F466901

General Info

Members Datasets Scaffolds Average Seq Length
589 290 575 254

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0004170|Ga0496104_0004170_11118_11984
Length 288
Sequence MSRSWRAWQVNFRLPSFALQHLRYEKQCLGSGAKAMIEIHQFPCLSDNYGYLVHDGASGETVCIDTPDAGRYLEEAAARGWRITQIWNTHWHADHAGGNTAIKAATGCTITAPLAEAAKIEGVDRTVDQGDTVRLGDHVAQVLAVGGHTLGHVAYHLPDAGAAFVGDALFALGCGRMFEGTAPQFWTSLSRLKALPAATLVYCAHEYTASNARFAVHADPDNADLAAYADEVAQCRAQDLPTVPTSLDRELATNPFLRADDPALQSRWGGGDAVATFAALRAAKDNFR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
3 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
4 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
5 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
6 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
7 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
8 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
9 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
10 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
11 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
12 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
161 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
173 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
183 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
184 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
185 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
186 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
187 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
188 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
189 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
190 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
191 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
192 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
195 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
200 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
203 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
204 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
205 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
231 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
232 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
233 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
234 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
235 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
239 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
240 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
250 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
251 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
252 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
253 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
254 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
255 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
256 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
266 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
267 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
278 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
279 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
280 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
285 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0
Isolates 2.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 0
Rhizoplane 5.43
Rhizosphere 79.97
Stem 0
Stem Tuber 0
Unclassified 8.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1439351 2162886007 Bacteria 1039
2 JGI24034J26672_10021882 3300002239 Bacteria 1007
3 Ga0065704_10082076 3300005289 Bacteria 3642
4 Ga0065704_10131197 3300005289 Bacteria 1627
5 Ga0065704_10201327 3300005289 Bacteria 1145
6 Ga0065707_10135350 3300005295 Bacteria 1851
7 Ga0070658_10000124 3300005327 Bacteria 68224
8 Ga0070658_10005251 3300005327 Bacteria 10525
9 Ga0070658_10228142 3300005327 Bacteria 1576
10 Ga0070658_10265901 3300005327 Bacteria 1457
11 Ga0070683_100029541 3300005329 Bacteria 4964
12 Ga0070683_100043254 3300005329 Bacteria 4151
13 Ga0070683_100176196 3300005329 Bacteria 2030
14 Ga0070690_100002347 3300005330 Bacteria 10176
15 Ga0070670_100153603 3300005331 Bacteria 1993
16 Ga0068869_100018365 3300005334 Bacteria 4759
17 Ga0070666_10019746 3300005335 Bacteria 4353
18 Ga0070666_10188915 3300005335 Bacteria 1447
19 Ga0070666_10210481 3300005335 Bacteria 1369
20 Ga0070680_100005639 3300005336 Bacteria 9484
21 Ga0070680_100011300 3300005336 Bacteria 6904
22 Ga0068868_100017924 3300005338 Bacteria 5283
23 Ga0070660_100004077 3300005339 Bacteria 10082
24 Ga0070660_100022443 3300005339 Bacteria 4667
25 Ga0070660_100122077 3300005339 Bacteria 2079
26 Ga0070689_100014474 3300005340 Bacteria 5730
27 Ga0070687_100145480 3300005343 Bacteria 1385
28 Ga0070661_100000735 3300005344 Bacteria 23855
29 Ga0070661_100157052 3300005344 Bacteria 1721
30 Ga0070668_100008123 3300005347 Bacteria 7794
31 Ga0070668_100023165 3300005347 Bacteria 4695
32 Ga0070668_100541682 3300005347 Bacteria 1012
33 Ga0070669_100000357 3300005353 Bacteria 35454
34 Ga0070669_100007923 3300005353 Bacteria 7591
35 Ga0070669_100144690 3300005353 Bacteria 1836
36 Ga0070669_100186302 3300005353 Bacteria 1626
37 Ga0070671_100002926 3300005355 Bacteria 13279
38 Ga0070671_100025197 3300005355 Bacteria 4879
39 Ga0070671_100066674 3300005355 Bacteria 3000
40 Ga0070674_100135820 3300005356 Bacteria 1839
41 Ga0070673_100023817 3300005364 Bacteria 4479
42 Ga0070659_100002707 3300005366 Bacteria 12596
43 Ga0070659_100046160 3300005366 Bacteria 3414
44 Ga0070659_100173382 3300005366 Bacteria 1768
45 Ga0070659_100423456 3300005366 Bacteria 1126
46 Ga0070667_100000261 3300005367 Bacteria 60134
47 Ga0070667_100000703 3300005367 Bacteria 32314
48 Ga0070667_100022127 3300005367 Bacteria 5273
49 Ga0070667_100051379 3300005367 Bacteria 3475
50 Ga0070703_10001502 3300005406 Bacteria 6986
51 Ga0070701_10070679 3300005438 Bacteria 1865
52 Ga0070705_100000029 3300005440 Bacteria 74892
53 Ga0070700_100001253 3300005441 Bacteria 12585
54 Ga0070700_100329449 3300005441 Bacteria 1125
55 Ga0070694_100000919 3300005444 Bacteria 16687
56 Ga0070694_100315002 3300005444 Bacteria 1203
57 Ga0070708_100006293 3300005445 Bacteria 9447
58 Ga0070663_100008334 3300005455 Bacteria 6368
59 Ga0070663_100194215 3300005455 Bacteria 1581
60 Ga0070678_100133617 3300005456 Bacteria 1975
61 Ga0070678_100155585 3300005456 Bacteria 1846
62 Ga0070662_100000685 3300005457 Bacteria 20655
63 Ga0070662_100035916 3300005457 Bacteria 3503
64 Ga0070662_100051070 3300005457 Bacteria 2985
65 Ga0070681_10005216 3300005458 Bacteria 12546
66 Ga0070685_10023778 3300005466 Bacteria 3358
67 Ga0070706_100044439 3300005467 Bacteria 4104
68 Ga0070707_100126917 3300005468 Bacteria 2479
69 Ga0070699_100000435 3300005518 Bacteria 40050
70 Ga0070679_100007617 3300005530 Bacteria 10134
71 Ga0070679_100122670 3300005530 Bacteria 2582
72 Ga0070684_100068427 3300005535 Bacteria 3121
73 Ga0070684_100081807 3300005535 Bacteria 2858
74 Ga0068853_100000358 3300005539 Bacteria 31415
75 Ga0068853_100098460 3300005539 Bacteria 2582
76 Ga0070686_100011189 3300005544 Bacteria 5083
77 Ga0070695_100002983 3300005545 Bacteria 9860
78 Ga0070696_100002652 3300005546 Bacteria 11859
79 Ga0070665_100000319 3300005548 Bacteria 74295
80 Ga0070665_100004090 3300005548 Bacteria 15339
81 Ga0070665_100009283 3300005548 Bacteria 9956
82 Ga0070665_100086223 3300005548 Bacteria 3145
83 Ga0070704_100007062 3300005549 Bacteria 6666
84 Ga0070704_100054095 3300005549 Bacteria 2840
85 Ga0068855_100002925 3300005563 Bacteria 20893
86 Ga0068855_100037402 3300005563 Bacteria 5771
87 Ga0068855_100085627 3300005563 Bacteria 3646
88 Ga0070664_100007055 3300005564 Bacteria 9067
89 Ga0070664_100026073 3300005564 Bacteria 4846
90 Ga0068857_100006642 3300005577 Bacteria 9938
91 Ga0068857_100019286 3300005577 Bacteria 5987
92 Ga0068854_100008377 3300005578 Bacteria 6646
93 Ga0068854_100018076 3300005578 Bacteria 4726
94 Ga0068856_100005500 3300005614 Bacteria 12479
95 Ga0068856_100052815 3300005614 Bacteria 4009
96 Ga0068856_100180161 3300005614 Bacteria 2126
97 Ga0068852_100000169 3300005616 Bacteria 43882
98 Ga0068852_100027497 3300005616 Bacteria 4637
99 Ga0068852_100259592 3300005616 Bacteria 1668
100 Ga0068859_100013037 3300005617 Bacteria 8352
101 Ga0068859_100030922 3300005617 Bacteria 5373
102 Ga0068859_100079699 3300005617 Bacteria 3315
103 Ga0068859_100115614 3300005617 Bacteria 2747
104 Ga0068859_100185092 3300005617 Bacteria 2166
105 Ga0068864_100001072 3300005618 Bacteria 22953
106 Ga0068864_100098965 3300005618 Bacteria 2583
107 Ga0068861_100013822 3300005719 Bacteria 5657
108 Ga0068861_100061981 3300005719 Bacteria 2871
109 Ga0068863_100000014 3300005841 Bacteria 216135
110 Ga0068863_100002594 3300005841 Bacteria 17917
111 Ga0068863_100004664 3300005841 Bacteria 13513
112 Ga0068863_100474111 3300005841 Bacteria 1230
113 Ga0068858_100004870 3300005842 Bacteria 13165
114 Ga0068858_100051743 3300005842 Bacteria 3800
115 Ga0068858_100055327 3300005842 Bacteria 3668
116 Ga0068858_100165988 3300005842 Bacteria 2080
117 Ga0068860_100000007 3300005843 Bacteria 429329
118 Ga0068860_100009800 3300005843 Bacteria 9508
119 Ga0068860_100029758 3300005843 Bacteria 5253
120 Ga0068860_100039467 3300005843 Bacteria 4516
121 Ga0068860_100065597 3300005843 Bacteria 3447
122 Ga0068860_100110999 3300005843 Bacteria 2621
123 Ga0068860_100116951 3300005843 Bacteria 2551
124 Ga0068860_100183074 3300005843 Bacteria 2025
125 Ga0068862_100000866 3300005844 Bacteria 29635
126 Ga0068862_100010264 3300005844 Bacteria 7728
127 Ga0068862_100063155 3300005844 Bacteria 3186
128 Ga0068862_100485827 3300005844 Bacteria 1170
129 Ga0075368_10002950 3300006042 Bacteria 5620
130 Ga0075368_10007399 3300006042 Bacteria 3874
131 Ga0075368_10061201 3300006042 Bacteria 1507
132 Ga0075364_10003873 3300006051 Bacteria 8580
133 Ga0075364_10017033 3300006051 Bacteria 4531
134 Ga0075364_10127801 3300006051 Bacteria 1705
135 Ga0075364_10313664 3300006051 Bacteria 1068
136 Ga0075432_10000822 3300006058 Bacteria 9718
137 Ga0070715_10218681 3300006163 Bacteria 978
138 Ga0075367_10006472 3300006178 Bacteria 5921
139 Ga0097621_100071890 3300006237 Bacteria 2860
140 Ga0075370_10027382 3300006353 Bacteria 3162
141 Ga0075428_100020451 3300006844 Bacteria 7327
142 Ga0075428_100116482 3300006844 Bacteria 2910
143 Ga0075428_100204819 3300006844 Bacteria 2132
144 Ga0075430_100003913 3300006846 Bacteria 12558
