F466901
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 589 | 290 | 575 | 254 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0004170|Ga0496104_0004170_11118_11984 |
| Length | 288 |
| Sequence | MSRSWRAWQVNFRLPSFALQHLRYEKQCLGSGAKAMIEIHQFPCLSDNYGYLVHDGASGETVCIDTPDAGRYLEEAAARGWRITQIWNTHWHADHAGGNTAIKAATGCTITAPLAEAAKIEGVDRTVDQGDTVRLGDHVAQVLAVGGHTLGHVAYHLPDAGAAFVGDALFALGCGRMFEGTAPQFWTSLSRLKALPAATLVYCAHEYTASNARFAVHADPDNADLAAYADEVAQCRAQDLPTVPTSLDRELATNPFLRADDPALQSRWGGGDAVATFAALRAAKDNFR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 3 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 4 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 5 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 6 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 7 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 8 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 9 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 10 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 11 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 12 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 73 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 178 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 179 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 184 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 185 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 186 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 187 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 188 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 189 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 190 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 191 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 192 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 217 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 218 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 219 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 231 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 232 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 233 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 234 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 235 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 236 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 237 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 238 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 239 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 240 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 263 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 264 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 265 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 266 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 267 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 268 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 275 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 278 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 279 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 280 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 281 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 282 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 283 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 284 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 285 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 286 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 288 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 290 | 8045864390 | Aurantimonas endophytica KCTC 52296 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.79 |
| Metatranscriptomes | 0 |
| Isolates | 2.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.28 |
| Nodule | 0 |
| Rhizoplane | 5.43 |
| Rhizosphere | 79.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.32 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1439351 | 2162886007 | Bacteria | 1039 |
| 2 | JGI24034J26672_10021882 | 3300002239 | Bacteria | 1007 |
| 3 | Ga0065704_10082076 | 3300005289 | Bacteria | 3642 |
| 4 | Ga0065704_10131197 | 3300005289 | Bacteria | 1627 |
| 5 | Ga0065704_10201327 | 3300005289 | Bacteria | 1145 |
| 6 | Ga0065707_10135350 | 3300005295 | Bacteria | 1851 |
| 7 | Ga0070658_10000124 | 3300005327 | Bacteria | 68224 |
| 8 | Ga0070658_10005251 | 3300005327 | Bacteria | 10525 |
| 9 | Ga0070658_10228142 | 3300005327 | Bacteria | 1576 |
| 10 | Ga0070658_10265901 | 3300005327 | Bacteria | 1457 |
| 11 | Ga0070683_100029541 | 3300005329 | Bacteria | 4964 |
| 12 | Ga0070683_100043254 | 3300005329 | Bacteria | 4151 |
| 13 | Ga0070683_100176196 | 3300005329 | Bacteria | 2030 |
| 14 | Ga0070690_100002347 | 3300005330 | Bacteria | 10176 |
| 15 | Ga0070670_100153603 | 3300005331 | Bacteria | 1993 |
| 16 | Ga0068869_100018365 | 3300005334 | Bacteria | 4759 |
| 17 | Ga0070666_10019746 | 3300005335 | Bacteria | 4353 |
| 18 | Ga0070666_10188915 | 3300005335 | Bacteria | 1447 |
| 19 | Ga0070666_10210481 | 3300005335 | Bacteria | 1369 |
| 20 | Ga0070680_100005639 | 3300005336 | Bacteria | 9484 |
| 21 | Ga0070680_100011300 | 3300005336 | Bacteria | 6904 |
| 22 | Ga0068868_100017924 | 3300005338 | Bacteria | 5283 |
| 23 | Ga0070660_100004077 | 3300005339 | Bacteria | 10082 |
| 24 | Ga0070660_100022443 | 3300005339 | Bacteria | 4667 |
| 25 | Ga0070660_100122077 | 3300005339 | Bacteria | 2079 |
| 26 | Ga0070689_100014474 | 3300005340 | Bacteria | 5730 |
| 27 | Ga0070687_100145480 | 3300005343 | Bacteria | 1385 |
| 28 | Ga0070661_100000735 | 3300005344 | Bacteria | 23855 |
| 29 | Ga0070661_100157052 | 3300005344 | Bacteria | 1721 |
| 30 | Ga0070668_100008123 | 3300005347 | Bacteria | 7794 |
