteria 924
185 Ga0075433_10007595 3300006852 Bacteria 8605
186 Ga0075433_10025007 3300006852 Bacteria 5046
187 Ga0075433_10123180 3300006852 Bacteria 2303
188 Ga0075434_100007916 3300006871 Bacteria 9850
189 Ga0075434_100008831 3300006871 Bacteria 9379
190 Ga0075434_100027932 3300006871 Bacteria 5539
191 Ga0075434_100082454 3300006871 Bacteria 3213
192 Ga0075429_100241054 3300006880 Bacteria 1584
193 Ga0075429_100264929 3300006880 Bacteria 1505
194 Ga0068865_100007638 3300006881 Bacteria 6658
195 Ga0068865_100307755 3300006881 Unclassified 1270
196 Ga0075436_100039326 3300006914 Bacteria 3265
197 Ga0075436_100080983 3300006914 Bacteria 2250
198 Ga0097620_100199789 3300006931 Bacteria 2084
199 Ga0075435_100009315 3300007076 Bacteria 7101
200 Ga0105240_10122646 3300009093 Bacteria 3127
201 Ga0105240_10240540 3300009093 Unclassified 2099
202 Ga0111539_10020617 3300009094 Bacteria 8119
203 Ga0111539_10042484 3300009094 Bacteria 5458
204 Ga0105245_10003097 3300009098 Bacteria 14881
205 Ga0114129_10191260 3300009147 Bacteria 2778
206 Ga0114129_10522352 3300009147 Bacteria 1548
207 Ga0114129_11036355 3300009147 Bacteria 1031
208 Ga0114129_11268347 3300009147 Bacteria 915
209 Ga0105241_10304778 3300009174 Bacteria 1368
210 Ga0105248_10045401 3300009177 Bacteria 4927
211 Ga0105248_10213538 3300009177 Unclassified 2174
212 Ga0105248_10286877 3300009177 Bacteria 1853
213 Ga0105237_10142202 3300009545 Bacteria 2394
214 Ga0105249_10000186 3300009553 Bacteria 71781
215 Ga0105249_10000946 3300009553 Bacteria 25696
216 Ga0105246_10690033 3300011119 Bacteria 894
217 Ga0157373_10341284 3300013100 Bacteria 1068
218 Ga0157371_10012564 3300013102 Bacteria 6468
219 Ga0157371_10055340 3300013102 Unclassified 2815
220 Ga0157369_10007962 3300013105 Bacteria 12179
221 Ga0157369_10011300 3300013105 Bacteria 10144
222 Ga0157369_10565064 3300013105 Bacteria 1175
223 Ga0157369_10808120 3300013105 Bacteria 963
224 Ga0157369_11131586 3300013105 Unclassified 800
225 Ga0157374_10035487 3300013296 Bacteria 4562
226 Ga0157374_10158174 3300013296 Unclassified 2206
227 Ga0157374_10168630 3300013296 Bacteria 2135
228 Ga0157378_10021351 3300013297 Bacteria 5693
229 Ga0157378_10090777 3300013297 Bacteria 2776
230 Ga0157378_10321264 3300013297 Unclassified 1504
231 Ga0157378_10433483 3300013297 Unclassified 1301
232 Ga0157378_10641442 3300013297 Unclassified 1077
233 Ga0163162_10002623 3300013306 Bacteria 17053
234 Ga0163162_10026901 3300013306 Bacteria 5689
235 Ga0157372_10005925 3300013307 Bacteria 12999
236 Ga0157372_10025551 3300013307 Bacteria 6424
237 Ga0157372_10070416 3300013307 Bacteria 3935
238 Ga0157372_10125836 3300013307 Unclassified 2947
239 Ga0157372_10160743 3300013307 Bacteria 2596
240 Ga0157372_10603135 3300013307 Bacteria 1280
241 Ga0157372_10994985 3300013307 Unclassified 971
242 Ga0157372_11094136 3300013307 Unclassified 922
243 Ga0157375_10017485 3300013308 Bacteria 6472
244 Ga0157375_10731138 3300013308 Unclassified 1142
245 Ga0157375_10886821 3300013308 Bacteria 1037
246 Ga0163163_10296027 3300014325 Unclassified 1670
247 Ga0157380_10053233 3300014326 Bacteria 3208
248 Ga0157380_10058794 3300014326 Bacteria 3066
249 Ga0157377_10048302 3300014745 Bacteria 2387
250 Ga0157377_10316521 3300014745 Unclassified 1035
251 Ga0157379_10000492 3300014968 Bacteria 32096
252 Ga0182007_10077973 3300015262 Bacteria 1086
253 Ga0163161_10100755 3300017792 Bacteria 2150
254 Ga0163161_10456039 3300017792 Bacteria 1034
255 Ga0206353_12004384 3300020082 Bacteria 857
256 Ga0207692_10069383 3300025898 Bacteria 1852
257 Ga0207642_10046261 3300025899 Bacteria 1937
258 Ga0207642_10089681 3300025899 Bacteria 1515
259 Ga0207642_10187845 3300025899 Bacteria 1131
260 Ga0207688_10120794 3300025901 Bacteria 1529
261 Ga0207699_10004282 3300025906 Bacteria 6824
262 Ga0207699_10324363 3300025906 Bacteria 1081
263 Ga0207645_10000103 3300025907 Bacteria 62417
264 Ga0207705_10001522 3300025909 Bacteria 18397
265 Ga0207705_10035127 3300025909 Bacteria 3586
266 Ga0207705_10307234 3300025909 Bacteria 1217
267 Ga0207684_10206455 3300025910 Bacteria 1695
268 Ga0207654_10217105 3300025911 Bacteria 1266
269 Ga0207707_10000262 3300025912 Bacteria 56811
270 Ga0207707_10001365 3300025912 Bacteria 22660
271 Ga0207707_10003848 3300025912 Bacteria 13301
272 Ga0207707_10008672 3300025912 Bacteria 8823
273 Ga0207707_10010620 3300025912 Bacteria 7998
274 Ga0207695_10064471 3300025913 Bacteria 3772