145 Ga0075430_100023915 3300006846 Bacteria 5202
146 Ga0075430_100039705 3300006846 Bacteria 3984
147 Ga0075430_100057610 3300006846 Bacteria 3268
148 Ga0075431_100002086 3300006847 Bacteria 19086
149 Ga0075431_100003429 3300006847 Bacteria 15377
150 Ga0075431_100014915 3300006847 Bacteria 7868
151 Ga0075431_100069487 3300006847 Bacteria 3634
152 Ga0075431_100247449 3300006847 Bacteria 1812
153 Ga0075433_10036040 3300006852 Bacteria 4258
154 Ga0075434_100274530 3300006871 Bacteria 1705
155 Ga0075434_100374265 3300006871 Bacteria 1445
156 Ga0075429_100016736 3300006880 Bacteria 6351
157 Ga0075429_100096018 3300006880 Bacteria 2585
158 Ga0075429_100178803 3300006880 Bacteria 1859
159 Ga0097620_100013038 3300006931 Bacteria 8352
160 Ga0097620_100030922 3300006931 Bacteria 5373
161 Ga0097620_100079693 3300006931 Bacteria 3315
162 Ga0097620_100115614 3300006931 Bacteria 2747
163 Ga0097620_100185089 3300006931 Bacteria 2166
164 Ga0105251_10003236 3300009011 Bacteria 11991
165 Ga0105250_10025545 3300009092 Bacteria 2380
166 Ga0105240_10157543 3300009093 Bacteria 2699
167 Ga0105240_10321550 3300009093 Bacteria 1763
168 Ga0111539_10007982 3300009094 Bacteria 13501
169 Ga0111539_10008813 3300009094 Bacteria 12790
170 Ga0111539_10113930 3300009094 Bacteria 3171
171 Ga0111539_10197472 3300009094 Bacteria 2346
172 Ga0111539_10322534 3300009094 Bacteria 1798
173 Ga0111539_10578971 3300009094 Bacteria 1307
174 Ga0105245_10001093 3300009098 Bacteria 24605
175 Ga0105247_10008448 3300009101 Bacteria 6273
176 Ga0105247_10065288 3300009101 Bacteria 2264
177 Ga0105247_10535874 3300009101 Bacteria 858
178 Ga0114129_10072454 3300009147 Bacteria 4802
179 Ga0114129_10093102 3300009147 Bacteria 4175
180 Ga0114129_10378257 3300009147 Bacteria 1871
181 Ga0114129_10846949 3300009147 Bacteria 1163
182 Ga0105243_10156740 3300009148 Bacteria 1959
183 Ga0105242_10100192 3300009176 Bacteria 2453
184 Ga0105242_10133911 3300009176 Bacteria 2143
185 Ga0105248_10006421 3300009177 Bacteria 12900
186 Ga0105248_10033092 3300009177 Bacteria 5774
187 Ga0105248_10043494 3300009177 Bacteria 5035
188 Ga0105238_10010483 3300009551 Bacteria 9303
189 Ga0105238_10151448 3300009551 Bacteria 2294
190 Ga0105238_10552103 3300009551 Bacteria 1156
191 Ga0105249_10007276 3300009553 Bacteria 9654
192 Ga0105249_10164083 3300009553 Bacteria 2149
193 Ga0105239_10288921 3300010375 Bacteria 1847
194 Ga0105239_10502248 3300010375 Bacteria 1379
195 Ga0105246_10002251 3300011119 Bacteria 11644
196 Ga0105246_10004894 3300011119 Bacteria 8159
197 Ga0105246_10023691 3300011119 Bacteria 3976
198 Ga0157373_10040948 3300013100 Bacteria 3314
199 Ga0157373_10057593 3300013100 Bacteria 2756
200 Ga0157371_10004503 3300013102 Bacteria 12142
201 Ga0157370_10009970 3300013104 Bacteria 10051
202 Ga0157370_10061361 3300013104 Bacteria 3568
203 Ga0157369_10126508 3300013105 Bacteria 2709
204 Ga0157374_10001203 3300013296 Bacteria 22140
205 Ga0157378_10132606 3300013297 Bacteria 2308
206 Ga0163162_10005300 3300013306 Bacteria 12450
207 Ga0163162_10120766 3300013306 Bacteria 2725
208 Ga0163162_10171604 3300013306 Bacteria 2294
209 Ga0163162_10372437 3300013306 Bacteria 1561
210 Ga0157372_10149186 3300013307 Bacteria 2698
211 Ga0157372_10322834 3300013307 Bacteria 1798
212 Ga0163163_10000433 3300014325 Bacteria 38351
213 Ga0163163_10158779 3300014325 Bacteria 2306
214 Ga0157380_10077684 3300014326 Bacteria 2706
215 Ga0157380_10148814 3300014326 Bacteria 2021
216 Ga0157380_10544337 3300014326 Bacteria 1137
217 Ga0157379_10049871 3300014968 Bacteria 3737
218 Ga0157379_10055252 3300014968 Bacteria 3548
219 Ga0157379_10345608 3300014968 Bacteria 1361
220 Ga0157376_10044510 3300014969 Bacteria 3649
221 Ga0157376_10169559 3300014969 Bacteria 1986
222 Ga0209050_1000119 3300025298 Bacteria 200661
223 Ga0207697_10157776 3300025315 Bacteria 989
224 Ga0207656_10051290 3300025321 Bacteria 1784
225 Ga0207696_1010467 3300025711 Bacteria 3397
226 Ga0207713_1002886 3300025735 Bacteria 12047
227 Ga0207653_10001041 3300025885 Bacteria 9112
228 Ga0207688_10154189 3300025901 Bacteria 1359
229 Ga0207680_10015444 3300025903 Bacteria 3984
230 Ga0207680_10152458 3300025903 Bacteria 1542
231 Ga0207680_10247337 3300025903 Bacteria 1231
232 Ga0207647_10029148 3300025904 Bacteria 3575
233 Ga0207647_10041236 3300025904 Bacteria 2904
234 Ga0207705_10000009 3300025909 Bacteria 576128
235 Ga0207705_10009562 3300025909 Bacteria 7053
236 Ga0207705_10042290 3300025909 Bacteria 3271
237 Ga0207684_10056161 3300025910 Bacteria 3340
238 Ga0207707_10021788 3300025912 Bacteria 5601
239 Ga0207695_10237313 3300025913 Bacteria 1725
240 Ga0207695_10257545 3300025913 Bacteria 1643
241 Ga0207660_10005228 3300025917 Bacteria 8432
242 Ga0207660_10057433 3300025917 Bacteria 2787
243 Ga0207660_10296688 3300025917 Bacteria 1286
244 Ga0207662_10256699 3300025918 Bacteria 1149
245 Ga0207657_10000077 3300025919 Bacteria 92227
246 Ga0207657_10062671 3300025919 Bacteria 3182
247 Ga0207657_10126446 3300025919 Bacteria 2099
248 Ga0207649_10009270 3300025920 Bacteria 5384
249 Ga0207649_10032403 3300025920 Bacteria 3115
250 Ga0207649_10188362 3300025920 Bacteria 1449
251 Ga0207652_10015079 3300025921 Bacteria 6270
252 Ga0207652_10018222 3300025921 Bacteria 5757
253 Ga0207652_10545003 3300025921 Bacteria 1043
254 Ga0207646_10073923 3300025922 Bacteria 3045
255 Ga0207681_10000321 3300025923 Bacteria 34677
256 Ga0207681_10000667 3300025923 Bacteria 22714
257 Ga0207681_10124332 3300025923 Bacteria 1897
258 Ga0207694_10045398 3300025924 Bacteria 3394
259 Ga0207694_10047515 3300025924 Bacteria 3320
260 Ga0207650_10210150 3300025925 Bacteria 1562
261 Ga0207650_10515334 3300025925 Bacteria 1000
262 Ga0207687_10007530 3300025927 Bacteria 7158
263 Ga0207644_10006124 3300025931 Bacteria 7846
264 Ga0207644_10006524 3300025931 Bacteria 7609
265 Ga0207644_10014842 3300025931 Bacteria 5222
266 Ga0207644_10023896 3300025931 Bacteria 4192
267 Ga0207644_10100479 3300025931 Bacteria 2172
268 Ga0207690_10001427 3300025932 Bacteria 14960
269 Ga0207690_10041295 3300025932 Bacteria 3022
270 Ga0207706_10000204 3300025933 Bacteria 65744
271 Ga0207706_10029117 3300025933 Bacteria 4931
272 Ga0207706_10058619 3300025933 Bacteria 3391
273 Ga0207706_10075982 3300025933 Bacteria 2955
274 Ga0207706_10465482 3300025933 Bacteria 1093
275 Ga0207686_10048899 3300025934 Bacteria 2622
276 Ga0207686_10086645 3300025934 Bacteria 2058
277 Ga0207670_10010867 3300025936 Bacteria 5255
278 Ga0207711_10003182 3300025941 Bacteria 14318
279 Ga0207711_10019446 3300025941 Bacteria 5653
280 Ga0207689_10025646 3300025942 Bacteria 4939
281 Ga0207689_10275483 3300025942 Bacteria 1393
282 Ga0207661_10003474 3300025944 Bacteria 10940
283 Ga0207661_10022029 3300025944 Bacteria 4789
284 Ga0207661_10255779 3300025944 Bacteria 1558
285 Ga0207679_10012194 3300025945 Bacteria 5598
286 Ga0207679_10088149 3300025945 Bacteria 2392
287 Ga0207667_10008852 3300025949 Bacteria 11913
288 Ga0207667_10011937 3300025949 Bacteria 10059
289 Ga0207667_10064815 3300025949 Bacteria 3813
290 Ga0207712_10002056 3300025961 Bacteria 13210
291 Ga0207668_10015821 3300025972 Bacteria 4696
292 Ga0207640_10007531 3300025981 Bacteria 6013
293 Ga0207640_10013218 3300025981 Bacteria 4726
294 Ga0207658_10000514 3300025986 Bacteria 35332
295 Ga0207658_10003671 3300025986 Bacteria 10821
296 Ga0207658_10004197 3300025986 Bacteria 10038
297 Ga0207658_10046198 3300025986 Bacteria 3178
298 Ga0207658_10241403 3300025986 Bacteria 1531
299 Ga0207677_10010473 3300026023 Bacteria 5247
300 Ga0207703_10011608 3300026035 Bacteria 6850
301 Ga0207703_10024192 3300026035 Bacteria 4778
302 Ga0207703_10043897 3300026035 Bacteria 3590
303 Ga0207703_10158029 3300026035 Bacteria 1983
304 Ga0207639_10000847 3300026041 Bacteria 20809
305 Ga0207639_10100612 3300026041 Bacteria 2335
306 Ga0207678_10019221 3300026067 Bacteria 5999
307 Ga0207678_10338154 3300026067 Bacteria 1297
308 Ga0207708_10001278 3300026075 Bacteria 18901
309 Ga0207708_10033844 3300026075 Bacteria 3885
310 Ga0207708_10239582 3300026075 Bacteria 1459
311 Ga0207708_10386703 3300026075 Unclassified 1154
312 Ga0207702_10015456 3300026078 Bacteria 6321
313 Ga0207702_10059447 3300026078 Bacteria 3256
314 Ga0207702_10147627 3300026078 Bacteria 2136
315 Ga0207641_10000126 3300026088 Bacteria 112607
316 Ga0207641_10004522 3300026088 Bacteria 12023
317 Ga0207641_10031498 3300026088 Bacteria 4398
318 Ga0207676_10001795 3300026095 Bacteria 15723
319 Ga0207676_10017419 3300026095 Bacteria 5205
320 Ga0207676_10139196 3300026095 Bacteria 2075
321 Ga0207674_10006724 3300026116 Bacteria 13499
322 Ga0207674_10053594 3300026116 Bacteria 4110
323 Ga0207675_100024013 3300026118 Bacteria 5668
324 Ga0207675_100047593 3300026118 Bacteria 4003
325 Ga0207675_100142996 3300026118 Bacteria 2273
326 Ga0207683_10063050 3300026121 Bacteria 3265
327 Ga0207683_10183930 3300026121 Bacteria 1895
328 Ga0207698_10000111 3300026142 Bacteria 50675
329 Ga0207698_10039004 3300026142 Bacteria 3515
330 Ga0207698_10152756 3300026142 Bacteria 2006
331 Ga0209983_1022670 3300027665 Bacteria 1317
332 Ga0209813_10000069 3300027866 Bacteria 39845
333 Ga0209813_10002705 3300027866 Bacteria 4081
334 Ga0209974_10018229 3300027876 Bacteria 2329
335 Ga0207428_10023468 3300027907 Bacteria 5188
336 Ga0207428_10061910 3300027907 Bacteria 2961
337 Ga0268266_10000212 3300028379 Bacteria 101029
338 Ga0268266_10007074 3300028379 Bacteria 10188
339 Ga0268266_10078012 3300028379 Bacteria 2881
340 Ga0268265_10001316 3300028380 Bacteria 21300
341 Ga0268265_10007813 3300028380 Bacteria 7218
342 Ga0268265_10188434 3300028380 Bacteria 1779
343 Ga0268265_10420562 3300028380 Bacteria 1241
344 Ga0268264_10000077 3300028381 Bacteria 252597
345 Ga0268264_10002022 3300028381 Bacteria 18188
346 Ga0268264_10019868 3300028381 Bacteria 5489
347 Ga0268264_10020743 3300028381 Bacteria 5369
348 Ga0268264_10068302 3300028381 Bacteria 3003
349 Ga0268264_10096796 3300028381 Bacteria 2557
350 Ga0268264_10113621 3300028381 Bacteria 2376
351 Ga0268264_10297848 3300028381 Bacteria 1517
352 Ga0268264_10491871 3300028381 Bacteria 1195
353 Ga0307408_100065485 3300031548 Bacteria 2665
354 Ga0307408_100154730 3300031548 Bacteria 1814
355 Ga0307405_10048602 3300031731 Bacteria 2617
356 Ga0307405_10255104 3300031731 Bacteria 1307
357 Ga0307413_10027011 3300031824 Bacteria 3173
358 Ga0307413_10146567 3300031824 Bacteria 1639