| 31 | Ga0070668_100023165 | 3300005347 | Bacteria | 4695 |
| 32 | Ga0070668_100541682 | 3300005347 | Bacteria | 1012 |
| 33 | Ga0070669_100000357 | 3300005353 | Bacteria | 35454 |
| 34 | Ga0070669_100007923 | 3300005353 | Bacteria | 7591 |
| 35 | Ga0070669_100144690 | 3300005353 | Bacteria | 1836 |
| 36 | Ga0070669_100186302 | 3300005353 | Bacteria | 1626 |
| 37 | Ga0070671_100002926 | 3300005355 | Bacteria | 13279 |
| 38 | Ga0070671_100025197 | 3300005355 | Bacteria | 4879 |
| 39 | Ga0070671_100066674 | 3300005355 | Bacteria | 3000 |
| 40 | Ga0070674_100135820 | 3300005356 | Bacteria | 1839 |
| 41 | Ga0070673_100023817 | 3300005364 | Bacteria | 4479 |
| 42 | Ga0070659_100002707 | 3300005366 | Bacteria | 12596 |
| 43 | Ga0070659_100046160 | 3300005366 | Bacteria | 3414 |
| 44 | Ga0070659_100173382 | 3300005366 | Bacteria | 1768 |
| 45 | Ga0070659_100423456 | 3300005366 | Bacteria | 1126 |
| 46 | Ga0070667_100000261 | 3300005367 | Bacteria | 60134 |
| 47 | Ga0070667_100000703 | 3300005367 | Bacteria | 32314 |
| 48 | Ga0070667_100022127 | 3300005367 | Bacteria | 5273 |
| 49 | Ga0070667_100051379 | 3300005367 | Bacteria | 3475 |
| 50 | Ga0070703_10001502 | 3300005406 | Bacteria | 6986 |
| 51 | Ga0070701_10070679 | 3300005438 | Bacteria | 1865 |
| 52 | Ga0070705_100000029 | 3300005440 | Bacteria | 74892 |
| 53 | Ga0070700_100001253 | 3300005441 | Bacteria | 12585 |
| 54 | Ga0070700_100329449 | 3300005441 | Bacteria | 1125 |
| 55 | Ga0070694_100000919 | 3300005444 | Bacteria | 16687 |
| 56 | Ga0070694_100315002 | 3300005444 | Bacteria | 1203 |
| 57 | Ga0070708_100006293 | 3300005445 | Bacteria | 9447 |
| 58 | Ga0070663_100008334 | 3300005455 | Bacteria | 6368 |
| 59 | Ga0070663_100194215 | 3300005455 | Bacteria | 1581 |
| 60 | Ga0070678_100133617 | 3300005456 | Bacteria | 1975 |
| 61 | Ga0070678_100155585 | 3300005456 | Bacteria | 1846 |
| 62 | Ga0070662_100000685 | 3300005457 | Bacteria | 20655 |
| 63 | Ga0070662_100035916 | 3300005457 | Bacteria | 3503 |
| 64 | Ga0070662_100051070 | 3300005457 | Bacteria | 2985 |
| 65 | Ga0070681_10005216 | 3300005458 | Bacteria | 12546 |
| 66 | Ga0070685_10023778 | 3300005466 | Bacteria | 3358 |
| 67 | Ga0070706_100044439 | 3300005467 | Bacteria | 4104 |
| 68 | Ga0070707_100126917 | 3300005468 | Bacteria | 2479 |
| 69 | Ga0070699_100000435 | 3300005518 | Bacteria | 40050 |
| 70 | Ga0070679_100007617 | 3300005530 | Bacteria | 10134 |
| 71 | Ga0070679_100122670 | 3300005530 | Bacteria | 2582 |
| 72 | Ga0070684_100068427 | 3300005535 | Bacteria | 3121 |
| 73 | Ga0070684_100081807 | 3300005535 | Bacteria | 2858 |
| 74 | Ga0068853_100000358 | 3300005539 | Bacteria | 31415 |
| 75 | Ga0068853_100098460 | 3300005539 | Bacteria | 2582 |
| 76 | Ga0070686_100011189 | 3300005544 | Bacteria | 5083 |
| 77 | Ga0070695_100002983 | 3300005545 | Bacteria | 9860 |
| 78 | Ga0070696_100002652 | 3300005546 | Bacteria | 11859 |
| 79 | Ga0070665_100000319 | 3300005548 | Bacteria | 74295 |
| 80 | Ga0070665_100004090 | 3300005548 | Bacteria | 15339 |
| 81 | Ga0070665_100009283 | 3300005548 | Bacteria | 9956 |
| 82 | Ga0070665_100086223 | 3300005548 | Bacteria | 3145 |
| 83 | Ga0070704_100007062 | 3300005549 | Bacteria | 6666 |
| 84 | Ga0070704_100054095 | 3300005549 | Bacteria | 2840 |
| 85 | Ga0068855_100002925 | 3300005563 | Bacteria | 20893 |
| 86 | Ga0068855_100037402 | 3300005563 | Bacteria | 5771 |
| 87 | Ga0068855_100085627 | 3300005563 | Bacteria | 3646 |
| 88 | Ga0070664_100007055 | 3300005564 | Bacteria | 9067 |
| 89 | Ga0070664_100026073 | 3300005564 | Bacteria | 4846 |
| 90 | Ga0068857_100006642 | 3300005577 | Bacteria | 9938 |
| 91 | Ga0068857_100019286 | 3300005577 | Bacteria | 5987 |
| 92 | Ga0068854_100008377 | 3300005578 | Bacteria | 6646 |
| 93 | Ga0068854_100018076 | 3300005578 | Bacteria | 4726 |
| 94 | Ga0068856_100005500 | 3300005614 | Bacteria | 12479 |
| 95 | Ga0068856_100052815 | 3300005614 | Bacteria | 4009 |
| 96 | Ga0068856_100180161 | 3300005614 | Bacteria | 2126 |
| 97 | Ga0068852_100000169 | 3300005616 | Bacteria | 43882 |
| 98 | Ga0068852_100027497 | 3300005616 | Bacteria | 4637 |
| 99 | Ga0068852_100259592 | 3300005616 | Bacteria | 1668 |
| 100 | Ga0068859_100013037 | 3300005617 | Bacteria | 8352 |
| 101 | Ga0068859_100030922 | 3300005617 | Bacteria | 5373 |
| 102 | Ga0068859_100079699 | 3300005617 | Bacteria | 3315 |
| 103 | Ga0068859_100115614 | 3300005617 | Bacteria | 2747 |
| 104 | Ga0068859_100185092 | 3300005617 | Bacteria | 2166 |
| 105 | Ga0068864_100001072 | 3300005618 | Bacteria | 22953 |
| 106 | Ga0068864_100098965 | 3300005618 | Bacteria | 2583 |
| 107 | Ga0068861_100013822 | 3300005719 | Bacteria | 5657 |
| 108 | Ga0068861_100061981 | 3300005719 | Bacteria | 2871 |
| 109 | Ga0068863_100000014 | 3300005841 | Bacteria | 216135 |
| 110 | Ga0068863_100002594 | 3300005841 | Bacteria | 17917 |
| 111 | Ga0068863_100004664 | 3300005841 | Bacteria | 13513 |
| 112 | Ga0068863_100474111 | 3300005841 | Bacteria | 1230 |
| 113 | Ga0068858_100004870 | 3300005842 | Bacteria | 13165 |
| 114 | Ga0068858_100051743 | 3300005842 | Bacteria | 3800 |
| 115 | Ga0068858_100055327 | 3300005842 | Bacteria | 3668 |
| 116 | Ga0068858_100165988 | 3300005842 | Bacteria | 2080 |
| 117 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 118 | Ga0068860_100009800 | 3300005843 | Bacteria | 9508 |
| 119 | Ga0068860_100029758 | 3300005843 | Bacteria | 5253 |
| 120 | Ga0068860_100039467 | 3300005843 | Bacteria | 4516 |
| 121 | Ga0068860_100065597 | 3300005843 | Bacteria | 3447 |
| 122 | Ga0068860_100110999 | 3300005843 | Bacteria | 2621 |
| 123 | Ga0068860_100116951 | 3300005843 | Bacteria | 2551 |
| 124 | Ga0068860_100183074 | 3300005843 | Bacteria | 2025 |
| 125 | Ga0068862_100000866 | 3300005844 | Bacteria | 29635 |