275 Ga0207693_10078108 3300025915 Bacteria 2591
276 Ga0207693_10309787 3300025915 Bacteria 1236
277 Ga0207663_10163394 3300025916 Unclassified 1575
278 Ga0207663_10318010 3300025916 Bacteria 1169
279 Ga0207660_10034194 3300025917 Unclassified 3521
280 Ga0207660_10046371 3300025917 Bacteria 3066
281 Ga0207660_10424561 3300025917 Bacteria 1073
282 Ga0207662_10058406 3300025918 Bacteria 2309
283 Ga0207662_10097856 3300025918 Bacteria 1814
284 Ga0207662_10158252 3300025918 Unclassified 1445
285 Ga0207657_10046186 3300025919 Bacteria 3816
286 Ga0207657_10130472 3300025919 Unclassified 2060
287 Ga0207649_10022356 3300025920 Bacteria 3652
288 Ga0207649_10028337 3300025920 Bacteria 3297
289 Ga0207652_10007847 3300025921 Bacteria 8568
290 Ga0207652_10010704 3300025921 Bacteria 7383
291 Ga0207652_10012239 3300025921 Bacteria 6932
292 Ga0207652_10044671 3300025921 Unclassified 3775
293 Ga0207652_10067012 3300025921 Bacteria 3112
294 Ga0207652_10268508 3300025921 Bacteria 1539
295 Ga0207652_10720265 3300025921 Bacteria 889
296 Ga0207646_10002582 3300025922 Bacteria 21380
297 Ga0207681_10002985 3300025923 Bacteria 10634
298 Ga0207681_10008013 3300025923 Bacteria 6462
299 Ga0207650_10008218 3300025925 Bacteria 7121
300 Ga0207650_10055202 3300025925 Bacteria 2948
301 Ga0207650_10644028 3300025925 Bacteria 893
302 Ga0207659_10005775 3300025926 Bacteria 7543
303 Ga0207659_10442260 3300025926 Bacteria 1094
304 Ga0207687_10123225 3300025927 Bacteria 1942
305 Ga0207700_10000640 3300025928 Bacteria 20431
306 Ga0207700_10039032 3300025928 Bacteria 3452
307 Ga0207664_10054370 3300025929 Unclassified 3172
308 Ga0207644_10184739 3300025931 Bacteria 1636
309 Ga0207690_10197731 3300025932 Bacteria 1525
310 Ga0207706_10000292 3300025933 Bacteria 54285
311 Ga0207706_10001490 3300025933 Bacteria 23259
312 Ga0207706_10032178 3300025933 Bacteria 4671
313 Ga0207686_10206349 3300025934 Bacteria 1410
314 Ga0207670_10051617 3300025936 Bacteria 2762
315 Ga0207669_10022759 3300025937 Bacteria 3335
316 Ga0207669_10173513 3300025937 Bacteria 1537
317 Ga0207669_10252385 3300025937 Bacteria 1314
318 Ga0207704_10010519 3300025938 Bacteria 4519
319 Ga0207704_10133617 3300025938 Unclassified 1723
320 Ga0207665_10003672 3300025939 Bacteria 10249
321 Ga0207691_10000329 3300025940 Bacteria 47290
322 Ga0207691_10008002 3300025940 Bacteria 10165
323 Ga0207691_10018309 3300025940 Bacteria 6635
324 Ga0207691_10588110 3300025940 Unclassified 943
325 Ga0207691_10681038 3300025940 Unclassified 868
326 Ga0207711_10196531 3300025941 Bacteria 1840
327 Ga0207689_10007872 3300025942 Bacteria 9309
328 Ga0207661_10008647 3300025944 Bacteria 7276
329 Ga0207661_10048024 3300025944 Bacteria 3391
330 Ga0207661_10057735 3300025944 Bacteria 3122
331 Ga0207661_10132261 3300025944 Bacteria 2139
332 Ga0207661_10436167 3300025944 Unclassified 1191
333 Ga0207679_10003851 3300025945 Bacteria 9304
334 Ga0207679_10020149 3300025945 Bacteria 4496
335 Ga0207679_10023811 3300025945 Bacteria 4192
336 Ga0207679_10499841 3300025945 Bacteria 1085
337 Ga0207667_10004964 3300025949 Bacteria 16251
338 Ga0207667_10311694 3300025949 Unclassified 1607
339 Ga0207651_10039161 3300025960 Bacteria 3123
340 Ga0207651_10726910 3300025960 Unclassified 876
341 Ga0207712_10000260 3300025961 Bacteria 51278
342 Ga0207712_10014413 3300025961 Bacteria 5086
343 Ga0207668_10002406 3300025972 Bacteria 10942
344 Ga0207640_10295043 3300025981 Bacteria 1280
345 Ga0207658_10030544 3300025986 Bacteria 3816
346 Ga0207658_10063151 3300025986 Bacteria 2775
347 Ga0207658_10487714 3300025986 Bacteria 1096
348 Ga0207677_10003138 3300026023 Bacteria 8716
349 Ga0207677_10036526 3300026023 Bacteria 3203
350 Ga0207677_10092467 3300026023 Bacteria 2202
351 Ga0207703_10069783 3300026035 Bacteria 2899
352 Ga0207639_10142551 3300026041 Unclassified 1998
353 Ga0207639_10395190 3300026041 Bacteria 1244
354 Ga0207678_10458006 3300026067 Bacteria 1109
355 Ga0207708_10007358 3300026075 Bacteria 8135
356 Ga0207708_10021862 3300026075 Bacteria 4827
357 Ga0207708_10085049 3300026075 Unclassified 2433
358 Ga0207708_10169117 3300026075 Bacteria 1730
359 Ga0207641_10039956 3300026088 Bacteria 3925
360 Ga0207648_10044638 3300026089 Bacteria 3889
361 Ga0207648_10101498 3300026089 Bacteria 2521
362 Ga0207648_10147407 3300026089 Unclassified 2076
363 Ga0207648_10561170 3300026089 Bacteria 1050
364 Ga0207676_10139351 3300026095 Unclassified 2074