359 Ga0307413_10166255 3300031824 Bacteria 1556
360 Ga0307413_10261186 3300031824 Bacteria 1291
361 Ga0307410_10113003 3300031852 Bacteria 1968
362 Ga0307410_10240700 3300031852 Bacteria 1402
363 Ga0307410_10394934 3300031852 Bacteria 1116
364 Ga0307410_10601513 3300031852 Bacteria 917
365 Ga0307406_10133779 3300031901 Bacteria 1744
366 Ga0307407_10015575 3300031903 Bacteria 3764
367 Ga0307412_10050317 3300031911 Bacteria 2749
368 Ga0307412_10052654 3300031911 Bacteria 2696
369 Ga0307412_10070762 3300031911 Bacteria 2379
370 Ga0307409_100067198 3300031995 Bacteria 2830
371 Ga0307409_100680112 3300031995 Bacteria 1026
372 Ga0307416_100019598 3300032002 Bacteria 4802
373 Ga0307416_100321413 3300032002 Bacteria 1550
374 Ga0307416_100775921 3300032002 Bacteria 1053
375 Ga0307414_10016727 3300032004 Bacteria 4468
376 Ga0307415_100050391 3300032126 Bacteria 2821
377 Ga0373939_0051112 3300035114 Bacteria 1284
378 Ga0373953_0026198 3300035117 Bacteria 2233
379 Ga0373955_0010662 3300035172 Bacteria 4349
380 Ga0373927_0112708 3300035695 Bacteria 1773
381 Ga0373933_0157221 3300035724 Bacteria 1442
382 Ga0373937_0002739 3300036401 Bacteria 14697
383 Ga0373937_0201219 3300036401 Bacteria 1872
384 Ga0316582_0205738 3300036647 Bacteria 1344
385 Ga0316584_0114864 3300036712 Bacteria 2014
386 Ga0400490_22429 3300038726 Bacteria 1614
387 Ga0400485_08081 3300038735 Unclassified 3309
388 Ga0400486_10851 3300038742 Unclassified 1613
389 Ga0400486_17016 3300038742 Bacteria 2275
390 Ga0400487_18928 3300039110 Unclassified 1454
391 Ga0439462_0038649 3300042015 Bacteria 1271
392 Ga0450923_014528 3300042125 Bacteria 1462
393 Ga0450916_010780 3300042530 Bacteria 1148
394 Ga0495627_000197 3300046453 Bacteria 66158
395 Ga0495650_0001750 3300046471 Bacteria 19773
396 Ga0495596_0000625 3300046500 Bacteria 22228
397 Ga0495596_0000662 3300046500 Bacteria 21469
398 Ga0495607_0016306 3300046501 Bacteria 4795
399 Ga0495583_0062925 3300046506 Bacteria 1651
400 Ga0495606_0139508 3300046507 Bacteria 1433
401 Ga0495610_0000020 3300046512 Bacteria 344007
402 Ga0495610_0000104 3300046512 Bacteria 98197
403 Ga0495610_0027769 3300046512 Bacteria 3002
404 Ga0495620_0047963 3300046515 Bacteria 1835
405 Ga0495632_0018817 3300046519 Bacteria 3778
406 Ga0495643_0000023 3300046522 Bacteria 288590
407 Ga0495643_0014027 3300046522 Bacteria 4778
408 Ga0495643_0030092 3300046522 Bacteria 3034
409 Ga0495643_0105758 3300046522 Bacteria 1436
410 Ga0495654_0042275 3300046530 Bacteria 2263
411 Ga0495598_0064611 3300046537 Bacteria 1137
412 Ga0495609_0004365 3300046538 Bacteria 7767
413 Ga0495621_0030410 3300046539 Bacteria 1846
414 Ga0495633_0076284 3300046558 Bacteria 1561
415 Ga0495671_0043114 3300046692 Bacteria 2265
416 Ga0495687_048675 3300047443 Bacteria 1817
417 Ga0495681_0000123 3300047470 Bacteria 68069
418 Ga0495686_0107327 3300047472 Bacteria 1678
419 Ga0495593_0055035 3300047673 Bacteria 2096
420 Ga0495615_0000098 3300048090 Bacteria 24482
421 Ga0495615_0044902 3300048090 Bacteria 1117
422 Ga0495626_0029271 3300048091 Bacteria 2666
423 Ga0496100_0095089 3300048903 Bacteria 2042
424 Ga0496100_0408491 3300048903 Bacteria 1035
425 Ga0496101_0245672 3300048904 Bacteria 1393
426 Ga0496101_0432345 3300048904 Bacteria 1038
427 Ga0496101_0573739 3300048904 Bacteria 892
428 Ga0496102_0000106 3300048905 Bacteria 118841
429 Ga0496102_0000972 3300048905 Bacteria 26983
430 Ga0496102_0106739 3300048905 Bacteria 2607
431 Ga0496102_0328410 3300048905 Bacteria 1441
432 Ga0496103_0000128 3300048906 Bacteria 81657
433 Ga0496103_0004335 3300048906 Bacteria 8615
434 Ga0496103_0039010 3300048906 Bacteria 2918
435 Ga0496103_0053713 3300048906 Bacteria 2497
436 Ga0496104_0004170 3300048907 Bacteria 12543
437 Ga0496104_0006287 3300048907 Bacteria 10441
438 Ga0496105_0002625 3300048908 Bacteria 13074
439 Ga0496105_0021662 3300048908 Bacteria 5201
440 Ga0496106_0000362 3300048909 Bacteria 32242
441 Ga0496106_0393528 3300048909 Bacteria 1114
442 Ga0496107_0004589 3300048910 Bacteria 9362
443 Ga0496107_0084985 3300048910 Bacteria 2309
444 Ga0496108_0093028 3300048911 Bacteria 2564
445 Ga0496109_0027160 3300048912 Bacteria 5109
446 Ga0496109_0038655 3300048912 Bacteria 4315
447 Ga0496110_0010150 3300048913 Bacteria 7650
448 Ga0496110_0177457 3300048913 Bacteria 1934
449 Ga0496111_0045131 3300048914 Bacteria 3170
450 Ga0496112_0011257 3300048915 Bacteria 8159
451 Ga0496113_0204939 3300048916 Bacteria 1568
452 Ga0496114_0132028 3300048917 Bacteria 2157
453 Ga0496114_0488566 3300048917 Bacteria 1089
454 Ga0496115_0017172 3300048918 Bacteria 5525
455 Ga0496116_0000035 3300048919 Bacteria 402424
456 Ga0496116_0044661 3300048919 Bacteria 3007
457 Ga0496117_0003021 3300048920 Bacteria 20200
458 Ga0496117_0019809 3300048920 Bacteria 5512
459 Ga0496118_0019621 3300048921 Bacteria 6035
460 Ga0496118_0047174 3300048921 Bacteria 3343
461 Ga0496118_0055728 3300048921 Bacteria 2979
462 Ga0496118_0068432 3300048921 Bacteria 2579
463 Ga0496118_0189644 3300048921 Bacteria 1231
464 Ga0496119_0001217 3300048922 Bacteria 32132
465 Ga0496119_0244269 3300048922 Bacteria 908
466 Ga0496120_0007787 3300048923 Bacteria 7912
467 Ga0496121_0000070 3300048924 Bacteria 249187
468 Ga0496121_0000222 3300048924 Bacteria 123595
469 Ga0496121_0004707 3300048924 Bacteria 18061
470 Ga0496121_0043487 3300048924 Bacteria 3889
471 Ga0496121_0354773 3300048924 Bacteria 975
472 Ga0496122_0005308 3300048925 Bacteria 15415
473 Ga0496122_0014798 3300048925 Bacteria 7516
474 Ga0496122_0129332 3300048925 Bacteria 1608
475 Ga0496122_0129440 3300048925 Bacteria 1607
476 Ga0496123_0002019 3300048926 Bacteria 26197
477 Ga0496123_0042925 3300048926 Bacteria 3113
478 Ga0496123_0088671 3300048926 Bacteria 1846
479 Ga0496124_0000417 3300048927 Bacteria 76104
480 Ga0496124_0029744 3300048927 Bacteria 4859
481 Ga0496124_0194940 3300048927 Bacteria 1546
482 Ga0496125_0032235 3300048928 Bacteria 4657
483 Ga0496125_0038471 3300048928 Bacteria 4138
484 Ga0496125_0134486 3300048928 Bacteria 1732
485 Ga0496126_0000084 3300048929 Bacteria 217111
486 Ga0496126_0000493 3300048929 Bacteria 77742
487 Ga0501033_0061089 3300049570 Bacteria 2778
488 Ga0501034_0394210 3300049571 Bacteria 1308
489 Ga0501036_0135871 3300049572 Bacteria 2076
490 Ga0501036_0180145 3300049572 Bacteria 1779
491 Ga0501037_0168949 3300049573 Bacteria 1556
492 Ga0501039_0209794 3300049575 Bacteria 1532
493 Ga0501039_0367136 3300049575 Bacteria 1131
494 Ga0501041_0032229 3300049577 Bacteria 3168
495 Ga0501041_0088537 3300049577 Bacteria 1911
496 Ga0501047_0140060 3300049581 Bacteria 2298
497 Ga0501048_0014311 3300049582 Bacteria 5875
498 Ga0501048_0230005 3300049582 Bacteria 1316
499 Ga0501067_0179247 3300049583 Unclassified 1180
500 Ga0501071_0056867 3300049587 Bacteria 2826
501 Ga0501071_0264768 3300049587 Bacteria 1299
502 Ga0501072_0033785 3300049588 Bacteria 4008
503 Ga0501073_0152073 3300049589 Bacteria 1604
504 Ga0501074_0258066 3300049590 Bacteria 1239
505 Ga0501075_0011677 3300049591 Bacteria 6223
506 Ga0501075_0187710 3300049591 Bacteria 1577
507 Ga0501075_0353471 3300049591 Bacteria 1120
508 Ga0501076_0051403 3300049592 Bacteria 3262
509 Ga0501076_0122140 3300049592 Bacteria 2109
510 Ga0501076_0153263 3300049592 Bacteria 1875
511 Ga0501076_0652279 3300049592 Bacteria 869
512 Ga0501077_0038047 3300049593 Bacteria 3063
513 Ga0501077_0045855 3300049593 Bacteria 2777
514 Ga0501077_0378079 3300049593 Bacteria 905
515 Ga0501079_0003608 3300049741 Bacteria 11390
516 Ga0501079_0053287 3300049741 Bacteria 3121
517 Ga0501079_0109992 3300049741 Bacteria 2141
518 Ga0501081_0033845 3300049743 Bacteria 3474
519 Ga0501081_0112997 3300049743 Bacteria 1928
520 Ga0501083_0160499 3300049744 Bacteria 1471
521 Ga0501044_0002739 3300049823 Bacteria 20043
522 Ga0501044_0167309 3300049823 Bacteria 2172
523 Ga0501044_0192861 3300049823 Bacteria 1999
524 Ga0501045_0071462 3300049824 Bacteria 2554
525 nmdc:mga03683_582_c1 3300050489 Bacteria 10474
526 nmdc:mga03n38_29660_c1 3300050490 Bacteria 2292
527 nmdc:mga03n38_34195_c1 3300050490 Bacteria 2169
528 nmdc:mga00v17_1542_c2 3300050491 Bacteria 3884
529 nmdc:mga00v17_2152_c1 3300050491 Bacteria 10125
530 nmdc:mga06z11_12519_c1 3300050494 Bacteria 3693
531 nmdc:mga06z11_1500_c1 3300050494 Bacteria 8675
532 nmdc:mga04h51_3312_c1 3300050495 Bacteria 3906
533 nmdc:mga04h51_710_c1 3300050495 Bacteria 7727
534 nmdc:mga07m45_185997_c1 3300050496 Bacteria 1208
535 nmdc:mga07m45_53_c1 3300050496 Bacteria 50852
536 nmdc:mga07m45_66488_c1 3300050496 Bacteria 2048
537 nmdc:mga05p37_128250_c1 3300050507 Bacteria 3114
538 nmdc:mga09592_59967_c1 3300050508 Bacteria 3217
539 nmdc:mga09592_76780_c1 3300050508 Bacteria 2841
540 nmdc:mga0qj67_11371_c1 3300050509 Bacteria 6669
541 nmdc:mga0qj67_2771_c1 3300050509 Bacteria 12574
542 nmdc:mga0qj67_89701_c1 3300050509 Bacteria 2469
543 nmdc:mga06r32_265446_c1 3300050510 Bacteria 1704
544 nmdc:mga06r32_36982_c1 3300050510 Bacteria 4618
545 nmdc:mga06r32_41488_c1 3300050510 Bacteria 4372
546 nmdc:mga06r32_6820_c1 3300050510 Bacteria 10267
547 nmdc:mga06r32_8867_c1 3300050510 Bacteria 9065
548 nmdc:mga08y16_163092_c1 3300050511 Bacteria 2316
549 nmdc:mga08y16_28067_c1 3300050511 Bacteria 5934
550 nmdc:mga0a205_9747_c1 3300050515 Bacteria 8434
551 nmdc:mga0sz30_18348_c1 3300050516 Bacteria 2799
552 nmdc:mga0sz30_404_c1 3300050516 Bacteria 16465
553 Ga0495601_0056833 3300053077 Bacteria 2478
554 Ga0495619_0230278 3300053085 Bacteria 1284
555 Ga0500643_000001 3300053087 Bacteria 1440111
556 Ga0500647_0110535 3300053091 Bacteria 1307
557 Ga0500608_003606 3300053122 Bacteria 5840
558 Ga0500618_028617 3300053125 Bacteria 1319
559 Ga0500559_0045018 3300053136 Bacteria 1931
560 Ga0500564_000978 3300053138 Bacteria 9309
561 Ga0500616_0003651 3300053153 Bacteria 11556
562 Ga0500567_000681 3300053723 Bacteria 12398
563 Ga0500625_000039 3300053729 Bacteria 43868
564 Ga0501084_0019344 3300054114 Bacteria 5673
565 Ga0501084_0310092 3300054114 Bacteria 1333
566 Ga0501084_0371144 3300054114 Bacteria 1209
567 Ga0500661_022520 3300055283 Bacteria 1117
568 Ga0501082_0017447 3300060353 Bacteria 6184
569 Ga0501082_0046733 3300060353 Bacteria 3731
570 Ga0501082_0121387 3300060353 Bacteria 2265
571 Ga0501082_0197962 3300060353 Bacteria 1748
572 Ga0501082_0281339 3300060353 Bacteria 1448
573 Ga0501082_0526225 3300060353 Bacteria 1034
574 Ga0530510_0008259 3300061734 Bacteria 7260
575 Ga0530510_0015817 3300061734 Bacteria 5334