| 126 | Ga0068862_100010264 | 3300005844 | Bacteria | 7728 |
| 127 | Ga0068862_100063155 | 3300005844 | Bacteria | 3186 |
| 128 | Ga0068862_100485827 | 3300005844 | Bacteria | 1170 |
| 129 | Ga0075368_10002950 | 3300006042 | Bacteria | 5620 |
| 130 | Ga0075368_10007399 | 3300006042 | Bacteria | 3874 |
| 131 | Ga0075368_10061201 | 3300006042 | Bacteria | 1507 |
| 132 | Ga0075364_10003873 | 3300006051 | Bacteria | 8580 |
| 133 | Ga0075364_10017033 | 3300006051 | Bacteria | 4531 |
| 134 | Ga0075364_10127801 | 3300006051 | Bacteria | 1705 |
| 135 | Ga0075364_10313664 | 3300006051 | Bacteria | 1068 |
| 136 | Ga0075432_10000822 | 3300006058 | Bacteria | 9718 |
| 137 | Ga0070715_10218681 | 3300006163 | Bacteria | 978 |
| 138 | Ga0075367_10006472 | 3300006178 | Bacteria | 5921 |
| 139 | Ga0097621_100071890 | 3300006237 | Bacteria | 2860 |
| 140 | Ga0075370_10027382 | 3300006353 | Bacteria | 3162 |
| 141 | Ga0075428_100020451 | 3300006844 | Bacteria | 7327 |
| 142 | Ga0075428_100116482 | 3300006844 | Bacteria | 2910 |
| 143 | Ga0075428_100204819 | 3300006844 | Bacteria | 2132 |
| 144 | Ga0075430_100003913 | 3300006846 | Bacteria | 12558 |
| 145 | Ga0075430_100023915 | 3300006846 | Bacteria | 5202 |
| 146 | Ga0075430_100039705 | 3300006846 | Bacteria | 3984 |
| 147 | Ga0075430_100057610 | 3300006846 | Bacteria | 3268 |
| 148 | Ga0075431_100002086 | 3300006847 | Bacteria | 19086 |
| 149 | Ga0075431_100003429 | 3300006847 | Bacteria | 15377 |
| 150 | Ga0075431_100014915 | 3300006847 | Bacteria | 7868 |
| 151 | Ga0075431_100069487 | 3300006847 | Bacteria | 3634 |
| 152 | Ga0075431_100247449 | 3300006847 | Bacteria | 1812 |
| 153 | Ga0075433_10036040 | 3300006852 | Bacteria | 4258 |
| 154 | Ga0075434_100274530 | 3300006871 | Bacteria | 1705 |
| 155 | Ga0075434_100374265 | 3300006871 | Bacteria | 1445 |
| 156 | Ga0075429_100016736 | 3300006880 | Bacteria | 6351 |
| 157 | Ga0075429_100096018 | 3300006880 | Bacteria | 2585 |
| 158 | Ga0075429_100178803 | 3300006880 | Bacteria | 1859 |
| 159 | Ga0097620_100013038 | 3300006931 | Bacteria | 8352 |
| 160 | Ga0097620_100030922 | 3300006931 | Bacteria | 5373 |
| 161 | Ga0097620_100079693 | 3300006931 | Bacteria | 3315 |
| 162 | Ga0097620_100115614 | 3300006931 | Bacteria | 2747 |
| 163 | Ga0097620_100185089 | 3300006931 | Bacteria | 2166 |
| 164 | Ga0105251_10003236 | 3300009011 | Bacteria | 11991 |
| 165 | Ga0105250_10025545 | 3300009092 | Bacteria | 2380 |
| 166 | Ga0105240_10157543 | 3300009093 | Bacteria | 2699 |
| 167 | Ga0105240_10321550 | 3300009093 | Bacteria | 1763 |
| 168 | Ga0111539_10007982 | 3300009094 | Bacteria | 13501 |
| 169 | Ga0111539_10008813 | 3300009094 | Bacteria | 12790 |
| 170 | Ga0111539_10113930 | 3300009094 | Bacteria | 3171 |
| 171 | Ga0111539_10197472 | 3300009094 | Bacteria | 2346 |
| 172 | Ga0111539_10322534 | 3300009094 | Bacteria | 1798 |
| 173 | Ga0111539_10578971 | 3300009094 | Bacteria | 1307 |
| 174 | Ga0105245_10001093 | 3300009098 | Bacteria | 24605 |
| 175 | Ga0105247_10008448 | 3300009101 | Bacteria | 6273 |
| 176 | Ga0105247_10065288 | 3300009101 | Bacteria | 2264 |
| 177 | Ga0105247_10535874 | 3300009101 | Bacteria | 858 |
| 178 | Ga0114129_10072454 | 3300009147 | Bacteria | 4802 |
| 179 | Ga0114129_10093102 | 3300009147 | Bacteria | 4175 |
| 180 | Ga0114129_10378257 | 3300009147 | Bacteria | 1871 |
| 181 | Ga0114129_10846949 | 3300009147 | Bacteria | 1163 |
| 182 | Ga0105243_10156740 | 3300009148 | Bacteria | 1959 |
| 183 | Ga0105242_10100192 | 3300009176 | Bacteria | 2453 |
| 184 | Ga0105242_10133911 | 3300009176 | Bacteria | 2143 |
| 185 | Ga0105248_10006421 | 3300009177 | Bacteria | 12900 |
| 186 | Ga0105248_10033092 | 3300009177 | Bacteria | 5774 |
| 187 | Ga0105248_10043494 | 3300009177 | Bacteria | 5035 |
| 188 | Ga0105238_10010483 | 3300009551 | Bacteria | 9303 |
| 189 | Ga0105238_10151448 | 3300009551 | Bacteria | 2294 |
| 190 | Ga0105238_10552103 | 3300009551 | Bacteria | 1156 |
| 191 | Ga0105249_10007276 | 3300009553 | Bacteria | 9654 |
| 192 | Ga0105249_10164083 | 3300009553 | Bacteria | 2149 |
| 193 | Ga0105239_10288921 | 3300010375 | Bacteria | 1847 |
| 194 | Ga0105239_10502248 | 3300010375 | Bacteria | 1379 |
| 195 | Ga0105246_10002251 | 3300011119 | Bacteria | 11644 |
| 196 | Ga0105246_10004894 | 3300011119 | Bacteria | 8159 |
| 197 | Ga0105246_10023691 | 3300011119 | Bacteria | 3976 |
| 198 | Ga0157373_10040948 | 3300013100 | Bacteria | 3314 |
| 199 | Ga0157373_10057593 | 3300013100 | Bacteria | 2756 |
| 200 | Ga0157371_10004503 | 3300013102 | Bacteria | 12142 |
| 201 | Ga0157370_10009970 | 3300013104 | Bacteria | 10051 |
| 202 | Ga0157370_10061361 | 3300013104 | Bacteria | 3568 |
| 203 | Ga0157369_10126508 | 3300013105 | Bacteria | 2709 |
| 204 | Ga0157374_10001203 | 3300013296 | Bacteria | 22140 |
| 205 | Ga0157378_10132606 | 3300013297 | Bacteria | 2308 |
| 206 | Ga0163162_10005300 | 3300013306 | Bacteria | 12450 |
| 207 | Ga0163162_10120766 | 3300013306 | Bacteria | 2725 |
| 208 | Ga0163162_10171604 | 3300013306 | Bacteria | 2294 |
| 209 | Ga0163162_10372437 | 3300013306 | Bacteria | 1561 |
| 210 | Ga0157372_10149186 | 3300013307 | Bacteria | 2698 |
| 211 | Ga0157372_10322834 | 3300013307 | Bacteria | 1798 |
| 212 | Ga0163163_10000433 | 3300014325 | Bacteria | 38351 |
| 213 | Ga0163163_10158779 | 3300014325 | Bacteria | 2306 |
| 214 | Ga0157380_10077684 | 3300014326 | Bacteria | 2706 |
| 215 | Ga0157380_10148814 | 3300014326 | Bacteria | 2021 |
| 216 | Ga0157380_10544337 | 3300014326 | Bacteria | 1137 |
| 217 | Ga0157379_10049871 | 3300014968 | Bacteria | 3737 |
| 218 | Ga0157379_10055252 | 3300014968 | Bacteria | 3548 |
| 219 | Ga0157379_10345608 | 3300014968 | Bacteria | 1361 |