365 Ga0207676_10886510 3300026095 Bacteria 874
366 Ga0207674_10002656 3300026116 Bacteria 22323
367 Ga0207674_10009235 3300026116 Bacteria 11303
368 Ga0207675_100000024 3300026118 Bacteria 114684
369 Ga0207675_100550570 3300026118 Bacteria 1153
370 Ga0207683_10055220 3300026121 Unclassified 3483
371 Ga0207683_10364219 3300026121 Bacteria 1328
372 Ga0207683_10462899 3300026121 Bacteria 1169
373 Ga0207698_10059593 3300026142 Bacteria 2965
374 Ga0207698_10745877 3300026142 Bacteria 978
375 Ga0209969_1001324 3300027360 Unclassified 3403
376 Ga0209995_1016679 3300027471 Bacteria 1207
377 Ga0209966_1021306 3300027695 Unclassified 1260
378 Ga0209998_10000482 3300027717 Bacteria 11002
379 Ga0209974_10021978 3300027876 Unclassified 2112
380 Ga0207428_10163728 3300027907 Bacteria 1688
381 Ga0268266_10629471 3300028379 Bacteria 1032
382 Ga0268266_10695622 3300028379 Bacteria 980
383 Ga0268265_10000144 3300028380 Bacteria 90132
384 Ga0268265_10056681 3300028380 Bacteria 2982
385 Ga0268265_10641914 3300028380 Bacteria 1019
386 Ga0268264_10005819 3300028381 Bacteria 10451
387 Ga0307408_100008152 3300031548 Bacteria 6919
388 Ga0307408_100017421 3300031548 Bacteria 4807
389 Ga0307408_100355963 3300031548 Bacteria 1244
390 Ga0307408_100364220 3300031548 Bacteria 1231
391 Ga0307405_10000447 3300031731 Bacteria 15431
392 Ga0307405_10114382 3300031731 Bacteria 1834
393 Ga0307405_10256474 3300031731 Bacteria 1304
394 Ga0307405_10510554 3300031731 Bacteria 965
395 Ga0307413_10005352 3300031824 Bacteria 5717
396 Ga0307413_10012250 3300031824 Bacteria 4260
397 Ga0307413_10146587 3300031824 Unclassified 1639
398 Ga0307410_10000313 3300031852 Bacteria 18871
399 Ga0307410_10003576 3300031852 Bacteria 7829
400 Ga0307410_10038178 3300031852 Bacteria 3144
401 Ga0307410_10580140 3300031852 Bacteria 933
402 Ga0307406_10006081 3300031901 Bacteria 6634
403 Ga0307406_10035238 3300031901 Bacteria 3076
404 Ga0307406_10046842 3300031901 Bacteria 2722
405 Ga0307406_10082371 3300031901 Bacteria 2142
406 Ga0307406_10207492 3300031901 Unclassified 1447
407 Ga0307406_10357043 3300031901 Unclassified 1144
408 Ga0307407_10002969 3300031903 Bacteria 6807
409 Ga0307412_10001848 3300031911 Bacteria 11734
410 Ga0307412_10108677 3300031911 Bacteria 1976
411 Ga0307412_10181330 3300031911 Bacteria 1584
412 Ga0307412_10792520 3300031911 Unclassified 822
413 Ga0307409_100020313 3300031995 Bacteria 4523
414 Ga0307409_100035204 3300031995 Bacteria 3666
415 Ga0307409_100062385 3300031995 Bacteria 2918
416 Ga0307409_100076416 3300031995 Bacteria 2685
417 Ga0307409_100217691 3300031995 Unclassified 1722
418 Ga0307409_100312426 3300031995 Bacteria 1467
419 Ga0307416_100039748 3300032002 Bacteria 3646
420 Ga0307416_100048580 3300032002 Bacteria 3368
421 Ga0307416_100155073 3300032002 Bacteria 2107
422 Ga0307416_100312232 3300032002 Unclassified 1569
423 Ga0307416_101109583 3300032002 Bacteria 896
424 Ga0307414_10583315 3300032004 Bacteria 1001
425 Ga0307411_10025906 3300032005 Bacteria 3521
426 Ga0307411_10057050 3300032005 Bacteria 2577
427 Ga0307411_10061913 3300032005 Bacteria 2494
428 Ga0307411_10144102 3300032005 Bacteria 1761
429 Ga0307411_10173358 3300032005 Bacteria 1629
430 Ga0307411_10330026 3300032005 Bacteria 1236
431 Ga0307415_100071559 3300032126 Bacteria 2439
432 Ga0307415_100357592 3300032126 Bacteria 1232
433 Ga0373950_0054040 3300034818 Bacteria 794
434 Ga0373926_0034851 3300035083 Bacteria 1783
435 Ga0373926_0084758 3300035083 Bacteria 1175
436 Ga0373934_0001566 3300035086 Bacteria 8390
437 Ga0373944_0003476 3300035089 Bacteria 4071
438 Ga0373944_0051774 3300035089 Unclassified 1296
439 Ga0373923_0002824 3300035111 Bacteria 5443
440 Ga0373936_0178031 3300035113 Bacteria 932
441 Ga0373941_0009301 3300035115 Bacteria 2470
442 Ga0373945_0008997 3300035116 Unclassified 3265
443 Ga0373953_0043095 3300035117 Bacteria 1800
444 Ga0373954_0040733 3300035118 Bacteria 2164
445 Ga0373956_0001312 3300035119 Bacteria 10286
446 Ga0373943_0000833 3300035170 Bacteria 13595
447 Ga0373946_0007945 3300035171 Bacteria 3895
448 Ga0373955_0002647 3300035172 Bacteria 7834
449 Ga0373924_0002303 3300035410 Bacteria 6407
450 Ga0373931_0141900 3300035691 Bacteria 1392
451 Ga0373935_0003163 3300035692 Bacteria 9491
452 Ga0373935_0068359 3300035692 Bacteria 2286
453 Ga0373935_0202037 3300035692 Bacteria 1373
454 Ga0373927_0002038 3300035695 Bacteria 14882
455 Ga0373933_0000305 3300035724 Bacteria 31659