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_100541682 Ga0070668_1005416821 230
2 3300005367 Ga0070667_100022127 Ga0070667_1000221272 230
3 3300005548 Ga0070665_100004090 Ga0070665_10000409011 230
4 3300005842 Ga0068858_100051743 Ga0068858_1000517432 230
5 3300005843 Ga0068860_100000007 Ga0068860_100000007184 230
6 3300025986 Ga0207658_10003671 Ga0207658_100036713 231
7 3300026035 Ga0207703_10024192 Ga0207703_100241922 231
8 3300028381 Ga0268264_10000077 Ga0268264_1000007755 231
9 3300025933 Ga0207706_10465482 Ga0207706_104654821 234
10 3300005843 Ga0068860_100183074 Ga0068860_1001830742 238
11 3300028381 Ga0268264_10491871 Ga0268264_104918712 238
12 3300025945 Ga0207679_10088149 Ga0207679_100881493 242
13 3300006051 Ga0075364_10017033 Ga0075364_100170333 244
14 3300027866 Ga0209813_10002705 Ga0209813_100027053 244
15 3300050495 nmdc:mga04h51_3312_c1 nmdc:mga04h51_3312_c1_1023_1790 244
16 3300005343 Ga0070687_100145480 Ga0070687_1001454801 245
17 3300005466 Ga0070685_10023778 Ga0070685_100237783 245
18 3300006042 Ga0075368_10061201 Ga0075368_100612012 245
19 3300006852 Ga0075433_10036040 Ga0075433_100360402 245
20 3300013306 Ga0163162_10372437 Ga0163162_103724372 245
21 3300014968 Ga0157379_10055252 Ga0157379_100552522 245
22 3300026118 Ga0207675_100047593 Ga0207675_1000475934 245
23 3300048912 Ga0496109_0027160 Ga0496109_0027160_824_1594 245
24 3300048913 Ga0496110_0010150 Ga0496110_0010150_3352_4122 245
25 3300048914 Ga0496111_0045131 Ga0496111_0045131_1943_2713 245
26 3300009094 Ga0111539_10113930 Ga0111539_101139302 247
27 3300009094 Ga0111539_10578971 Ga0111539_105789711 247
28 3300009147 Ga0114129_10378257 Ga0114129_103782572 247
29 3300014326 Ga0157380_10148814 Ga0157380_101488141 247
30 3300026075 Ga0207708_10386703 Ga0207708_103867031 247
31 3300027907 Ga0207428_10023468 Ga0207428_100234687 247
32 3300049572 Ga0501036_0180145 Ga0501036_0180145_609_1358 247
33 3300049587 Ga0501071_0264768 Ga0501071_0264768_82_831 247
34 3300050511 nmdc:mga08y16_163092_c1 nmdc:mga08y16_163092_c1_1278_2048 247
35 3300047443 Ga0495687_048675 Ga0495687_048675_495_1256 248
36 3300053091 Ga0500647_0110535 Ga0500647_0110535_465_1226 248
37 3300053136 Ga0500559_0045018 Ga0500559_0045018_451_1212 248
38 3300053138 Ga0500564_000978 Ga0500564_000978_3022_3783 248
39 3300053723 Ga0500567_000681 Ga0500567_000681_10147_10908 248
40 3300053729 Ga0500625_000039 Ga0500625_000039_31681_32442 248
41 3300055283 Ga0500661_022520 Ga0500661_022520_289_1050 248
42 iso_pu_bacteria 2818991438 2819552665 248
43 iso_pu_bacteria 2738541275 2738709545 249
44 iso_pu_bacteria 2738541301 2738847970 249
45 iso_pu_bacteria 2738541304 2738863699 249
46 iso_pu_bacteria 2738543022 2739296217 249
47 iso_pu_bacteria 2738543033 2739357895 249
48 iso_pu_bacteria 2928100450 2928101100 249
49 iso_pu_bacteria 2928959182 2928960490 249
50 3300005617 Ga0068859_100079699 Ga0068859_1000796992 250
51 3300005843 Ga0068860_100110999 Ga0068860_1001109993 250
52 3300006931 Ga0097620_100079693 Ga0097620_1000796932 250
53 3300009101 Ga0105247_10535874 Ga0105247_105358741 250
54 3300009176 Ga0105242_10100192 Ga0105242_101001922 250
55 3300009551 Ga0105238_10552103 Ga0105238_105521032 250
56 3300009553 Ga0105249_10164083 Ga0105249_101640832 250
57 3300014325 Ga0163163_10158779 Ga0163163_101587792 250
58 3300025934 Ga0207686_10086645 Ga0207686_100866453 250
59 3300025942 Ga0207689_10275483 Ga0207689_102754832 250
60 3300028380 Ga0268265_10007813 Ga0268265_100078137 250
61 3300028380 Ga0268265_10188434 Ga0268265_101884342 250
62 3300028381 Ga0268264_10297848 Ga0268264_102978482 250
63 iso_pu_bacteria 2643221689 2644500398 250
64 iso_pu_bacteria 2837678835 2837679337 250
65 iso_pu_bacteria 2837678835 2837682815 250
66 iso_pu_bacteria 8045864390 8045869056 250
67 3300005441 Ga0070700_100329449 Ga0070700_1003294492 251
68 3300005844 Ga0068862_100063155 Ga0068862_1000631554 251
69 3300006042 Ga0075368_10007399 Ga0075368_100073994 251
70 3300006178 Ga0075367_10006472 Ga0075367_100064726 251
71 3300006844 Ga0075428_100116482 Ga0075428_1001164823 251
72 3300006846 Ga0075430_100057610 Ga0075430_1000576103 251
73 3300006847 Ga0075431_100014915 Ga0075431_1000149152 251
74 3300006880 Ga0075429_100096018 Ga0075429_1000960181 251
75 3300026075 Ga0207708_10239582 Ga0207708_102395822 251
76 3300046453 Ga0495627_000197 Ga0495627_000197_1517_2278 251
77 3300046471 Ga0495650_0001750 Ga0495650_0001750_17736_18497 251
78 3300046512 Ga0495610_0000020 Ga0495610_0000020_54336_55097 251
79 3300046515 Ga0495620_0047963 Ga0495620_0047963_886_1647 251
80 3300046519 Ga0495632_0018817 Ga0495632_0018817_1372_2133 251
81 3300046530 Ga0495654_0042275 Ga0495654_0042275_1385_2146 251
82 3300047470 Ga0495681_0000123 Ga0495681_0000123_3402_4163 251
83 3300048090 Ga0495615_0000098 Ga0495615_0000098_1823_2584 251
84 3300048925 Ga0496122_0005308 Ga0496122_0005308_1567_2328 251
85 3300048926 Ga0496123_0042925 Ga0496123_0042925_1572_2333 251
86 3300050490 nmdc:mga03n38_29660_c1 nmdc:mga03n38_29660_c1_582_1349 251
87 3300050494 nmdc:mga06z11_1500_c1 nmdc:mga06z11_1500_c1_4726_5493 251
88 3300050508 nmdc:mga09592_76780_c1 nmdc:mga09592_76780_c1_1773_2540 251
89 3300050510 nmdc:mga06r32_36982_c1 nmdc:mga06r32_36982_c1_3753_4520 251
90 iso_pu_bacteria 2895880812 2895885928 251
91 3300005289 Ga0065704_10082076 Ga0065704_100820761 252
92 3300005289 Ga0065704_10131197 Ga0065704_101311971 252
93 3300005295 Ga0065707_10135350 Ga0065707_101353502 252
94 3300005327 Ga0070658_10000124 Ga0070658_1000012419 252
95 3300005329 Ga0070683_100029541 Ga0070683_1000295419 252
96 3300005329 Ga0070683_100043254 Ga0070683_1000432545 252
97 3300005330 Ga0070690_100002347 Ga0070690_1000023479 252
98 3300005331 Ga0070670_100153603 Ga0070670_1001536034 252
99 3300005334 Ga0068869_100018365 Ga0068869_1000183654 252
100 3300005335 Ga0070666_10019746 Ga0070666_100197463 252
101 3300005335 Ga0070666_10188915 Ga0070666_101889152 252
102 3300005336 Ga0070680_100005639 Ga0070680_1000056396 252
103 3300005338 Ga0068868_100017924 Ga0068868_1000179243 252
104 3300005339 Ga0070660_100122077 Ga0070660_1001220773 252
105 3300005340 Ga0070689_100014474 Ga0070689_1000144746 252
106 3300005344 Ga0070661_100157052 Ga0070661_1001570522 252
107 3300005347 Ga0070668_100008123 Ga0070668_10000812310 252
108 3300005353 Ga0070669_100007923 Ga0070669_1000079232 252
109 3300005353 Ga0070669_100144690 Ga0070669_1001446902 252
110 3300005355 Ga0070671_100025197 Ga0070671_1000251972 252
111 3300005355 Ga0070671_100066674 Ga0070671_1000666742 252
112 3300005356 Ga0070674_100135820 Ga0070674_1001358202 252
113 3300005364 Ga0070673_100023817 Ga0070673_1000238174 252
114 3300005366 Ga0070659_100046160 Ga0070659_1000461604 252
115 3300005366 Ga0070659_100423456 Ga0070659_1004234562 252
116 3300005367 Ga0070667_100000261 Ga0070667_10000026144 252
117 3300005367 Ga0070667_100051379 Ga0070667_1000513792 252
118 3300005406 Ga0070703_10001502 Ga0070703_100015023 252
119 3300005438 Ga0070701_10070679 Ga0070701_100706792 252
120 3300005440 Ga0070705_100000029 Ga0070705_1000000293 252
121 3300005441 Ga0070700_100001253 Ga0070700_1000012533 252
122 3300005444 Ga0070694_100000919 Ga0070694_10000091918 252
123 3300005444 Ga0070694_100315002 Ga0070694_1003150022 252
124 3300005445 Ga0070708_100006293 Ga0070708_1000062934 252
125 3300005455 Ga0070663_100194215 Ga0070663_1001942152 252
126 3300005456 Ga0070678_100133617 Ga0070678_1001336172 252
127 3300005456 Ga0070678_100155585 Ga0070678_1001555851 252
128 3300005457 Ga0070662_100035916 Ga0070662_1000359162 252
129 3300005457 Ga0070662_100051070 Ga0070662_1000510702 252
130 3300005467 Ga0070706_100044439 Ga0070706_1000444394 252
131 3300005468 Ga0070707_100126917 Ga0070707_1001269173 252
132 3300005518 Ga0070699_100000435 Ga0070699_10000043524 252
133 3300005530 Ga0070679_100007617 Ga0070679_1000076176 252
134 3300005535 Ga0070684_100081807 Ga0070684_1000818071 252
135 3300005539 Ga0068853_100098460 Ga0068853_1000984604 252
136 3300005544 Ga0070686_100011189 Ga0070686_1000111896 252
137 3300005545 Ga0070695_100002983 Ga0070695_1000029834 252
138 3300005546 Ga0070696_100002652 Ga0070696_1000026524 252
139 3300005548 Ga0070665_100000319 Ga0070665_10000031963 252
140 3300005548 Ga0070665_100086223 Ga0070665_1000862232 252
141 3300005549 Ga0070704_100007062 Ga0070704_1000070624 252
142 3300005549 Ga0070704_100054095 Ga0070704_1000540952 252
143 3300005563 Ga0068855_100037402 Ga0068855_1000374022 252
144 3300005563 Ga0068855_100085627 Ga0068855_1000856272 252
145 3300005564 Ga0070664_100026073 Ga0070664_1000260732 252
146 3300005577 Ga0068857_100006642 Ga0068857_1000066427 252
147 3300005578 Ga0068854_100018076 Ga0068854_1000180764 252
148 3300005614 Ga0068856_100052815 Ga0068856_1000528152 252
149 3300005614 Ga0068856_100180161 Ga0068856_1001801612 252
150 3300005616 Ga0068852_100000169 Ga0068852_10000016934 252
151 3300005616 Ga0068852_100027497 Ga0068852_1000274972 252
152 3300005616 Ga0068852_100259592 Ga0068852_1002595922 252