| 220 | Ga0157376_10044510 | 3300014969 | Bacteria | 3649 |
| 221 | Ga0157376_10169559 | 3300014969 | Bacteria | 1986 |
| 222 | Ga0209050_1000119 | 3300025298 | Bacteria | 200661 |
| 223 | Ga0207697_10157776 | 3300025315 | Bacteria | 989 |
| 224 | Ga0207656_10051290 | 3300025321 | Bacteria | 1784 |
| 225 | Ga0207696_1010467 | 3300025711 | Bacteria | 3397 |
| 226 | Ga0207713_1002886 | 3300025735 | Bacteria | 12047 |
| 227 | Ga0207653_10001041 | 3300025885 | Bacteria | 9112 |
| 228 | Ga0207688_10154189 | 3300025901 | Bacteria | 1359 |
| 229 | Ga0207680_10015444 | 3300025903 | Bacteria | 3984 |
| 230 | Ga0207680_10152458 | 3300025903 | Bacteria | 1542 |
| 231 | Ga0207680_10247337 | 3300025903 | Bacteria | 1231 |
| 232 | Ga0207647_10029148 | 3300025904 | Bacteria | 3575 |
| 233 | Ga0207647_10041236 | 3300025904 | Bacteria | 2904 |
| 234 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 235 | Ga0207705_10009562 | 3300025909 | Bacteria | 7053 |
| 236 | Ga0207705_10042290 | 3300025909 | Bacteria | 3271 |
| 237 | Ga0207684_10056161 | 3300025910 | Bacteria | 3340 |
| 238 | Ga0207707_10021788 | 3300025912 | Bacteria | 5601 |
| 239 | Ga0207695_10237313 | 3300025913 | Bacteria | 1725 |
| 240 | Ga0207695_10257545 | 3300025913 | Bacteria | 1643 |
| 241 | Ga0207660_10005228 | 3300025917 | Bacteria | 8432 |
| 242 | Ga0207660_10057433 | 3300025917 | Bacteria | 2787 |
| 243 | Ga0207660_10296688 | 3300025917 | Bacteria | 1286 |
| 244 | Ga0207662_10256699 | 3300025918 | Bacteria | 1149 |
| 245 | Ga0207657_10000077 | 3300025919 | Bacteria | 92227 |
| 246 | Ga0207657_10062671 | 3300025919 | Bacteria | 3182 |
| 247 | Ga0207657_10126446 | 3300025919 | Bacteria | 2099 |
| 248 | Ga0207649_10009270 | 3300025920 | Bacteria | 5384 |
| 249 | Ga0207649_10032403 | 3300025920 | Bacteria | 3115 |
| 250 | Ga0207649_10188362 | 3300025920 | Bacteria | 1449 |
| 251 | Ga0207652_10015079 | 3300025921 | Bacteria | 6270 |
| 252 | Ga0207652_10018222 | 3300025921 | Bacteria | 5757 |
| 253 | Ga0207652_10545003 | 3300025921 | Bacteria | 1043 |
| 254 | Ga0207646_10073923 | 3300025922 | Bacteria | 3045 |
| 255 | Ga0207681_10000321 | 3300025923 | Bacteria | 34677 |
| 256 | Ga0207681_10000667 | 3300025923 | Bacteria | 22714 |
| 257 | Ga0207681_10124332 | 3300025923 | Bacteria | 1897 |
| 258 | Ga0207694_10045398 | 3300025924 | Bacteria | 3394 |
| 259 | Ga0207694_10047515 | 3300025924 | Bacteria | 3320 |
| 260 | Ga0207650_10210150 | 3300025925 | Bacteria | 1562 |
| 261 | Ga0207650_10515334 | 3300025925 | Bacteria | 1000 |
| 262 | Ga0207687_10007530 | 3300025927 | Bacteria | 7158 |
| 263 | Ga0207644_10006124 | 3300025931 | Bacteria | 7846 |
| 264 | Ga0207644_10006524 | 3300025931 | Bacteria | 7609 |
| 265 | Ga0207644_10014842 | 3300025931 | Bacteria | 5222 |
| 266 | Ga0207644_10023896 | 3300025931 | Bacteria | 4192 |
| 267 | Ga0207644_10100479 | 3300025931 | Bacteria | 2172 |
| 268 | Ga0207690_10001427 | 3300025932 | Bacteria | 14960 |
| 269 | Ga0207690_10041295 | 3300025932 | Bacteria | 3022 |
| 270 | Ga0207706_10000204 | 3300025933 | Bacteria | 65744 |
| 271 | Ga0207706_10029117 | 3300025933 | Bacteria | 4931 |
| 272 | Ga0207706_10058619 | 3300025933 | Bacteria | 3391 |
| 273 | Ga0207706_10075982 | 3300025933 | Bacteria | 2955 |
| 274 | Ga0207706_10465482 | 3300025933 | Bacteria | 1093 |
| 275 | Ga0207686_10048899 | 3300025934 | Bacteria | 2622 |
| 276 | Ga0207686_10086645 | 3300025934 | Bacteria | 2058 |
| 277 | Ga0207670_10010867 | 3300025936 | Bacteria | 5255 |
| 278 | Ga0207711_10003182 | 3300025941 | Bacteria | 14318 |
| 279 | Ga0207711_10019446 | 3300025941 | Bacteria | 5653 |
| 280 | Ga0207689_10025646 | 3300025942 | Bacteria | 4939 |
| 281 | Ga0207689_10275483 | 3300025942 | Bacteria | 1393 |
| 282 | Ga0207661_10003474 | 3300025944 | Bacteria | 10940 |
| 283 | Ga0207661_10022029 | 3300025944 | Bacteria | 4789 |
| 284 | Ga0207661_10255779 | 3300025944 | Bacteria | 1558 |
| 285 | Ga0207679_10012194 | 3300025945 | Bacteria | 5598 |
| 286 | Ga0207679_10088149 | 3300025945 | Bacteria | 2392 |
| 287 | Ga0207667_10008852 | 3300025949 | Bacteria | 11913 |
| 288 | Ga0207667_10011937 | 3300025949 | Bacteria | 10059 |
| 289 | Ga0207667_10064815 | 3300025949 | Bacteria | 3813 |
| 290 | Ga0207712_10002056 | 3300025961 | Bacteria | 13210 |
| 291 | Ga0207668_10015821 | 3300025972 | Bacteria | 4696 |
| 292 | Ga0207640_10007531 | 3300025981 | Bacteria | 6013 |
| 293 | Ga0207640_10013218 | 3300025981 | Bacteria | 4726 |
| 294 | Ga0207658_10000514 | 3300025986 | Bacteria | 35332 |
| 295 | Ga0207658_10003671 | 3300025986 | Bacteria | 10821 |
| 296 | Ga0207658_10004197 | 3300025986 | Bacteria | 10038 |
| 297 | Ga0207658_10046198 | 3300025986 | Bacteria | 3178 |
| 298 | Ga0207658_10241403 | 3300025986 | Bacteria | 1531 |
| 299 | Ga0207677_10010473 | 3300026023 | Bacteria | 5247 |
| 300 | Ga0207703_10011608 | 3300026035 | Bacteria | 6850 |
| 301 | Ga0207703_10024192 | 3300026035 | Bacteria | 4778 |
| 302 | Ga0207703_10043897 | 3300026035 | Bacteria | 3590 |
| 303 | Ga0207703_10158029 | 3300026035 | Bacteria | 1983 |
| 304 | Ga0207639_10000847 | 3300026041 | Bacteria | 20809 |
| 305 | Ga0207639_10100612 | 3300026041 | Bacteria | 2335 |
| 306 | Ga0207678_10019221 | 3300026067 | Bacteria | 5999 |
| 307 | Ga0207678_10338154 | 3300026067 | Bacteria | 1297 |
| 308 | Ga0207708_10001278 | 3300026075 | Bacteria | 18901 |
| 309 | Ga0207708_10033844 | 3300026075 | Bacteria | 3885 |
| 310 | Ga0207708_10239582 | 3300026075 | Bacteria | 1459 |
| 311 | Ga0207708_10386703 | 3300026075 | Unclassified | 1154 |
| 312 | Ga0207702_10015456 | 3300026078 | Bacteria | 6321 |
| 313 | Ga0207702_10059447 | 3300026078 | Bacteria | 3256 |
| 314 | Ga0207702_10147627 | 3300026078 | Bacteria | 2136 |