456 Ga0373947_0004080 3300035725 Bacteria 8597
457 Ga0373947_0134525 3300035725 Bacteria 1581
458 Ga0373937_0001214 3300036401 Bacteria 21668
459 Ga0373925_0000472 3300037068 Bacteria 40154
460 Ga0373925_0197917 3300037068 Bacteria 1597
461 Ga0373925_0675466 3300037068 Bacteria 851
462 Ga0395900_0553762 3300037418 Bacteria 1094
463 Ga0395905_0014889 3300037471 Bacteria 7421
464 Ga0395901_0000690 3300038443 Bacteria 38627
465 Ga0436365_1460635 3300039437 Bacteria 1103
466 Ga0439462_0030083 3300042015 Bacteria 1436
467 Ga0439434_0111061 3300042435 Bacteria 888
468 Ga0466959_0215180 3300045049 Bacteria 1334
469 Ga0451576_0074490 3300045051 Bacteria 3533
470 Ga0451576_0108508 3300045051 Bacteria 2888
471 Ga0451576_0673827 3300045051 Bacteria 1087
472 Ga0466967_0136869 3300045976 Bacteria 2278
473 Ga0495592_0001353 3300046454 Bacteria 16950
474 Ga0495603_0009413 3300046455 Bacteria 5905
475 Ga0495629_0005301 3300046459 Bacteria 9640
476 Ga0495651_0000448 3300046462 Bacteria 31774
477 Ga0495653_0001606 3300046463 Bacteria 17765
478 Ga0495653_0333370 3300046463 Bacteria 980
479 Ga0495580_0000284 3300046472 Bacteria 41171
480 Ga0495582_0006170 3300046473 Bacteria 6669
481 Ga0495639_0000089 3300046475 Bacteria 44172
482 Ga0495594_0011875 3300046499 Bacteria 4531
483 Ga0495608_0000482 3300046511 Bacteria 27697
484 Ga0495628_0020472 3300046516 Bacteria 5454
485 Ga0495628_0050662 3300046516 Bacteria 3284
486 Ga0495630_0009968 3300046517 Bacteria 6841
487 Ga0495630_0105359 3300046517 Bacteria 2135
488 Ga0495652_0005176 3300046529 Bacteria 12329
489 Ga0495652_0009560 3300046529 Bacteria 8804
490 Ga0495665_0000018 3300046531 Bacteria 62843
491 Ga0495665_0048405 3300046531 Bacteria 2254
492 Ga0495665_0149969 3300046531 Bacteria 1217
493 Ga0495640_0052009 3300046533 Bacteria 2814
494 Ga0495587_0024773 3300046536 Bacteria 3674
495 Ga0495587_0034922 3300046536 Bacteria 3031
496 Ga0495645_0001613 3300046543 Bacteria 15266
497 Ga0495667_0002048 3300046559 Bacteria 13376
498 Ga0495667_0012094 3300046559 Bacteria 5846
499 Ga0495634_0159790 3300046642 Bacteria 1421
500 Ga0495635_0002137 3300046663 Bacteria 13408
501 Ga0495635_0235725 3300046663 Unclassified 1235
502 Ga0495588_0338436 3300046674 Bacteria 791
503 Ga0495657_0000832 3300046675 Bacteria 27258
504 Ga0495599_0001031 3300046678 Bacteria 15639
505 Ga0495599_0025820 3300046678 Bacteria 3680
506 Ga0495599_0094851 3300046678 Bacteria 1861
507 Ga0495623_0000618 3300046679 Bacteria 23684
508 Ga0495658_0029809 3300046683 Bacteria 2957
509 Ga0495613_0006034 3300046689 Bacteria 9065
510 Ga0495600_0000463 3300046809 Bacteria 21090
511 Ga0495600_0129898 3300046809 Bacteria 1638
512 Ga0495581_0000124 3300047315 Bacteria 33166
513 Ga0495604_0000184 3300047317 Bacteria 55687
514 Ga0495674_0004278 3300047319 Bacteria 13739
515 Ga0495674_0004511 3300047319 Bacteria 13392
516 Ga0495680_0020091 3300047322 Bacteria 5628
517 Ga0495675_0007957 3300047444 Bacteria 6555
518 Ga0495684_0001087 3300047471 Bacteria 21918
519 Ga0495684_0001473 3300047471 Bacteria 18840
520 Ga0495593_0000056 3300047673 Bacteria 47474
521 Ga0495593_0278866 3300047673 Bacteria 836
522 Ga0495602_0009326 3300048088 Bacteria 10212
523 Ga0495614_0000019 3300048089 Bacteria 49609
524 Ga0496108_0030907 3300048911 Bacteria 4439
525 Ga0496112_0002761 3300048915 Bacteria 14238
526 Ga0496112_0066861 3300048915 Bacteria 3547
527 Ga0496112_0224522 3300048915 Unclassified 1834
528 Ga0496112_0388820 3300048915 Bacteria 1335
529 Ga0496115_0058217 3300048918 Bacteria 3109
530 Ga0501033_0013016 3300049570 Bacteria 6344
531 Ga0501034_0111127 3300049571 Bacteria 2731
532 Ga0501036_0024888 3300049572 Bacteria 5049
533 Ga0501043_0024170 3300049579 Bacteria 4768
534 Ga0501047_0023510 3300049581 Bacteria 5915
535 Ga0501048_0249010 3300049582 Bacteria 1261
536 Ga0501199_009358 3300049650 Unclassified 1035
537 Ga0501202_049470 3300049652 Unclassified 928
538 Ga0501207_006885 3300049654 Unclassified 1608
539 Ga0501217_034587 3300049661 Bacteria 1261
540 Ga0501233_000321 3300049668 Bacteria 7383
541 Ga0501235_000133 3300049669 Bacteria 12374
542 Ga0501240_002306 3300049673 Bacteria 2007
543 Ga0501249_017578 3300049679 Bacteria 1541
544 Ga0501250_003984 3300049680 Bacteria 1449
545 Ga0501257_007220 3300049686 Bacteria 2481
546 Ga0501259_004934 3300049688 Bacteria 2115
547 Ga0501261_011364 3300049690 Bacteria 1185
548 Ga0501221_002131 3300049704 Bacteria 3291