153 3300005617 Ga0068859_100013037 Ga0068859_1000130374 252
154 3300005617 Ga0068859_100030922 Ga0068859_1000309223 252
155 3300005617 Ga0068859_100115614 Ga0068859_1001156143 252
156 3300005617 Ga0068859_100185092 Ga0068859_1001850922 252
157 3300005618 Ga0068864_100001072 Ga0068864_10000107216 252
158 3300005719 Ga0068861_100013822 Ga0068861_1000138221 252
159 3300005719 Ga0068861_100061981 Ga0068861_1000619814 252
160 3300005841 Ga0068863_100002594 Ga0068863_1000025948 252
161 3300005841 Ga0068863_100004664 Ga0068863_1000046643 252
162 3300005842 Ga0068858_100004870 Ga0068858_1000048703 252
163 3300005842 Ga0068858_100165988 Ga0068858_1001659883 252
164 3300005843 Ga0068860_100009800 Ga0068860_1000098004 252
165 3300005843 Ga0068860_100029758 Ga0068860_1000297582 252
166 3300005843 Ga0068860_100039467 Ga0068860_1000394671 252
167 3300005843 Ga0068860_100065597 Ga0068860_1000655972 252
168 3300005843 Ga0068860_100116951 Ga0068860_1001169513 252
169 3300005844 Ga0068862_100000866 Ga0068862_10000086617 252
170 3300005844 Ga0068862_100010264 Ga0068862_1000102642 252
171 3300005844 Ga0068862_100485827 Ga0068862_1004858271 252
172 3300006042 Ga0075368_10002950 Ga0075368_100029509 252
173 3300006051 Ga0075364_10003873 Ga0075364_100038737 252
174 3300006051 Ga0075364_10127801 Ga0075364_101278011 252
175 3300006051 Ga0075364_10313664 Ga0075364_103136642 252
176 3300006058 Ga0075432_10000822 Ga0075432_100008227 252
177 3300006163 Ga0070715_10218681 Ga0070715_102186811 252
178 3300006237 Ga0097621_100071890 Ga0097621_1000718905 252
179 3300006353 Ga0075370_10027382 Ga0075370_100273822 252
180 3300006844 Ga0075428_100020451 Ga0075428_1000204516 252
181 3300006844 Ga0075428_100204819 Ga0075428_1002048193 252
182 3300006846 Ga0075430_100003913 Ga0075430_1000039133 252
183 3300006846 Ga0075430_100023915 Ga0075430_1000239157 252
184 3300006846 Ga0075430_100039705 Ga0075430_1000397053 252
185 3300006847 Ga0075431_100002086 Ga0075431_10000208621 252
186 3300006847 Ga0075431_100003429 Ga0075431_1000034293 252
187 3300006847 Ga0075431_100069487 Ga0075431_1000694873 252
188 3300006847 Ga0075431_100247449 Ga0075431_1002474494 252
189 3300006871 Ga0075434_100274530 Ga0075434_1002745302 252
190 3300006871 Ga0075434_100374265 Ga0075434_1003742652 252
191 3300006880 Ga0075429_100016736 Ga0075429_1000167363 252
192 3300006880 Ga0075429_100178803 Ga0075429_1001788032 252
193 3300006931 Ga0097620_100013038 Ga0097620_1000130387 252
194 3300006931 Ga0097620_100030922 Ga0097620_1000309223 252
195 3300006931 Ga0097620_100115614 Ga0097620_1001156143 252
196 3300006931 Ga0097620_100185089 Ga0097620_1001850892 252
197 3300009011 Ga0105251_10003236 Ga0105251_1000323613 252
198 3300009093 Ga0105240_10157543 Ga0105240_101575435 252
199 3300009093 Ga0105240_10321550 Ga0105240_103215502 252
200 3300009094 Ga0111539_10007982 Ga0111539_100079824 252
201 3300009094 Ga0111539_10008813 Ga0111539_100088138 252
202 3300009094 Ga0111539_10197472 Ga0111539_101974722 252
203 3300009094 Ga0111539_10322534 Ga0111539_103225342 252
204 3300009098 Ga0105245_10001093 Ga0105245_1000109317 252
205 3300009101 Ga0105247_10008448 Ga0105247_100084489 252
206 3300009147 Ga0114129_10072454 Ga0114129_100724544 252
207 3300009147 Ga0114129_10093102 Ga0114129_100931023 252
208 3300009147 Ga0114129_10846949 Ga0114129_108469492 252
209 3300009148 Ga0105243_10156740 Ga0105243_101567402 252
210 3300009176 Ga0105242_10133911 Ga0105242_101339114 252
211 3300009177 Ga0105248_10006421 Ga0105248_1000642113 252
212 3300009177 Ga0105248_10033092 Ga0105248_100330923 252
213 3300009177 Ga0105248_10043494 Ga0105248_100434942 252
214 3300009551 Ga0105238_10010483 Ga0105238_1001048314 252
215 3300009551 Ga0105238_10151448 Ga0105238_101514482 252
216 3300009553 Ga0105249_10007276 Ga0105249_100072763 252
217 3300010375 Ga0105239_10288921 Ga0105239_102889213 252
218 3300010375 Ga0105239_10502248 Ga0105239_105022482 252
219 3300011119 Ga0105246_10002251 Ga0105246_1000225111 252
220 3300011119 Ga0105246_10004894 Ga0105246_100048945 252
221 3300011119 Ga0105246_10023691 Ga0105246_100236913 252
222 3300013100 Ga0157373_10057593 Ga0157373_100575932 252
223 3300013296 Ga0157374_10001203 Ga0157374_1000120310 252
224 3300013297 Ga0157378_10132606 Ga0157378_101326062 252
225 3300013306 Ga0163162_10005300 Ga0163162_1000530011 252
226 3300014325 Ga0163163_10000433 Ga0163163_100004333 252
227 3300014326 Ga0157380_10077684 Ga0157380_100776841 252
228 3300014326 Ga0157380_10544337 Ga0157380_105443372 252
229 3300014968 Ga0157379_10049871 Ga0157379_100498713 252
230 3300014968 Ga0157379_10345608 Ga0157379_103456081 252
231 3300014969 Ga0157376_10044510 Ga0157376_100445102 252
232 3300014969 Ga0157376_10169559 Ga0157376_101695592 252
233 3300025298 Ga0209050_1000119 Ga0209050_100011984 252
234 3300025315 Ga0207697_10157776 Ga0207697_101577761 252
235 3300025321 Ga0207656_10051290 Ga0207656_100512902 252
236 3300025735 Ga0207713_1002886 Ga0207713_100288613 252
237 3300025885 Ga0207653_10001041 Ga0207653_100010416 252
238 3300025901 Ga0207688_10154189 Ga0207688_101541892 252
239 3300025903 Ga0207680_10015444 Ga0207680_100154443 252
240 3300025903 Ga0207680_10152458 Ga0207680_101524582 252
241 3300025904 Ga0207647_10029148 Ga0207647_100291482 252
242 3300025904 Ga0207647_10041236 Ga0207647_100412362 252
243 3300025909 Ga0207705_10000009 Ga0207705_10000009506 252
244 3300025910 Ga0207684_10056161 Ga0207684_100561612 252
245 3300025913 Ga0207695_10237313 Ga0207695_102373132 252
246 3300025913 Ga0207695_10257545 Ga0207695_102575452 252
247 3300025917 Ga0207660_10005228 Ga0207660_100052287 252
248 3300025917 Ga0207660_10296688 Ga0207660_102966882 252
249 3300025918 Ga0207662_10256699 Ga0207662_102566992 252
250 3300025919 Ga0207657_10126446 Ga0207657_101264463 252
251 3300025920 Ga0207649_10032403 Ga0207649_100324034 252
252 3300025920 Ga0207649_10188362 Ga0207649_101883622 252
253 3300025921 Ga0207652_10015079 Ga0207652_100150791 252
254 3300025921 Ga0207652_10545003 Ga0207652_105450032 252
255 3300025922 Ga0207646_10073923 Ga0207646_100739232 252
256 3300025923 Ga0207681_10124332 Ga0207681_101243322 252
257 3300025924 Ga0207694_10045398 Ga0207694_100453986 252
258 3300025924 Ga0207694_10047515 Ga0207694_100475152 252
259 3300025925 Ga0207650_10210150 Ga0207650_102101502 252
260 3300025925 Ga0207650_10515334 Ga0207650_105153341 252
261 3300025927 Ga0207687_10007530 Ga0207687_1000753010 252
262 3300025931 Ga0207644_10006124 Ga0207644_1000612410 252
263 3300025931 Ga0207644_10006524 Ga0207644_100065244 252
264 3300025931 Ga0207644_10023896 Ga0207644_100238966 252
265 3300025931 Ga0207644_10100479 Ga0207644_101004793 252
266 3300025932 Ga0207690_10041295 Ga0207690_100412953 252
267 3300025933 Ga0207706_10029117 Ga0207706_100291174 252
268 3300025933 Ga0207706_10058619 Ga0207706_100586195 252
269 3300025933 Ga0207706_10075982 Ga0207706_100759824 252
270 3300025934 Ga0207686_10048899 Ga0207686_100488992 252
271 3300025936 Ga0207670_10010867 Ga0207670_100108677 252
272 3300025941 Ga0207711_10003182 Ga0207711_1000318213 252
273 3300025941 Ga0207711_10019446 Ga0207711_100194463 252
274 3300025942 Ga0207689_10025646 Ga0207689_100256466 252
275 3300025944 Ga0207661_10022029 Ga0207661_100220299 252
276 3300025944 Ga0207661_10255779 Ga0207661_102557792 252
277 3300025945 Ga0207679_10012194 Ga0207679_100121942 252
278 3300025949 Ga0207667_10008852 Ga0207667_100088526 252
279 3300025949 Ga0207667_10064815 Ga0207667_100648152 252
280 3300025961 Ga0207712_10002056 Ga0207712_100020564 252
281 3300025981 Ga0207640_10013218 Ga0207640_100132184 252
282 3300025986 Ga0207658_10004197 Ga0207658_100041972 252
283 3300025986 Ga0207658_10046198 Ga0207658_100461986 252
284 3300025986 Ga0207658_10241403 Ga0207658_102414032 252
285 3300026023 Ga0207677_10010473 Ga0207677_100104732 252
286 3300026035 Ga0207703_10011608 Ga0207703_100116088 252
287 3300026035 Ga0207703_10158029 Ga0207703_101580293 252
288 3300026041 Ga0207639_10100612 Ga0207639_101006124 252
289 3300026067 Ga0207678_10019221 Ga0207678_1001922110 252
290 3300026075 Ga0207708_10001278 Ga0207708_100012787 252
291 3300026075 Ga0207708_10033844 Ga0207708_100338446 252
292 3300026078 Ga0207702_10059447 Ga0207702_100594475 252
293 3300026078 Ga0207702_10147627 Ga0207702_101476272 252
294 3300026088 Ga0207641_10004522 Ga0207641_1000452216 252
295 3300026088 Ga0207641_10031498 Ga0207641_100314982 252
296 3300026095 Ga0207676_10001795 Ga0207676_100017956 252
297 3300026095 Ga0207676_10139196 Ga0207676_101391963 252
298 3300026116 Ga0207674_10006724 Ga0207674_100067248 252
299 3300026118 Ga0207675_100024013 Ga0207675_1000240137 252
300 3300026118 Ga0207675_100142996 Ga0207675_1001429966 252
301 3300026121 Ga0207683_10063050 Ga0207683_100630502 252
302 3300026121 Ga0207683_10183930 Ga0207683_101839302 252
303 3300026142 Ga0207698_10000111 Ga0207698_100001112 252
304 3300026142 Ga0207698_10039004 Ga0207698_100390042 252