| 315 | Ga0207641_10000126 | 3300026088 | Bacteria | 112607 |
| 316 | Ga0207641_10004522 | 3300026088 | Bacteria | 12023 |
| 317 | Ga0207641_10031498 | 3300026088 | Bacteria | 4398 |
| 318 | Ga0207676_10001795 | 3300026095 | Bacteria | 15723 |
| 319 | Ga0207676_10017419 | 3300026095 | Bacteria | 5205 |
| 320 | Ga0207676_10139196 | 3300026095 | Bacteria | 2075 |
| 321 | Ga0207674_10006724 | 3300026116 | Bacteria | 13499 |
| 322 | Ga0207674_10053594 | 3300026116 | Bacteria | 4110 |
| 323 | Ga0207675_100024013 | 3300026118 | Bacteria | 5668 |
| 324 | Ga0207675_100047593 | 3300026118 | Bacteria | 4003 |
| 325 | Ga0207675_100142996 | 3300026118 | Bacteria | 2273 |
| 326 | Ga0207683_10063050 | 3300026121 | Bacteria | 3265 |
| 327 | Ga0207683_10183930 | 3300026121 | Bacteria | 1895 |
| 328 | Ga0207698_10000111 | 3300026142 | Bacteria | 50675 |
| 329 | Ga0207698_10039004 | 3300026142 | Bacteria | 3515 |
| 330 | Ga0207698_10152756 | 3300026142 | Bacteria | 2006 |
| 331 | Ga0209983_1022670 | 3300027665 | Bacteria | 1317 |
| 332 | Ga0209813_10000069 | 3300027866 | Bacteria | 39845 |
| 333 | Ga0209813_10002705 | 3300027866 | Bacteria | 4081 |
| 334 | Ga0209974_10018229 | 3300027876 | Bacteria | 2329 |
| 335 | Ga0207428_10023468 | 3300027907 | Bacteria | 5188 |
| 336 | Ga0207428_10061910 | 3300027907 | Bacteria | 2961 |
| 337 | Ga0268266_10000212 | 3300028379 | Bacteria | 101029 |
| 338 | Ga0268266_10007074 | 3300028379 | Bacteria | 10188 |
| 339 | Ga0268266_10078012 | 3300028379 | Bacteria | 2881 |
| 340 | Ga0268265_10001316 | 3300028380 | Bacteria | 21300 |
| 341 | Ga0268265_10007813 | 3300028380 | Bacteria | 7218 |
| 342 | Ga0268265_10188434 | 3300028380 | Bacteria | 1779 |
| 343 | Ga0268265_10420562 | 3300028380 | Bacteria | 1241 |
| 344 | Ga0268264_10000077 | 3300028381 | Bacteria | 252597 |
| 345 | Ga0268264_10002022 | 3300028381 | Bacteria | 18188 |
| 346 | Ga0268264_10019868 | 3300028381 | Bacteria | 5489 |
| 347 | Ga0268264_10020743 | 3300028381 | Bacteria | 5369 |
| 348 | Ga0268264_10068302 | 3300028381 | Bacteria | 3003 |
| 349 | Ga0268264_10096796 | 3300028381 | Bacteria | 2557 |
| 350 | Ga0268264_10113621 | 3300028381 | Bacteria | 2376 |
| 351 | Ga0268264_10297848 | 3300028381 | Bacteria | 1517 |
| 352 | Ga0268264_10491871 | 3300028381 | Bacteria | 1195 |
| 353 | Ga0307408_100065485 | 3300031548 | Bacteria | 2665 |
| 354 | Ga0307408_100154730 | 3300031548 | Bacteria | 1814 |
| 355 | Ga0307405_10048602 | 3300031731 | Bacteria | 2617 |
| 356 | Ga0307405_10255104 | 3300031731 | Bacteria | 1307 |
| 357 | Ga0307413_10027011 | 3300031824 | Bacteria | 3173 |
| 358 | Ga0307413_10146567 | 3300031824 | Bacteria | 1639 |
| 359 | Ga0307413_10166255 | 3300031824 | Bacteria | 1556 |
| 360 | Ga0307413_10261186 | 3300031824 | Bacteria | 1291 |
| 361 | Ga0307410_10113003 | 3300031852 | Bacteria | 1968 |
| 362 | Ga0307410_10240700 | 3300031852 | Bacteria | 1402 |
| 363 | Ga0307410_10394934 | 3300031852 | Bacteria | 1116 |
| 364 | Ga0307410_10601513 | 3300031852 | Bacteria | 917 |
| 365 | Ga0307406_10133779 | 3300031901 | Bacteria | 1744 |
| 366 | Ga0307407_10015575 | 3300031903 | Bacteria | 3764 |
| 367 | Ga0307412_10050317 | 3300031911 | Bacteria | 2749 |
| 368 | Ga0307412_10052654 | 3300031911 | Bacteria | 2696 |
| 369 | Ga0307412_10070762 | 3300031911 | Bacteria | 2379 |
| 370 | Ga0307409_100067198 | 3300031995 | Bacteria | 2830 |
| 371 | Ga0307409_100680112 | 3300031995 | Bacteria | 1026 |
| 372 | Ga0307416_100019598 | 3300032002 | Bacteria | 4802 |
| 373 | Ga0307416_100321413 | 3300032002 | Bacteria | 1550 |
| 374 | Ga0307416_100775921 | 3300032002 | Bacteria | 1053 |
| 375 | Ga0307414_10016727 | 3300032004 | Bacteria | 4468 |
| 376 | Ga0307415_100050391 | 3300032126 | Bacteria | 2821 |
| 377 | Ga0373939_0051112 | 3300035114 | Bacteria | 1284 |
| 378 | Ga0373953_0026198 | 3300035117 | Bacteria | 2233 |
| 379 | Ga0373955_0010662 | 3300035172 | Bacteria | 4349 |
| 380 | Ga0373927_0112708 | 3300035695 | Bacteria | 1773 |
| 381 | Ga0373933_0157221 | 3300035724 | Bacteria | 1442 |
| 382 | Ga0373937_0002739 | 3300036401 | Bacteria | 14697 |
| 383 | Ga0373937_0201219 | 3300036401 | Bacteria | 1872 |
| 384 | Ga0316582_0205738 | 3300036647 | Bacteria | 1344 |
| 385 | Ga0316584_0114864 | 3300036712 | Bacteria | 2014 |
| 386 | Ga0400490_22429 | 3300038726 | Bacteria | 1614 |
| 387 | Ga0400485_08081 | 3300038735 | Unclassified | 3309 |
| 388 | Ga0400486_10851 | 3300038742 | Unclassified | 1613 |
| 389 | Ga0400486_17016 | 3300038742 | Bacteria | 2275 |
| 390 | Ga0400487_18928 | 3300039110 | Unclassified | 1454 |
| 391 | Ga0439462_0038649 | 3300042015 | Bacteria | 1271 |
| 392 | Ga0450923_014528 | 3300042125 | Bacteria | 1462 |
| 393 | Ga0450916_010780 | 3300042530 | Bacteria | 1148 |
| 394 | Ga0495627_000197 | 3300046453 | Bacteria | 66158 |
| 395 | Ga0495650_0001750 | 3300046471 | Bacteria | 19773 |
| 396 | Ga0495596_0000625 | 3300046500 | Bacteria | 22228 |
| 397 | Ga0495596_0000662 | 3300046500 | Bacteria | 21469 |
| 398 | Ga0495607_0016306 | 3300046501 | Bacteria | 4795 |
| 399 | Ga0495583_0062925 | 3300046506 | Bacteria | 1651 |
| 400 | Ga0495606_0139508 | 3300046507 | Bacteria | 1433 |
| 401 | Ga0495610_0000020 | 3300046512 | Bacteria | 344007 |
| 402 | Ga0495610_0000104 | 3300046512 | Bacteria | 98197 |
| 403 | Ga0495610_0027769 | 3300046512 | Bacteria | 3002 |
| 404 | Ga0495620_0047963 | 3300046515 | Bacteria | 1835 |
| 405 | Ga0495632_0018817 | 3300046519 | Bacteria | 3778 |
| 406 | Ga0495643_0000023 | 3300046522 | Bacteria | 288590 |
| 407 | Ga0495643_0014027 | 3300046522 | Bacteria | 4778 |
| 408 | Ga0495643_0030092 | 3300046522 | Bacteria | 3034 |
| 409 | Ga0495643_0105758 | 3300046522 | Bacteria | 1436 |