549 Ga0501225_0000652 3300049705 Bacteria 10800
550 Ga0501268_000066 3300049765 Bacteria 8285
551 Ga0501269_014268 3300049766 Bacteria 974
552 Ga0501273_015140 3300049770 Bacteria 999
553 Ga0501035_0362907 3300049822 Bacteria 1210
554 Ga0501044_0013875 3300049823 Bacteria 8706
555 Ga0501212_025091 3300049851 Bacteria 940
556 nmdc:mga05p37_1030053_c1 3300050507 Bacteria 871
557 nmdc:mga05p37_170310_c1 3300050507 Bacteria 2656
558 nmdc:mga09592_205259_c1 3300050508 Bacteria 1707
559 nmdc:mga0qj67_248991_c1 3300050509 Bacteria 1442
560 nmdc:mga0qj67_24955_c1 3300050509 Bacteria 4614
561 nmdc:mga0qj67_4887_c1 3300050509 Bacteria 9744
562 nmdc:mga0qj67_86856_c1 3300050509 Bacteria 2510
563 nmdc:mga06r32_175559_c1 3300050510 Bacteria 2127
564 nmdc:mga06r32_19167_c1 3300050510 Bacteria 6278
565 nmdc:mga06r32_443629_c1 3300050510 Bacteria 1278
566 nmdc:mga06r32_763969_c1 3300050510 Bacteria 929
567 nmdc:mga06r32_825992_c1 3300050510 Unclassified 886
568 nmdc:mga08y16_170035_c1 3300050511 Unclassified 2264
569 nmdc:mga08y16_42500_c1 3300050511 Bacteria 4760
570 nmdc:mga08y16_54207_c1 3300050511 Unclassified 4190
571 nmdc:mga08y16_554293_c1 3300050511 Bacteria 1163
572 nmdc:mga0n895_11816_c1 3300050512 Bacteria 7807
573 nmdc:mga0n895_13819_c1 3300050512 Bacteria 7305
574 nmdc:mga0n895_33210_c1 3300050512 Bacteria 4957
575 nmdc:mga0n895_424_c1 3300050512 Bacteria 28339
576 nmdc:mga0n895_649293_c1 3300050512 Bacteria 1054
577 nmdc:mga0rr50_11711_c1 3300050513 Bacteria 5629
578 nmdc:mga0rr50_421246_c1 3300050513 Bacteria 1129
579 nmdc:mga08x19_27276_c1 3300050514 Bacteria 3571
580 nmdc:mga08x19_94759_c1 3300050514 Bacteria 1974
581 nmdc:mga0a205_178683_c1 3300050515 Bacteria 2017
582 nmdc:mga0a205_248636_c1 3300050515 Unclassified 1658
583 nmdc:mga0a205_25938_c1 3300050515 Bacteria 5584
584 nmdc:mga0a205_8934_c1 3300050515 Bacteria 9133
585 Ga0495601_0010260 3300053077 Bacteria 5570
586 Ga0495612_0009758 3300053078 Bacteria 3889
587 Ga0495595_0028434 3300053084 Bacteria 2497
588 Ga0495619_0059542 3300053085 Bacteria 2537
589 Ga0495619_0463697 3300053085 Bacteria 873
590 nmdc:mga0a205_43834_c2
591 Ga0065707_10129182
592 Ga0065707_10135730
593 Ga0070658_10006351
594 Ga0070658_10022567
595 Ga0070658_10182417
596 Ga0070676_10024644
597 Ga0070683_100000870
598 Ga0070683_100027040
599 Ga0070683_100156254
600 Ga0070683_100179899
601 Ga0070690_100087951
602 Ga0070670_100001355
603 Ga0070670_100004550
604 Ga0070677_10130832
605 Ga0070680_100024669
606 Ga0070680_100063221
607 Ga0070680_100079817
608 Ga0070680_100218152
609 Ga0070680_100472973
610 Ga0070682_100000534
611 Ga0070682_100001078
612 Ga0068868_100010776
613 Ga0068868_100025566
614 Ga0068868_100148718
615 Ga0070660_100223376
616 Ga0070691_10026302
617 Ga0070687_100055560
618 Ga0070687_100089797
619 Ga0070687_100131601
620 Ga0070661_100007976
621 Ga0070661_100044014
622 Ga0070661_100044520
623 Ga0070661_100058425
624 Ga0070692_10002668
625 Ga0070692_10024638
626 Ga0070692_10118099
627 Ga0070692_10142141
628 Ga0070692_10310148
629 Ga0070668_100006883
630 Ga0070669_100005328
631 Ga0070669_100010822
632 Ga0070669_100166083
633 Ga0070675_100000384
634 Ga0070675_100004326
635 Ga0070671_100072534
636 Ga0070674_100047966
637 Ga0070674_100261803
638 Ga0070674_100281495
639 Ga0070674_100607630
640 Ga0070673_100031177
641 Ga0070673_100388854
642 Ga0070688_100159294
643 Ga0070659_100038580
644 Ga0070659_100083109
645 Ga0070667_100040304
646 Ga0070667_100143983
647 Ga0070667_100549705
648 Ga0070703_10185020
649 Ga0070709_10026432
650 Ga0070709_10059637
651 Ga0070709_10062909
652 Ga0070714_100010440
653 Ga0070714_100053239
654 Ga0070714_100428354
655 Ga0070713_100000317
656 Ga0070713_100117303
657 Ga0070713_100936598
658 Ga0070710_10024370
659 Ga0070701_10093715
660 Ga0070701_10097468
661 Ga0070711_100009321
662 Ga0070711_100342446
663 Ga0070711_100368127
664 Ga0070700_100009068
665 Ga0070700_100035423
666 Ga0070700_100118973
667 Ga0070700_100209771
668 Ga0070694_100112021
669 Ga0070694_100113505
670 Ga0070694_100461622
671 Ga0070708_100002236
672 Ga0070708_100040977
673 Ga0070708_100521572
674 Ga0070663_100304751
675 Ga0070678_100081880
676 Ga0070678_100757101
677 Ga0070662_100000842
678 Ga0070662_100030786
679 Ga0070662_100139643
680 Ga0070681_10000800
681 Ga0070681_10001771
682 Ga0070681_10003098
683 Ga0070681_10037114
684 Ga0070681_10038562
685 Ga0070681_10077799
686 Ga0070681_10223704