305 3300026142 Ga0207698_10152756 Ga0207698_101527563 252
306 3300027665 Ga0209983_1022670 Ga0209983_10226701 252
307 3300027866 Ga0209813_10000069 Ga0209813_1000006929 252
308 3300027876 Ga0209974_10018229 Ga0209974_100182292 252
309 3300027907 Ga0207428_10061910 Ga0207428_100619107 252
310 3300028379 Ga0268266_10000212 Ga0268266_1000021253 252
311 3300028379 Ga0268266_10078012 Ga0268266_100780122 252
312 3300028380 Ga0268265_10001316 Ga0268265_1000131613 252
313 3300028380 Ga0268265_10420562 Ga0268265_104205622 252
314 3300028381 Ga0268264_10002022 Ga0268264_1000202215 252
315 3300028381 Ga0268264_10019868 Ga0268264_100198685 252
316 3300028381 Ga0268264_10020743 Ga0268264_100207437 252
317 3300028381 Ga0268264_10068302 Ga0268264_100683024 252
318 3300028381 Ga0268264_10096796 Ga0268264_100967962 252
319 3300031548 Ga0307408_100154730 Ga0307408_1001547303 252
320 3300031731 Ga0307405_10048602 Ga0307405_100486022 252
321 3300031731 Ga0307405_10255104 Ga0307405_102551042 252
322 3300031824 Ga0307413_10166255 Ga0307413_101662552 252
323 3300031824 Ga0307413_10261186 Ga0307413_102611862 252
324 3300031852 Ga0307410_10240700 Ga0307410_102407002 252
325 3300031852 Ga0307410_10601513 Ga0307410_106015131 252
326 3300031911 Ga0307412_10052654 Ga0307412_100526543 252
327 3300031911 Ga0307412_10070762 Ga0307412_100707622 252
328 3300031995 Ga0307409_100067198 Ga0307409_1000671982 252
329 3300032002 Ga0307416_100321413 Ga0307416_1003214132 252
330 3300032004 Ga0307414_10016727 Ga0307414_100167272 252
331 3300035114 Ga0373939_0051112 Ga0373939_0051112_388_1158 252
332 3300035117 Ga0373953_0026198 Ga0373953_0026198_1145_1957 252
333 3300035172 Ga0373955_0010662 Ga0373955_0010662_699_1511 252
334 3300035695 Ga0373927_0112708 Ga0373927_0112708_122_892 252
335 3300035724 Ga0373933_0157221 Ga0373933_0157221_135_947 252
336 3300036401 Ga0373937_0002739 Ga0373937_0002739_3978_4790 252
337 3300036401 Ga0373937_0201219 Ga0373937_0201219_564_1334 252
338 3300036647 Ga0316582_0205738 Ga0316582_0205738_550_1308 252
339 3300036712 Ga0316584_0114864 Ga0316584_0114864_834_1592 252
340 3300038726 Ga0400490_22429 Ga0400490_22429_229_999 252
341 3300038735 Ga0400485_08081 Ga0400485_08081_1295_2065 252
342 3300038742 Ga0400486_10851 Ga0400486_10851_481_1251 252
343 3300038742 Ga0400486_17016 Ga0400486_17016_1402_2172 252
344 3300039110 Ga0400487_18928 Ga0400487_18928_533_1303 252
345 3300042015 Ga0439462_0038649 Ga0439462_0038649_69_827 252
346 3300042125 Ga0450923_014528 Ga0450923_014528_21_791 252
347 3300046500 Ga0495596_0000625 Ga0495596_0000625_1511_2281 252
348 3300046500 Ga0495596_0000662 Ga0495596_0000662_5094_5864 252
349 3300046501 Ga0495607_0016306 Ga0495607_0016306_3249_4019 252
350 3300046506 Ga0495583_0062925 Ga0495583_0062925_818_1588 252
351 3300046507 Ga0495606_0139508 Ga0495606_0139508_428_1198 252
352 3300046512 Ga0495610_0000104 Ga0495610_0000104_27963_28733 252
353 3300046512 Ga0495610_0027769 Ga0495610_0027769_338_1108 252
354 3300046522 Ga0495643_0000023 Ga0495643_0000023_90143_90913 252
355 3300046522 Ga0495643_0014027 Ga0495643_0014027_630_1400 252
356 3300046522 Ga0495643_0030092 Ga0495643_0030092_945_1703 252
357 3300046522 Ga0495643_0105758 Ga0495643_0105758_289_1059 252
358 3300046538 Ga0495609_0004365 Ga0495609_0004365_1765_2535 252
359 3300046539 Ga0495621_0030410 Ga0495621_0030410_820_1578 252
360 3300046558 Ga0495633_0076284 Ga0495633_0076284_205_975 252
361 3300046692 Ga0495671_0043114 Ga0495671_0043114_1368_2138 252
362 3300047472 Ga0495686_0107327 Ga0495686_0107327_25_795 252
363 3300047673 Ga0495593_0055035 Ga0495593_0055035_1173_1943 252
364 3300048090 Ga0495615_0044902 Ga0495615_0044902_281_1039 252
365 3300048091 Ga0495626_0029271 Ga0495626_0029271_477_1247 252
366 3300048903 Ga0496100_0095089 Ga0496100_0095089_720_1478 252
367 3300048903 Ga0496100_0408491 Ga0496100_0408491_57_827 252
368 3300048904 Ga0496101_0432345 Ga0496101_0432345_155_913 252
369 3300048904 Ga0496101_0573739 Ga0496101_0573739_53_823 252
370 3300048905 Ga0496102_0000972 Ga0496102_0000972_25692_26462 252
371 3300048905 Ga0496102_0328410 Ga0496102_0328410_176_946 252
372 3300048906 Ga0496103_0004335 Ga0496103_0004335_6817_7575 252
373 3300048906 Ga0496103_0053713 Ga0496103_0053713_521_1291 252
374 3300048909 Ga0496106_0000362 Ga0496106_0000362_16882_17652 252
375 3300048910 Ga0496107_0004589 Ga0496107_0004589_4616_5386 252
376 3300048911 Ga0496108_0093028 Ga0496108_0093028_783_1553 252
377 3300048912 Ga0496109_0038655 Ga0496109_0038655_1158_1928 252
378 3300048913 Ga0496110_0177457 Ga0496110_0177457_959_1729 252
379 3300048915 Ga0496112_0011257 Ga0496112_0011257_2040_2810 252
380 3300048916 Ga0496113_0204939 Ga0496113_0204939_404_1174 252
381 3300048917 Ga0496114_0132028 Ga0496114_0132028_318_1088 252
382 3300048918 Ga0496115_0017172 Ga0496115_0017172_3833_4603 252
383 3300048919 Ga0496116_0000035 Ga0496116_0000035_65717_66475 252
384 3300048920 Ga0496117_0019809 Ga0496117_0019809_584_1342 252
385 3300048921 Ga0496118_0047174 Ga0496118_0047174_2324_3082 252
386 3300048921 Ga0496118_0055728 Ga0496118_0055728_1233_1991 252
387 3300048922 Ga0496119_0244269 Ga0496119_0244269_51_809 252
388 3300048924 Ga0496121_0000070 Ga0496121_0000070_247024_247785 252
389 3300048924 Ga0496121_0004707 Ga0496121_0004707_400_1158 252
390 3300048924 Ga0496121_0043487 Ga0496121_0043487_1288_2046 252
391 3300048925 Ga0496122_0014798 Ga0496122_0014798_4823_5581 252
392 3300048926 Ga0496123_0002019 Ga0496123_0002019_18334_19092 252
393 3300048926 Ga0496123_0088671 Ga0496123_0088671_1070_1828 252
394 3300048927 Ga0496124_0029744 Ga0496124_0029744_1332_2090 252
395 3300048927 Ga0496124_0194940 Ga0496124_0194940_188_946 252
396 3300048928 Ga0496125_0032235 Ga0496125_0032235_3563_4321 252
397 3300048928 Ga0496125_0038471 Ga0496125_0038471_2143_2901 252
398 3300048928 Ga0496125_0134486 Ga0496125_0134486_637_1395 252
399 3300048929 Ga0496126_0000084 Ga0496126_0000084_167522_168280 252
400 3300049570 Ga0501033_0061089 Ga0501033_0061089_28_798 252
401 3300049571 Ga0501034_0394210 Ga0501034_0394210_451_1209 252
402 3300049572 Ga0501036_0135871 Ga0501036_0135871_148_912 252
403 3300049573 Ga0501037_0168949 Ga0501037_0168949_40_804 252
404 3300049575 Ga0501039_0209794 Ga0501039_0209794_693_1463 252
405 3300049575 Ga0501039_0367136 Ga0501039_0367136_258_1028 252
406 3300049577 Ga0501041_0032229 Ga0501041_0032229_276_1046 252
407 3300049577 Ga0501041_0088537 Ga0501041_0088537_892_1662 252
408 3300049581 Ga0501047_0140060 Ga0501047_0140060_261_1025 252
409 3300049582 Ga0501048_0014311 Ga0501048_0014311_4470_5240 252
410 3300049582 Ga0501048_0230005 Ga0501048_0230005_502_1272 252
411 3300049583 Ga0501067_0179247 Ga0501067_0179247_28_798 252
412 3300049587 Ga0501071_0056867 Ga0501071_0056867_1434_2204 252
413 3300049588 Ga0501072_0033785 Ga0501072_0033785_1336_2106 252
414 3300049589 Ga0501073_0152073 Ga0501073_0152073_232_1050 252
415 3300049590 Ga0501074_0258066 Ga0501074_0258066_412_1182 252
416 3300049591 Ga0501075_0011677 Ga0501075_0011677_3731_4501 252
417 3300049591 Ga0501075_0187710 Ga0501075_0187710_466_1236 252
418 3300049591 Ga0501075_0353471 Ga0501075_0353471_323_1093 252
419 3300049592 Ga0501076_0051403 Ga0501076_0051403_1775_2545 252
420 3300049592 Ga0501076_0122140 Ga0501076_0122140_980_1750 252
421 3300049592 Ga0501076_0153263 Ga0501076_0153263_215_985 252
422 3300049592 Ga0501076_0652279 Ga0501076_0652279_37_807 252
423 3300049593 Ga0501077_0038047 Ga0501077_0038047_1609_2379 252
424 3300049593 Ga0501077_0045855 Ga0501077_0045855_1555_2325 252
425 3300049593 Ga0501077_0378079 Ga0501077_0378079_92_862 252
426 3300049741 Ga0501079_0003608 Ga0501079_0003608_2909_3679 252
427 3300049741 Ga0501079_0053287 Ga0501079_0053287_686_1456 252
428 3300049741 Ga0501079_0109992 Ga0501079_0109992_543_1313 252
429 3300049743 Ga0501081_0033845 Ga0501081_0033845_2510_3280 252
430 3300049743 Ga0501081_0112997 Ga0501081_0112997_1127_1897 252
431 3300049744 Ga0501083_0160499 Ga0501083_0160499_119_889 252
432 3300049823 Ga0501044_0002739 Ga0501044_0002739_1620_2378 252
433 3300049824 Ga0501045_0071462 Ga0501045_0071462_721_1491 252
434 3300050489 nmdc:mga03683_582_c1 nmdc:mga03683_582_c1_2873_3634 252
435 3300050489 nmdc:mga03683_582_c1 nmdc:mga03683_582_c1_6841_7602 252
436 3300050490 nmdc:mga03n38_34195_c1 nmdc:mga03n38_34195_c1_940_1701 252
437 3300050491 nmdc:mga00v17_1542_c2 nmdc:mga00v17_1542_c2_3015_3776 252
438 3300050491 nmdc:mga00v17_2152_c1 nmdc:mga00v17_2152_c1_3948_4709 252
439 3300050494 nmdc:mga06z11_12519_c1 nmdc:mga06z11_12519_c1_1379_2140 252
440 3300050495 nmdc:mga04h51_710_c1 nmdc:mga04h51_710_c1_2873_3634 252
441 3300050496 nmdc:mga07m45_185997_c1 nmdc:mga07m45_185997_c1_205_966 252
442 3300050496 nmdc:mga07m45_53_c1 nmdc:mga07m45_53_c1_49623_50384 252
443 3300050496 nmdc:mga07m45_66488_c1 nmdc:mga07m45_66488_c1_276_1037 252
444 3300050507 nmdc:mga05p37_128250_c1 nmdc:mga05p37_128250_c1_695_1465 252
445 3300050508 nmdc:mga09592_59967_c1 nmdc:mga09592_59967_c1_1768_2538 252