| 410 | Ga0495654_0042275 | 3300046530 | Bacteria | 2263 |
| 411 | Ga0495598_0064611 | 3300046537 | Bacteria | 1137 |
| 412 | Ga0495609_0004365 | 3300046538 | Bacteria | 7767 |
| 413 | Ga0495621_0030410 | 3300046539 | Bacteria | 1846 |
| 414 | Ga0495633_0076284 | 3300046558 | Bacteria | 1561 |
| 415 | Ga0495671_0043114 | 3300046692 | Bacteria | 2265 |
| 416 | Ga0495687_048675 | 3300047443 | Bacteria | 1817 |
| 417 | Ga0495681_0000123 | 3300047470 | Bacteria | 68069 |
| 418 | Ga0495686_0107327 | 3300047472 | Bacteria | 1678 |
| 419 | Ga0495593_0055035 | 3300047673 | Bacteria | 2096 |
| 420 | Ga0495615_0000098 | 3300048090 | Bacteria | 24482 |
| 421 | Ga0495615_0044902 | 3300048090 | Bacteria | 1117 |
| 422 | Ga0495626_0029271 | 3300048091 | Bacteria | 2666 |
| 423 | Ga0496100_0095089 | 3300048903 | Bacteria | 2042 |
| 424 | Ga0496100_0408491 | 3300048903 | Bacteria | 1035 |
| 425 | Ga0496101_0245672 | 3300048904 | Bacteria | 1393 |
| 426 | Ga0496101_0432345 | 3300048904 | Bacteria | 1038 |
| 427 | Ga0496101_0573739 | 3300048904 | Bacteria | 892 |
| 428 | Ga0496102_0000106 | 3300048905 | Bacteria | 118841 |
| 429 | Ga0496102_0000972 | 3300048905 | Bacteria | 26983 |
| 430 | Ga0496102_0106739 | 3300048905 | Bacteria | 2607 |
| 431 | Ga0496102_0328410 | 3300048905 | Bacteria | 1441 |
| 432 | Ga0496103_0000128 | 3300048906 | Bacteria | 81657 |
| 433 | Ga0496103_0004335 | 3300048906 | Bacteria | 8615 |
| 434 | Ga0496103_0039010 | 3300048906 | Bacteria | 2918 |
| 435 | Ga0496103_0053713 | 3300048906 | Bacteria | 2497 |
| 436 | Ga0496104_0004170 | 3300048907 | Bacteria | 12543 |
| 437 | Ga0496104_0006287 | 3300048907 | Bacteria | 10441 |
| 438 | Ga0496105_0002625 | 3300048908 | Bacteria | 13074 |
| 439 | Ga0496105_0021662 | 3300048908 | Bacteria | 5201 |
| 440 | Ga0496106_0000362 | 3300048909 | Bacteria | 32242 |
| 441 | Ga0496106_0393528 | 3300048909 | Bacteria | 1114 |
| 442 | Ga0496107_0004589 | 3300048910 | Bacteria | 9362 |
| 443 | Ga0496107_0084985 | 3300048910 | Bacteria | 2309 |
| 444 | Ga0496108_0093028 | 3300048911 | Bacteria | 2564 |
| 445 | Ga0496109_0027160 | 3300048912 | Bacteria | 5109 |
| 446 | Ga0496109_0038655 | 3300048912 | Bacteria | 4315 |
| 447 | Ga0496110_0010150 | 3300048913 | Bacteria | 7650 |
| 448 | Ga0496110_0177457 | 3300048913 | Bacteria | 1934 |
| 449 | Ga0496111_0045131 | 3300048914 | Bacteria | 3170 |
| 450 | Ga0496112_0011257 | 3300048915 | Bacteria | 8159 |
| 451 | Ga0496113_0204939 | 3300048916 | Bacteria | 1568 |
| 452 | Ga0496114_0132028 | 3300048917 | Bacteria | 2157 |
| 453 | Ga0496114_0488566 | 3300048917 | Bacteria | 1089 |
| 454 | Ga0496115_0017172 | 3300048918 | Bacteria | 5525 |
| 455 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 456 | Ga0496116_0044661 | 3300048919 | Bacteria | 3007 |
| 457 | Ga0496117_0003021 | 3300048920 | Bacteria | 20200 |
| 458 | Ga0496117_0019809 | 3300048920 | Bacteria | 5512 |
| 459 | Ga0496118_0019621 | 3300048921 | Bacteria | 6035 |
| 460 | Ga0496118_0047174 | 3300048921 | Bacteria | 3343 |
| 461 | Ga0496118_0055728 | 3300048921 | Bacteria | 2979 |
| 462 | Ga0496118_0068432 | 3300048921 | Bacteria | 2579 |
| 463 | Ga0496118_0189644 | 3300048921 | Bacteria | 1231 |
| 464 | Ga0496119_0001217 | 3300048922 | Bacteria | 32132 |
| 465 | Ga0496119_0244269 | 3300048922 | Bacteria | 908 |
| 466 | Ga0496120_0007787 | 3300048923 | Bacteria | 7912 |
| 467 | Ga0496121_0000070 | 3300048924 | Bacteria | 249187 |
| 468 | Ga0496121_0000222 | 3300048924 | Bacteria | 123595 |
| 469 | Ga0496121_0004707 | 3300048924 | Bacteria | 18061 |
| 470 | Ga0496121_0043487 | 3300048924 | Bacteria | 3889 |
| 471 | Ga0496121_0354773 | 3300048924 | Bacteria | 975 |
| 472 | Ga0496122_0005308 | 3300048925 | Bacteria | 15415 |
| 473 | Ga0496122_0014798 | 3300048925 | Bacteria | 7516 |
| 474 | Ga0496122_0129332 | 3300048925 | Bacteria | 1608 |
| 475 | Ga0496122_0129440 | 3300048925 | Bacteria | 1607 |
| 476 | Ga0496123_0002019 | 3300048926 | Bacteria | 26197 |
| 477 | Ga0496123_0042925 | 3300048926 | Bacteria | 3113 |
| 478 | Ga0496123_0088671 | 3300048926 | Bacteria | 1846 |
| 479 | Ga0496124_0000417 | 3300048927 | Bacteria | 76104 |
| 480 | Ga0496124_0029744 | 3300048927 | Bacteria | 4859 |
| 481 | Ga0496124_0194940 | 3300048927 | Bacteria | 1546 |
| 482 | Ga0496125_0032235 | 3300048928 | Bacteria | 4657 |
| 483 | Ga0496125_0038471 | 3300048928 | Bacteria | 4138 |
| 484 | Ga0496125_0134486 | 3300048928 | Bacteria | 1732 |
| 485 | Ga0496126_0000084 | 3300048929 | Bacteria | 217111 |
| 486 | Ga0496126_0000493 | 3300048929 | Bacteria | 77742 |
| 487 | Ga0501033_0061089 | 3300049570 | Bacteria | 2778 |
| 488 | Ga0501034_0394210 | 3300049571 | Bacteria | 1308 |
| 489 | Ga0501036_0135871 | 3300049572 | Bacteria | 2076 |
| 490 | Ga0501036_0180145 | 3300049572 | Bacteria | 1779 |
| 491 | Ga0501037_0168949 | 3300049573 | Bacteria | 1556 |
| 492 | Ga0501039_0209794 | 3300049575 | Bacteria | 1532 |
| 493 | Ga0501039_0367136 | 3300049575 | Bacteria | 1131 |
| 494 | Ga0501041_0032229 | 3300049577 | Bacteria | 3168 |
| 495 | Ga0501041_0088537 | 3300049577 | Bacteria | 1911 |
| 496 | Ga0501047_0140060 | 3300049581 | Bacteria | 2298 |
| 497 | Ga0501048_0014311 | 3300049582 | Bacteria | 5875 |
| 498 | Ga0501048_0230005 | 3300049582 | Bacteria | 1316 |
| 499 | Ga0501067_0179247 | 3300049583 | Unclassified | 1180 |
| 500 | Ga0501071_0056867 | 3300049587 | Bacteria | 2826 |
| 501 | Ga0501071_0264768 | 3300049587 | Bacteria | 1299 |
| 502 | Ga0501072_0033785 | 3300049588 | Bacteria | 4008 |
| 503 | Ga0501073_0152073 | 3300049589 | Bacteria | 1604 |
| 504 | Ga0501074_0258066 | 3300049590 | Bacteria | 1239 |
| 505 | Ga0501075_0011677 | 3300049591 | Bacteria | 6223 |