687 Ga0070681_10694172
688 Ga0068867_100037305
689 Ga0068867_100042857
690 Ga0068867_100249121
691 Ga0070706_100177057
692 Ga0070707_100000654
693 Ga0070698_100002034
694 Ga0070698_100195051
695 Ga0070698_100433346
696 Ga0070699_100020189
697 Ga0070699_100030205
698 Ga0070699_100145972
699 Ga0070699_100461611
700 Ga0070699_100476029
701 Ga0070699_100928688
702 Ga0070679_100001214
703 Ga0070679_100024161
704 Ga0070679_100039459
705 Ga0070679_100068594
706 Ga0070679_100341543
707 Ga0070679_100774341
708 Ga0070684_100090693
709 Ga0070684_100160073
710 Ga0070697_100015262
711 Ga0070697_100236756
712 Ga0068853_100006414
713 Ga0068853_100023233
714 Ga0068853_100177351
715 Ga0070672_100001480
716 Ga0070672_100025699
717 Ga0070672_100056071
718 Ga0070672_100164496
719 Ga0070672_100188756
720 Ga0070686_100018412
721 Ga0070695_100053110
722 Ga0070695_100074002
723 Ga0070696_100208128
724 Ga0070696_100631476
725 Ga0070693_100037536
726 Ga0070693_100298991
727 Ga0070693_100413424
728 Ga0070665_100010948
729 Ga0070665_100696889
730 Ga0070704_100296251
731 Ga0068855_100001191
732 Ga0068855_100112866
733 Ga0068855_100176908
734 Ga0068855_101032694
735 Ga0070664_100003488
736 Ga0070664_100076999
737 Ga0070664_100177217
738 Ga0070664_100743382
739 Ga0068857_100001055
740 Ga0068857_100005630
741 Ga0068857_100013153
742 Ga0068854_100243159
743 Ga0068854_100810636
744 Ga0068856_100138620
745 Ga0070702_100240871
746 Ga0068852_100020977
747 Ga0068852_100449935
748 Ga0068859_100199798
749 Ga0068866_10011017
750 Ga0068866_10026518
751 Ga0068861_100003148
752 Ga0068861_100924621
753 Ga0068863_100058488
754 Ga0068863_100097744
755 Ga0068858_100005394
756 Ga0068858_100402072
757 Ga0068858_100476219
758 Ga0068860_100617969
759 Ga0068862_100000767
760 Ga0068862_100369969
761 Ga0070717_10002758
762 Ga0070717_10173013
763 Ga0070716_100000394
764 Ga0070712_100069656
765 Ga0070712_100343156
766 Ga0075430_100008637
767 Ga0075430_100027221
768 Ga0075430_100069046
769 Ga0075430_100186312
770 Ga0075431_100007881
771 Ga0075431_100118525
772 Ga0075431_100152299
773 Ga0075431_100788726
774 Ga0075433_10007595
775 Ga0075433_10025007
776 Ga0075433_10123180
777 Ga0075434_100007916
778 Ga0075434_100008831
779 Ga0075434_100027932
780 Ga0075434_100082454
781 Ga0075429_100241054
782 Ga0075429_100264929
783 Ga0068865_100007638
784 Ga0068865_100307755
785 Ga0075436_100039326
786 Ga0075436_100080983
787 Ga0097620_100199789
788 Ga0075435_100009315
789 Ga0105240_10122646
790 Ga0105240_10240540
791 Ga0111539_10020617
792 Ga0111539_10042484
793 Ga0105245_10003097
794 Ga0114129_10191260
795 Ga0114129_10522352
796 Ga0114129_11036355
797 Ga0114129_11268347
798 Ga0105241_10304778
799 Ga0105248_10045401
800 Ga0105248_10213538
801 Ga0105248_10286877
802 Ga0105237_10142202
803 Ga0105249_10000186
804 Ga0105249_10000946
805 Ga0105246_10690033
806 Ga0157373_10341284
807 Ga0157371_10012564
808 Ga0157371_10055340
809 Ga0157369_10007962
810 Ga0157369_10011300
811 Ga0157369_10565064
812 Ga0157369_10808120
813 Ga0157369_11131586
814 Ga0157374_10035487
815 Ga0157374_10158174
816 Ga0157374_10168630
817 Ga0157378_10021351
818 Ga0157378_10090777
819 Ga0157378_10321264
820 Ga0157378_10433483
821 Ga0157378_10641442
822 Ga0163162_10002623
823 Ga0163162_10026901
824 Ga0157372_10005925
825 Ga0157372_10025551
826 Ga0157372_10070416
827 Ga0157372_10125836
828 Ga0157372_10160743
829 Ga0157372_10603135
830 Ga0157372_10994985
831 Ga0157372_11094136
832 Ga0157375_10017485
833 Ga0157375_10731138
834 Ga0157375_10886821
835 Ga0163163_10296027
836 Ga0157380_10053233
837 Ga0157380_10058794
838 Ga0157377_10048302
839 Ga0157377_10316521
840 Ga0157379_10000492
841 Ga0182007_10077973
842 Ga0163161_10100755
843 Ga0163161_10456039
844 Ga0206353_12004384
845 Ga0207692_10069383
846 Ga0207642_10046261
847 Ga0207642_10089681
848 Ga0207642_10187845
849 Ga0207688_10120794
850 Ga0207699_10004282
851 Ga0207699_10324363
852 Ga0207645_10000103
853 Ga0207705_10001522
854 Ga0207705_10035127
855 Ga0207705_10307234
856 Ga0207684_10206455
857 Ga0207654_10217105
858 Ga0207707_10000262
859 Ga0207707_10001365
860 Ga0207707_10003848
861 Ga0207707_10008672
862 Ga0207707_10010620
863 Ga0207695_10064471
864 Ga0207693_10078108
865 Ga0207693_10309787
866 Ga0207663_10163394
867 Ga0207663_10318010
868 Ga0207660_10034194
869 Ga0207660_10046371
870 Ga0207660_10424561
871 Ga0207662_10058406
872 Ga0207662_10097856
873 Ga0207662_10158252