446 3300050509 nmdc:mga0qj67_11371_c1 nmdc:mga0qj67_11371_c1_2127_2897 252
447 3300050509 nmdc:mga0qj67_2771_c1 nmdc:mga0qj67_2771_c1_10882_11652 252
448 3300050509 nmdc:mga0qj67_89701_c1 nmdc:mga0qj67_89701_c1_1055_1825 252
449 3300050510 nmdc:mga06r32_265446_c1 nmdc:mga06r32_265446_c1_208_978 252
450 3300050510 nmdc:mga06r32_41488_c1 nmdc:mga06r32_41488_c1_2525_3295 252
451 3300050510 nmdc:mga06r32_6820_c1 nmdc:mga06r32_6820_c1_1724_2494 252
452 3300050510 nmdc:mga06r32_8867_c1 nmdc:mga06r32_8867_c1_2730_3500 252
453 3300050511 nmdc:mga08y16_28067_c1 nmdc:mga08y16_28067_c1_3792_4562 252
454 3300050515 nmdc:mga0a205_9747_c1 nmdc:mga0a205_9747_c1_1954_2724 252
455 3300050516 nmdc:mga0sz30_18348_c1 nmdc:mga0sz30_18348_c1_1533_2294 252
456 3300050516 nmdc:mga0sz30_404_c1 nmdc:mga0sz30_404_c1_6355_7116 252
457 3300053077 Ga0495601_0056833 Ga0495601_0056833_63_833 252
458 3300053085 Ga0495619_0230278 Ga0495619_0230278_253_1023 252
459 3300053087 Ga0500643_000001 Ga0500643_000001_1122985_1123743 252
460 3300053125 Ga0500618_028617 Ga0500618_028617_47_814 252
461 3300053153 Ga0500616_0003651 Ga0500616_0003651_524_1282 252
462 3300054114 Ga0501084_0019344 Ga0501084_0019344_4100_4870 252
463 3300054114 Ga0501084_0310092 Ga0501084_0310092_19_789 252
464 3300054114 Ga0501084_0371144 Ga0501084_0371144_323_1093 252
465 3300060353 Ga0501082_0017447 Ga0501082_0017447_1045_1815 252
466 3300060353 Ga0501082_0046733 Ga0501082_0046733_2243_3013 252
467 3300060353 Ga0501082_0121387 Ga0501082_0121387_1314_2084 252
468 3300060353 Ga0501082_0197962 Ga0501082_0197962_543_1313 252
469 3300060353 Ga0501082_0281339 Ga0501082_0281339_288_1058 252
470 3300060353 Ga0501082_0526225 Ga0501082_0526225_52_822 252
471 3300061734 Ga0530510_0008259 Ga0530510_0008259_3519_4289 252
472 3300061734 Ga0530510_0015817 Ga0530510_0015817_4080_4850 252
473 2162886007 SwRhRL2b_contig_1439351 SwRhRL2b_0755.00003710 253
474 3300002239 JGI24034J26672_10021882 JGI24034J26672_100218821 253
475 3300005289 Ga0065704_10201327 Ga0065704_102013272 253
476 3300005327 Ga0070658_10005251 Ga0070658_100052513 253
477 3300005327 Ga0070658_10228142 Ga0070658_102281422 253
478 3300005327 Ga0070658_10265901 Ga0070658_102659012 253
479 3300005329 Ga0070683_100176196 Ga0070683_1001761962 253
480 3300005335 Ga0070666_10210481 Ga0070666_102104812 253
481 3300005336 Ga0070680_100011300 Ga0070680_1000113002 253
482 3300005339 Ga0070660_100004077 Ga0070660_10000407711 253
483 3300005339 Ga0070660_100022443 Ga0070660_1000224437 253
484 3300005344 Ga0070661_100000735 Ga0070661_10000073524 253
485 3300005347 Ga0070668_100023165 Ga0070668_1000231654 253
486 3300005353 Ga0070669_100000357 Ga0070669_10000035721 253
487 3300005353 Ga0070669_100186302 Ga0070669_1001863022 253
488 3300005355 Ga0070671_100002926 Ga0070671_1000029263 253
489 3300005366 Ga0070659_100002707 Ga0070659_10000270710 253
490 3300005366 Ga0070659_100173382 Ga0070659_1001733822 253
491 3300005367 Ga0070667_100000703 Ga0070667_10000070315 253
492 3300005455 Ga0070663_100008334 Ga0070663_1000083349 253
493 3300005457 Ga0070662_100000685 Ga0070662_10000068513 253
494 3300005458 Ga0070681_10005216 Ga0070681_1000521610 253
495 3300005530 Ga0070679_100122670 Ga0070679_1001226702 253
496 3300005535 Ga0070684_100068427 Ga0070684_1000684273 253
497 3300005539 Ga0068853_100000358 Ga0068853_1000003588 253
498 3300005548 Ga0070665_100009283 Ga0070665_1000092838 253
499 3300005563 Ga0068855_100002925 Ga0068855_10000292511 253
500 3300005564 Ga0070664_100007055 Ga0070664_1000070552 253
501 3300005577 Ga0068857_100019286 Ga0068857_1000192867 253
502 3300005578 Ga0068854_100008377 Ga0068854_1000083779 253
503 3300005614 Ga0068856_100005500 Ga0068856_10000550010 253
504 3300005618 Ga0068864_100098965 Ga0068864_1000989652 253
505 3300005841 Ga0068863_100000014 Ga0068863_10000001451 253
506 3300005841 Ga0068863_100474111 Ga0068863_1004741112 253
507 3300005842 Ga0068858_100055327 Ga0068858_1000553272 253
508 3300009092 Ga0105250_10025545 Ga0105250_100255453 253
509 3300009101 Ga0105247_10065288 Ga0105247_100652882 253
510 3300013100 Ga0157373_10040948 Ga0157373_100409483 253
511 3300013102 Ga0157371_10004503 Ga0157371_100045033 253
512 3300013104 Ga0157370_10009970 Ga0157370_1000997012 253
513 3300013104 Ga0157370_10061361 Ga0157370_100613613 253
514 3300013105 Ga0157369_10126508 Ga0157369_101265082 253
515 3300013306 Ga0163162_10120766 Ga0163162_101207662 253
516 3300013306 Ga0163162_10171604 Ga0163162_101716042 253
517 3300013307 Ga0157372_10149186 Ga0157372_101491862 253
518 3300013307 Ga0157372_10322834 Ga0157372_103228342 253
519 3300025711 Ga0207696_1010467 Ga0207696_10104673 253
520 3300025903 Ga0207680_10247337 Ga0207680_102473372 253
521 3300025909 Ga0207705_10009562 Ga0207705_100095626 253
522 3300025909 Ga0207705_10042290 Ga0207705_100422902 253
523 3300025912 Ga0207707_10021788 Ga0207707_100217882 253
524 3300025917 Ga0207660_10057433 Ga0207660_100574331 253
525 3300025919 Ga0207657_10000077 Ga0207657_1000007730 253
526 3300025919 Ga0207657_10062671 Ga0207657_100626715 253
527 3300025920 Ga0207649_10009270 Ga0207649_100092703 253
528 3300025921 Ga0207652_10018222 Ga0207652_100182229 253
529 3300025923 Ga0207681_10000321 Ga0207681_1000032119 253
530 3300025923 Ga0207681_10000667 Ga0207681_1000066727 253
531 3300025931 Ga0207644_10014842 Ga0207644_100148426 253
532 3300025932 Ga0207690_10001427 Ga0207690_1000142711 253
533 3300025933 Ga0207706_10000204 Ga0207706_100002043 253
534 3300025944 Ga0207661_10003474 Ga0207661_1000347411 253
535 3300025949 Ga0207667_10011937 Ga0207667_100119372 253
536 3300025972 Ga0207668_10015821 Ga0207668_100158216 253
537 3300025981 Ga0207640_10007531 Ga0207640_1000753110 253
538 3300025986 Ga0207658_10000514 Ga0207658_1000051418 253
539 3300026035 Ga0207703_10043897 Ga0207703_100438972 253
540 3300026041 Ga0207639_10000847 Ga0207639_100008473 253
541 3300026067 Ga0207678_10338154 Ga0207678_103381541 253
542 3300026078 Ga0207702_10015456 Ga0207702_1001545610 253
543 3300026088 Ga0207641_10000126 Ga0207641_1000012652 253
544 3300026095 Ga0207676_10017419 Ga0207676_100174193 253
545 3300026116 Ga0207674_10053594 Ga0207674_100535943 253
546 3300028379 Ga0268266_10007074 Ga0268266_100070748 253
547 3300028381 Ga0268264_10113621 Ga0268264_101136214 253
548 3300031548 Ga0307408_100065485 Ga0307408_1000654852 253
549 3300031824 Ga0307413_10027011 Ga0307413_100270112 253
550 3300031824 Ga0307413_10146567 Ga0307413_101465673 253
551 3300031852 Ga0307410_10113003 Ga0307410_101130031 253
552 3300031852 Ga0307410_10394934 Ga0307410_103949342 253
553 3300031901 Ga0307406_10133779 Ga0307406_101337792 253
554 3300031903 Ga0307407_10015575 Ga0307407_100155754 253
555 3300031911 Ga0307412_10050317 Ga0307412_100503173 253
556 3300031995 Ga0307409_100680112 Ga0307409_1006801121 253
557 3300032002 Ga0307416_100019598 Ga0307416_1000195982 253
558 3300032002 Ga0307416_100775921 Ga0307416_1007759212 253
559 3300032126 Ga0307415_100050391 Ga0307415_1000503914 253
560 3300042530 Ga0450916_010780 Ga0450916_010780_190_957 253
561 3300046537 Ga0495598_0064611 Ga0495598_0064611_209_976 253
562 3300048904 Ga0496101_0245672 Ga0496101_0245672_314_1075 253
563 3300048905 Ga0496102_0000106 Ga0496102_0000106_116100_116861 253
564 3300048905 Ga0496102_0106739 Ga0496102_0106739_1405_2175 253
565 3300048906 Ga0496103_0000128 Ga0496103_0000128_12200_12961 253
566 3300048906 Ga0496103_0039010 Ga0496103_0039010_1523_2293 253
567 3300048907 Ga0496104_0004170 Ga0496104_0004170_11118_11984 253
568 3300048907 Ga0496104_0006287 Ga0496104_0006287_16_786 253
569 3300048908 Ga0496105_0002625 Ga0496105_0002625_11206_11976 253
570 3300048908 Ga0496105_0021662 Ga0496105_0021662_266_1132 253
571 3300048909 Ga0496106_0393528 Ga0496106_0393528_230_991 253
572 3300048910 Ga0496107_0084985 Ga0496107_0084985_515_1276 253
573 3300048917 Ga0496114_0488566 Ga0496114_0488566_259_1026 253
574 3300048919 Ga0496116_0044661 Ga0496116_0044661_1928_2689 253
575 3300048920 Ga0496117_0003021 Ga0496117_0003021_12888_13649 253
576 3300048921 Ga0496118_0019621 Ga0496118_0019621_1724_2494 253
577 3300048921 Ga0496118_0068432 Ga0496118_0068432_1486_2247 253
578 3300048921 Ga0496118_0189644 Ga0496118_0189644_140_910 253
579 3300048922 Ga0496119_0001217 Ga0496119_0001217_3567_4433 253
580 3300048923 Ga0496120_0007787 Ga0496120_0007787_5847_6713 253
581 3300048924 Ga0496121_0000222 Ga0496121_0000222_108165_108935 253
582 3300048924 Ga0496121_0354773 Ga0496121_0354773_198_959 253
583 3300048925 Ga0496122_0129332 Ga0496122_0129332_135_896 253
584 3300048925 Ga0496122_0129440 Ga0496122_0129440_607_1473 253
585 3300048927 Ga0496124_0000417 Ga0496124_0000417_32678_33439 253
586 3300048929 Ga0496126_0000493 Ga0496126_0000493_69451_70317 253
587 3300049823 Ga0501044_0167309 Ga0501044_0167309_131_895 253
588 3300049823 Ga0501044_0192861 Ga0501044_0192861_780_1550 253
589 3300053122 Ga0500608_003606 Ga0500608_003606_2961_3722 253