| 506 | Ga0501075_0187710 | 3300049591 | Bacteria | 1577 |
| 507 | Ga0501075_0353471 | 3300049591 | Bacteria | 1120 |
| 508 | Ga0501076_0051403 | 3300049592 | Bacteria | 3262 |
| 509 | Ga0501076_0122140 | 3300049592 | Bacteria | 2109 |
| 510 | Ga0501076_0153263 | 3300049592 | Bacteria | 1875 |
| 511 | Ga0501076_0652279 | 3300049592 | Bacteria | 869 |
| 512 | Ga0501077_0038047 | 3300049593 | Bacteria | 3063 |
| 513 | Ga0501077_0045855 | 3300049593 | Bacteria | 2777 |
| 514 | Ga0501077_0378079 | 3300049593 | Bacteria | 905 |
| 515 | Ga0501079_0003608 | 3300049741 | Bacteria | 11390 |
| 516 | Ga0501079_0053287 | 3300049741 | Bacteria | 3121 |
| 517 | Ga0501079_0109992 | 3300049741 | Bacteria | 2141 |
| 518 | Ga0501081_0033845 | 3300049743 | Bacteria | 3474 |
| 519 | Ga0501081_0112997 | 3300049743 | Bacteria | 1928 |
| 520 | Ga0501083_0160499 | 3300049744 | Bacteria | 1471 |
| 521 | Ga0501044_0002739 | 3300049823 | Bacteria | 20043 |
| 522 | Ga0501044_0167309 | 3300049823 | Bacteria | 2172 |
| 523 | Ga0501044_0192861 | 3300049823 | Bacteria | 1999 |
| 524 | Ga0501045_0071462 | 3300049824 | Bacteria | 2554 |
| 525 | nmdc:mga03683_582_c1 | 3300050489 | Bacteria | 10474 |
| 526 | nmdc:mga03n38_29660_c1 | 3300050490 | Bacteria | 2292 |
| 527 | nmdc:mga03n38_34195_c1 | 3300050490 | Bacteria | 2169 |
| 528 | nmdc:mga00v17_1542_c2 | 3300050491 | Bacteria | 3884 |
| 529 | nmdc:mga00v17_2152_c1 | 3300050491 | Bacteria | 10125 |
| 530 | nmdc:mga06z11_12519_c1 | 3300050494 | Bacteria | 3693 |
| 531 | nmdc:mga06z11_1500_c1 | 3300050494 | Bacteria | 8675 |
| 532 | nmdc:mga04h51_3312_c1 | 3300050495 | Bacteria | 3906 |
| 533 | nmdc:mga04h51_710_c1 | 3300050495 | Bacteria | 7727 |
| 534 | nmdc:mga07m45_185997_c1 | 3300050496 | Bacteria | 1208 |
| 535 | nmdc:mga07m45_53_c1 | 3300050496 | Bacteria | 50852 |
| 536 | nmdc:mga07m45_66488_c1 | 3300050496 | Bacteria | 2048 |
| 537 | nmdc:mga05p37_128250_c1 | 3300050507 | Bacteria | 3114 |
| 538 | nmdc:mga09592_59967_c1 | 3300050508 | Bacteria | 3217 |
| 539 | nmdc:mga09592_76780_c1 | 3300050508 | Bacteria | 2841 |
| 540 | nmdc:mga0qj67_11371_c1 | 3300050509 | Bacteria | 6669 |
| 541 | nmdc:mga0qj67_2771_c1 | 3300050509 | Bacteria | 12574 |
| 542 | nmdc:mga0qj67_89701_c1 | 3300050509 | Bacteria | 2469 |
| 543 | nmdc:mga06r32_265446_c1 | 3300050510 | Bacteria | 1704 |
| 544 | nmdc:mga06r32_36982_c1 | 3300050510 | Bacteria | 4618 |
| 545 | nmdc:mga06r32_41488_c1 | 3300050510 | Bacteria | 4372 |
| 546 | nmdc:mga06r32_6820_c1 | 3300050510 | Bacteria | 10267 |
| 547 | nmdc:mga06r32_8867_c1 | 3300050510 | Bacteria | 9065 |
| 548 | nmdc:mga08y16_163092_c1 | 3300050511 | Bacteria | 2316 |
| 549 | nmdc:mga08y16_28067_c1 | 3300050511 | Bacteria | 5934 |
| 550 | nmdc:mga0a205_9747_c1 | 3300050515 | Bacteria | 8434 |
| 551 | nmdc:mga0sz30_18348_c1 | 3300050516 | Bacteria | 2799 |
| 552 | nmdc:mga0sz30_404_c1 | 3300050516 | Bacteria | 16465 |
| 553 | Ga0495601_0056833 | 3300053077 | Bacteria | 2478 |
| 554 | Ga0495619_0230278 | 3300053085 | Bacteria | 1284 |
| 555 | Ga0500643_000001 | 3300053087 | Bacteria | 1440111 |
| 556 | Ga0500647_0110535 | 3300053091 | Bacteria | 1307 |
| 557 | Ga0500608_003606 | 3300053122 | Bacteria | 5840 |
| 558 | Ga0500618_028617 | 3300053125 | Bacteria | 1319 |
| 559 | Ga0500559_0045018 | 3300053136 | Bacteria | 1931 |
| 560 | Ga0500564_000978 | 3300053138 | Bacteria | 9309 |
| 561 | Ga0500616_0003651 | 3300053153 | Bacteria | 11556 |
| 562 | Ga0500567_000681 | 3300053723 | Bacteria | 12398 |
| 563 | Ga0500625_000039 | 3300053729 | Bacteria | 43868 |
| 564 | Ga0501084_0019344 | 3300054114 | Bacteria | 5673 |
| 565 | Ga0501084_0310092 | 3300054114 | Bacteria | 1333 |
| 566 | Ga0501084_0371144 | 3300054114 | Bacteria | 1209 |
| 567 | Ga0500661_022520 | 3300055283 | Bacteria | 1117 |
| 568 | Ga0501082_0017447 | 3300060353 | Bacteria | 6184 |
| 569 | Ga0501082_0046733 | 3300060353 | Bacteria | 3731 |
| 570 | Ga0501082_0121387 | 3300060353 | Bacteria | 2265 |
| 571 | Ga0501082_0197962 | 3300060353 | Bacteria | 1748 |
| 572 | Ga0501082_0281339 | 3300060353 | Bacteria | 1448 |
| 573 | Ga0501082_0526225 | 3300060353 | Bacteria | 1034 |
| 574 | Ga0530510_0008259 | 3300061734 | Bacteria | 7260 |
| 575 | Ga0530510_0015817 | 3300061734 | Bacteria | 5334 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005347 | Ga0070668_100541682 | Ga0070668_1005416821 | 230 |
| 2 | 3300005367 | Ga0070667_100022127 | Ga0070667_1000221272 | 230 |
| 3 | 3300005548 | Ga0070665_100004090 | Ga0070665_10000409011 | 230 |
| 4 | 3300005842 | Ga0068858_100051743 | Ga0068858_1000517432 | 230 |
| 5 | 3300005843 | Ga0068860_100000007 | Ga0068860_100000007184 | 230 |
| 6 | 3300025986 | Ga0207658_10003671 | Ga0207658_100036713 | 231 |
| 7 | 3300026035 | Ga0207703_10024192 | Ga0207703_100241922 | 231 |
| 8 | 3300028381 | Ga0268264_10000077 | Ga0268264_1000007755 | 231 |
| 9 | 3300025933 | Ga0207706_10465482 | Ga0207706_104654821 | 234 |
| 10 | 3300005843 | Ga0068860_100183074 | Ga0068860_1001830742 | 238 |
| 11 | 3300028381 | Ga0268264_10491871 | Ga0268264_104918712 | 238 |
| 12 | 3300025945 | Ga0207679_10088149 | Ga0207679_100881493 | 242 |
| 13 | 3300006051 | Ga0075364_10017033 | Ga0075364_100170333 | 244 |
| 14 | 3300027866 | Ga0209813_10002705 | Ga0209813_100027053 | 244 |
| 15 | 3300050495 | nmdc:mga04h51_3312_c1 | nmdc:mga04h51_3312_c1_1023_1790 | 244 |
| 16 | 3300005343 | Ga0070687_100145480 | Ga0070687_1001454801 | 245 |
| 17 | 3300005466 | Ga0070685_10023778 | Ga0070685_100237783 | 245 |
| 18 | 3300006042 | Ga0075368_10061201 | Ga0075368_100612012 | 245 |
| 19 | 3300006852 | Ga0075433_10036040 | Ga0075433_100360402 | 245 |
| 20 | 3300013306 | Ga0163162_10372437 | Ga0163162_103724372 | 245 |