874 Ga0207657_10046186
875 Ga0207657_10130472
876 Ga0207649_10022356
877 Ga0207649_10028337
878 Ga0207652_10007847
879 Ga0207652_10010704
880 Ga0207652_10012239
881 Ga0207652_10044671
882 Ga0207652_10067012
883 Ga0207652_10268508
884 Ga0207652_10720265
885 Ga0207646_10002582
886 Ga0207681_10002985
887 Ga0207681_10008013
888 Ga0207650_10008218
889 Ga0207650_10055202
890 Ga0207650_10644028
891 Ga0207659_10005775
892 Ga0207659_10442260
893 Ga0207687_10123225
894 Ga0207700_10000640
895 Ga0207700_10039032
896 Ga0207664_10054370
897 Ga0207644_10184739
898 Ga0207690_10197731
899 Ga0207706_10000292
900 Ga0207706_10001490
901 Ga0207706_10032178
902 Ga0207686_10206349
903 Ga0207670_10051617
904 Ga0207669_10022759
905 Ga0207669_10173513
906 Ga0207669_10252385
907 Ga0207704_10010519
908 Ga0207704_10133617
909 Ga0207665_10003672
910 Ga0207691_10000329
911 Ga0207691_10008002
912 Ga0207691_10018309
913 Ga0207691_10588110
914 Ga0207691_10681038
915 Ga0207711_10196531
916 Ga0207689_10007872
917 Ga0207661_10008647
918 Ga0207661_10048024
919 Ga0207661_10057735
920 Ga0207661_10132261
921 Ga0207661_10436167
922 Ga0207679_10003851
923 Ga0207679_10020149
924 Ga0207679_10023811
925 Ga0207679_10499841
926 Ga0207667_10004964
927 Ga0207667_10311694
928 Ga0207651_10039161
929 Ga0207651_10726910
930 Ga0207712_10000260
931 Ga0207712_10014413
932 Ga0207668_10002406
933 Ga0207640_10295043
934 Ga0207658_10030544
935 Ga0207658_10063151
936 Ga0207658_10487714
937 Ga0207677_10003138
938 Ga0207677_10036526
939 Ga0207677_10092467
940 Ga0207703_10069783
941 Ga0207639_10142551
942 Ga0207639_10395190
943 Ga0207678_10458006
944 Ga0207708_10007358
945 Ga0207708_10021862
946 Ga0207708_10085049
947 Ga0207708_10169117
948 Ga0207641_10039956
949 Ga0207648_10044638
950 Ga0207648_10101498
951 Ga0207648_10147407
952 Ga0207648_10561170
953 Ga0207676_10139351
954 Ga0207676_10886510
955 Ga0207674_10002656
956 Ga0207674_10009235
957 Ga0207675_100000024
958 Ga0207675_100550570
959 Ga0207683_10055220
960 Ga0207683_10364219
961 Ga0207683_10462899
962 Ga0207698_10059593
963 Ga0207698_10745877
964 Ga0209969_1001324
965 Ga0209995_1016679
966 Ga0209966_1021306
967 Ga0209998_10000482
968 Ga0209974_10021978
969 Ga0207428_10163728
970 Ga0268266_10629471
971 Ga0268266_10695622
972 Ga0268265_10000144
973 Ga0268265_10056681
974 Ga0268265_10641914
975 Ga0268264_10005819
976 Ga0307408_100008152
977 Ga0307408_100017421
978 Ga0307408_100355963
979 Ga0307408_100364220
980 Ga0307405_10000447
981 Ga0307405_10114382
982 Ga0307405_10256474
983 Ga0307405_10510554
984 Ga0307413_10005352
985 Ga0307413_10012250
986 Ga0307413_10146587
987 Ga0307410_10000313
988 Ga0307410_10003576
989 Ga0307410_10038178
990 Ga0307410_10580140
991 Ga0307406_10006081
992 Ga0307406_10035238
993 Ga0307406_10046842
994 Ga0307406_10082371
995 Ga0307406_10207492
996 Ga0307406_10357043
997 Ga0307407_10002969
998 Ga0307412_10001848
999 Ga0307412_10108677
1000 Ga0307412_10181330
1001 Ga0307412_10792520
1002 Ga0307409_100020313
1003 Ga0307409_100035204
1004 Ga0307409_100062385
1005 Ga0307409_100076416
1006 Ga0307409_100217691
1007 Ga0307409_100312426
1008 Ga0307416_100039748
1009 Ga0307416_100048580
1010 Ga0307416_100155073
1011 Ga0307416_100312232
1012 Ga0307416_101109583
1013 Ga0307414_10583315
1014 Ga0307411_10025906
1015 Ga0307411_10057050
1016 Ga0307411_10061913
1017 Ga0307411_10144102
1018 Ga0307411_10173358
1019 Ga0307411_10330026
1020 Ga0307415_100071559
1021 Ga0307415_100357592
1022 Ga0373950_0054040
1023 Ga0373926_0034851
1024 Ga0373926_0084758
1025 Ga0373934_0001566
1026 Ga0373944_0003476
1027 Ga0373944_0051774
1028 Ga0373923_0002824
1029 Ga0373936_0178031
1030 Ga0373941_0009301
1031 Ga0373945_0008997
1032 Ga0373953_0043095
1033 Ga0373954_0040733
1034 Ga0373956_0001312
1035 Ga0373943_0000833
1036 Ga0373946_0007945
1037 Ga0373955_0002647
1038 Ga0373924_0002303
1039 Ga0373931_0141900
1040 Ga0373935_0003163
1041 Ga0373935_0068359
1042 Ga0373935_0202037
1043 Ga0373927_0002038
1044 Ga0373933_0000305
1045 Ga0373947_0004080
1046 Ga0373947_0134525
1047 Ga0373937_0001214
1048 Ga0373925_0000472
1049 Ga0373925_0197917
1050 Ga0373925_0675466
1051 Ga0395900_0553762
1052 Ga0395905_0014889
1053 Ga0395901_0000690
1054 Ga0436365_1460635
1055 Ga0439462_0030083
1056 Ga0439434_0111061
1057 Ga0466959_0215180
1058 Ga0451576_0074490
1059 Ga0451576_0108508
1060 Ga0451576_0673827
1061 Ga0466967_0136869
1062 Ga0495592_0001353