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16123

HAGH_C

Hydroxyacylglutathione hydrolase C-terminus

206

287

0.98

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

48

205

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xm8-assembly2.cif.gz_B x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 0.9723 3 252
1qh5-assembly1.cif.gz_B human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl)glutathione 0.958 3 253
1xm8-assembly2.cif.gz_B x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 0.9572 3 252
8ewo-assembly2.cif.gz_B crystal structure of putative glyoxylase ii from pseudomonas aeruginosa 0.9529 1 252
2qed-assembly1.cif.gz_A crystal structure of salmonella thyphimurium lt2 glyoxalase ii 0.9511 1 252
ID Description Score Start End Superfamily
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9753 3 252 3.60.15.10
af_O35952_50_309_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9607 3 253 3.60.15.10
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9602 3 252 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9589 3 253 3.60.15.10
af_A0A1D6K1V4_1_276_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9572 3 253 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A3D2E949-F1-model_v4 deleted 0.9997 129 252
AF-A0A2N3B0W4-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 0.9964 1 252 GO:0004416
GO:0019243
GO:0046872
AF-A0A4V1V7I5-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) 0.9931 1 221 GO:0004416
GO:0019243
GO:0046872
AF-A0A258HXA9-F1-model_v4 hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) 0.9927 160 252 GO:0016787
GO:0046872
AF-A0A2N3B0W4-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 0.9924 1 252 GO:0004416
GO:0019243
GO:0046872

Feature Viewer

pLDDT pTM Quality
97.18 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map