1063 Ga0495603_0009413
1064 Ga0495629_0005301
1065 Ga0495651_0000448
1066 Ga0495653_0001606
1067 Ga0495653_0333370
1068 Ga0495580_0000284
1069 Ga0495582_0006170
1070 Ga0495639_0000089
1071 Ga0495594_0011875
1072 Ga0495608_0000482
1073 Ga0495628_0020472
1074 Ga0495628_0050662
1075 Ga0495630_0009968
1076 Ga0495630_0105359
1077 Ga0495652_0005176
1078 Ga0495652_0009560
1079 Ga0495665_0000018
1080 Ga0495665_0048405
1081 Ga0495665_0149969
1082 Ga0495640_0052009
1083 Ga0495587_0024773
1084 Ga0495587_0034922
1085 Ga0495645_0001613
1086 Ga0495667_0002048
1087 Ga0495667_0012094
1088 Ga0495634_0159790
1089 Ga0495635_0002137
1090 Ga0495635_0235725
1091 Ga0495588_0338436
1092 Ga0495657_0000832
1093 Ga0495599_0001031
1094 Ga0495599_0025820
1095 Ga0495599_0094851
1096 Ga0495623_0000618
1097 Ga0495658_0029809
1098 Ga0495613_0006034
1099 Ga0495600_0000463
1100 Ga0495600_0129898
1101 Ga0495581_0000124
1102 Ga0495604_0000184
1103 Ga0495674_0004278
1104 Ga0495674_0004511
1105 Ga0495680_0020091
1106 Ga0495675_0007957
1107 Ga0495684_0001087
1108 Ga0495684_0001473
1109 Ga0495593_0000056
1110 Ga0495593_0278866
1111 Ga0495602_0009326
1112 Ga0495614_0000019
1113 Ga0496108_0030907
1114 Ga0496112_0002761
1115 Ga0496112_0066861
1116 Ga0496112_0224522
1117 Ga0496112_0388820
1118 Ga0496115_0058217
1119 Ga0501033_0013016
1120 Ga0501034_0111127
1121 Ga0501036_0024888
1122 Ga0501043_0024170
1123 Ga0501047_0023510
1124 Ga0501048_0249010
1125 Ga0501199_009358
1126 Ga0501202_049470
1127 Ga0501207_006885
1128 Ga0501217_034587
1129 Ga0501233_000321
1130 Ga0501235_000133
1131 Ga0501240_002306
1132 Ga0501249_017578
1133 Ga0501250_003984
1134 Ga0501257_007220
1135 Ga0501259_004934
1136 Ga0501261_011364
1137 Ga0501221_002131
1138 Ga0501225_0000652
1139 Ga0501268_000066
1140 Ga0501269_014268
1141 Ga0501273_015140
1142 Ga0501035_0362907
1143 Ga0501044_0013875
1144 Ga0501212_025091
1145 nmdc:mga05p37_1030053_c1
1146 nmdc:mga05p37_170310_c1
1147 nmdc:mga09592_205259_c1
1148 nmdc:mga0qj67_248991_c1
1149 nmdc:mga0qj67_24955_c1
1150 nmdc:mga0qj67_4887_c1
1151 nmdc:mga0qj67_86856_c1
1152 nmdc:mga06r32_175559_c1
1153 nmdc:mga06r32_19167_c1
1154 nmdc:mga06r32_443629_c1
1155 nmdc:mga06r32_763969_c1
1156 nmdc:mga06r32_825992_c1
1157 nmdc:mga08y16_170035_c1
1158 nmdc:mga08y16_42500_c1
1159 nmdc:mga08y16_54207_c1
1160 nmdc:mga08y16_554293_c1
1161 nmdc:mga0n895_11816_c1
1162 nmdc:mga0n895_13819_c1
1163 nmdc:mga0n895_33210_c1
1164 nmdc:mga0n895_424_c1
1165 nmdc:mga0n895_649293_c1
1166 nmdc:mga0rr50_11711_c1
1167 nmdc:mga0rr50_421246_c1
1168 nmdc:mga08x19_27276_c1
1169 nmdc:mga08x19_94759_c1
1170 nmdc:mga0a205_178683_c1
1171 nmdc:mga0a205_248636_c1
1172 nmdc:mga0a205_25938_c1
1173 nmdc:mga0a205_8934_c1
1174 Ga0495601_0010260
1175 Ga0495612_0009758
1176 Ga0495595_0028434
1177 Ga0495619_0059542
1178 Ga0495619_0463697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rff-assembly1.cif.gz_A crystal structure of a putative nucleotidyltransferase (np_343093.1) from sulfolobus solfataricus at 1.40 a resolution 0.6917 5 103
7aer-assembly1.cif.gz_A rebuilt and re-refined pdb entry 5yep: tri-ampylated shewanella oneidensis hepn toxin in complex with mnt antitoxin 0.6831 4 103
7bxo-assembly1.cif.gz_A crystal structure of the toxin-antitoxin with amp-pnp 0.6645 2 103
6m6u-assembly1.cif.gz_F crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e 0.6638 1 107
6m6u-assembly1.cif.gz_A crystal structure the toxin-antitoxin mnta-hpet mutant-d39ed41e 0.6601 1 103
ID Description Score Start End Superfamily
4ebkB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7858 3 50 3.30.460.10
af_Q58701_1_124_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7815 3 106 3.30.460.10
af_Q58021_1_93_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7285 3 85 3.30.460.10
af_P9WN29_1_164_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7234 4 106 3.30.460.10
af_Q57606_1_96_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.7118 1 75 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A7Y5TJA6-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9936 1 233 GO:0016740
AF-A0A2V7JEF2-F1-model_v4 Uncharacterized protein 0.9812 61 232
AF-A0A7Y5TJA6-F1-model_v4 Nucleotidyltransferase domain-containing protein 0.9769 1 233 GO:0016740
AF-A0A1E4B4N5-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9739 1 232
AF-A0A143BIB9-F1-model_v4 Polymerase nucleotidyl transferase domain-containing protein 0.9711 1 233

Map