| 21 | 3300014968 | Ga0157379_10055252 | Ga0157379_100552522 | 245 |
| 22 | 3300026118 | Ga0207675_100047593 | Ga0207675_1000475934 | 245 |
| 23 | 3300048912 | Ga0496109_0027160 | Ga0496109_0027160_824_1594 | 245 |
| 24 | 3300048913 | Ga0496110_0010150 | Ga0496110_0010150_3352_4122 | 245 |
| 25 | 3300048914 | Ga0496111_0045131 | Ga0496111_0045131_1943_2713 | 245 |
| 26 | 3300009094 | Ga0111539_10113930 | Ga0111539_101139302 | 247 |
| 27 | 3300009094 | Ga0111539_10578971 | Ga0111539_105789711 | 247 |
| 28 | 3300009147 | Ga0114129_10378257 | Ga0114129_103782572 | 247 |
| 29 | 3300014326 | Ga0157380_10148814 | Ga0157380_101488141 | 247 |
| 30 | 3300026075 | Ga0207708_10386703 | Ga0207708_103867031 | 247 |
| 31 | 3300027907 | Ga0207428_10023468 | Ga0207428_100234687 | 247 |
| 32 | 3300049572 | Ga0501036_0180145 | Ga0501036_0180145_609_1358 | 247 |
| 33 | 3300049587 | Ga0501071_0264768 | Ga0501071_0264768_82_831 | 247 |
| 34 | 3300050511 | nmdc:mga08y16_163092_c1 | nmdc:mga08y16_163092_c1_1278_2048 | 247 |
| 35 | 3300047443 | Ga0495687_048675 | Ga0495687_048675_495_1256 | 248 |
| 36 | 3300053091 | Ga0500647_0110535 | Ga0500647_0110535_465_1226 | 248 |
| 37 | 3300053136 | Ga0500559_0045018 | Ga0500559_0045018_451_1212 | 248 |
| 38 | 3300053138 | Ga0500564_000978 | Ga0500564_000978_3022_3783 | 248 |
| 39 | 3300053723 | Ga0500567_000681 | Ga0500567_000681_10147_10908 | 248 |
| 40 | 3300053729 | Ga0500625_000039 | Ga0500625_000039_31681_32442 | 248 |
| 41 | 3300055283 | Ga0500661_022520 | Ga0500661_022520_289_1050 | 248 |
| 42 | iso_pu_bacteria | 2818991438 | 2819552665 | 248 |
| 43 | iso_pu_bacteria | 2738541275 | 2738709545 | 249 |
| 44 | iso_pu_bacteria | 2738541301 | 2738847970 | 249 |
| 45 | iso_pu_bacteria | 2738541304 | 2738863699 | 249 |
| 46 | iso_pu_bacteria | 2738543022 | 2739296217 | 249 |
| 47 | iso_pu_bacteria | 2738543033 | 2739357895 | 249 |
| 48 | iso_pu_bacteria | 2928100450 | 2928101100 | 249 |
| 49 | iso_pu_bacteria | 2928959182 | 2928960490 | 249 |
| 50 | 3300005617 | Ga0068859_100079699 | Ga0068859_1000796992 | 250 |
| 51 | 3300005843 | Ga0068860_100110999 | Ga0068860_1001109993 | 250 |
| 52 | 3300006931 | Ga0097620_100079693 | Ga0097620_1000796932 | 250 |
| 53 | 3300009101 | Ga0105247_10535874 | Ga0105247_105358741 | 250 |
| 54 | 3300009176 | Ga0105242_10100192 | Ga0105242_101001922 | 250 |
| 55 | 3300009551 | Ga0105238_10552103 | Ga0105238_105521032 | 250 |
| 56 | 3300009553 | Ga0105249_10164083 | Ga0105249_101640832 | 250 |
| 57 | 3300014325 | Ga0163163_10158779 | Ga0163163_101587792 | 250 |
| 58 | 3300025934 | Ga0207686_10086645 | Ga0207686_100866453 | 250 |
| 59 | 3300025942 | Ga0207689_10275483 | Ga0207689_102754832 | 250 |
| 60 | 3300028380 | Ga0268265_10007813 | Ga0268265_100078137 | 250 |
| 61 | 3300028380 | Ga0268265_10188434 | Ga0268265_101884342 | 250 |
| 62 | 3300028381 | Ga0268264_10297848 | Ga0268264_102978482 | 250 |
| 63 | iso_pu_bacteria | 2643221689 | 2644500398 | 250 |
| 64 | iso_pu_bacteria | 2837678835 | 2837679337 | 250 |
| 65 | iso_pu_bacteria | 2837678835 | 2837682815 | 250 |
| 66 | iso_pu_bacteria | 8045864390 | 8045869056 | 250 |
| 67 | 3300005441 | Ga0070700_100329449 | Ga0070700_1003294492 | 251 |
| 68 | 3300005844 | Ga0068862_100063155 | Ga0068862_1000631554 | 251 |
| 69 | 3300006042 | Ga0075368_10007399 | Ga0075368_100073994 | 251 |
| 70 | 3300006178 | Ga0075367_10006472 | Ga0075367_100064726 | 251 |
| 71 | 3300006844 | Ga0075428_100116482 | Ga0075428_1001164823 | 251 |
| 72 | 3300006846 | Ga0075430_100057610 | Ga0075430_1000576103 | 251 |
| 73 | 3300006847 | Ga0075431_100014915 | Ga0075431_1000149152 | 251 |
| 74 | 3300006880 | Ga0075429_100096018 | Ga0075429_1000960181 | 251 |
| 75 | 3300026075 | Ga0207708_10239582 | Ga0207708_102395822 | 251 |
| 76 | 3300046453 | Ga0495627_000197 | Ga0495627_000197_1517_2278 | 251 |
| 77 | 3300046471 | Ga0495650_0001750 | Ga0495650_0001750_17736_18497 | 251 |
| 78 | 3300046512 | Ga0495610_0000020 | Ga0495610_0000020_54336_55097 | 251 |
| 79 | 3300046515 | Ga0495620_0047963 | Ga0495620_0047963_886_1647 | 251 |
| 80 | 3300046519 | Ga0495632_0018817 | Ga0495632_0018817_1372_2133 | 251 |
| 81 | 3300046530 | Ga0495654_0042275 | Ga0495654_0042275_1385_2146 | 251 |
| 82 | 3300047470 | Ga0495681_0000123 | Ga0495681_0000123_3402_4163 | 251 |
| 83 | 3300048090 | Ga0495615_0000098 | Ga0495615_0000098_1823_2584 | 251 |
| 84 | 3300048925 | Ga0496122_0005308 | Ga0496122_0005308_1567_2328 | 251 |
| 85 | 3300048926 | Ga0496123_0042925 | Ga0496123_0042925_1572_2333 | 251 |
| 86 | 3300050490 | nmdc:mga03n38_29660_c1 | nmdc:mga03n38_29660_c1_582_1349 | 251 |
| 87 | 3300050494 | nmdc:mga06z11_1500_c1 | nmdc:mga06z11_1500_c1_4726_5493 | 251 |
| 88 | 3300050508 | nmdc:mga09592_76780_c1 | nmdc:mga09592_76780_c1_1773_2540 | 251 |
| 89 | 3300050510 | nmdc:mga06r32_36982_c1 | nmdc:mga06r32_36982_c1_3753_4520 | 251 |
| 90 | iso_pu_bacteria | 2895880812 | 2895885928 | 251 |
| 91 | 3300005289 | Ga0065704_10082076 | Ga0065704_100820761 | 252 |
| 92 | 3300005289 | Ga0065704_10131197 | Ga0065704_101311971 | 252 |
| 93 | 3300005295 | Ga0065707_10135350 | Ga0065707_101353502 | 252 |
| 94 | 3300005327 | Ga0070658_10000124 | Ga0070658_1000012419 | 252 |
| 95 | 3300005329 | Ga0070683_100029541 | Ga0070683_1000295419 | 252 |
| 96 | 3300005329 | Ga0070683_100043254 | Ga0070683_1000432545 | 252 |
| 97 | 3300005330 | Ga0070690_100002347 | Ga0070690_1000023479 | 252 |
| 98 | 3300005331 | Ga0070670_100153603 | Ga0070670_1001536034 | 252 |
| 99 | 3300005334 | Ga0068869_100018365 | Ga0068869_1000183654 | 252 |
| 100 | 3300005335 | Ga0070666_10019746 | Ga0070666_100197463 | 252 |
| 101 | 3300005335 | Ga0070666_10188915 | Ga0070666_101889152 | 252 |
| 102 | 3300005336 | Ga0070680_100005639 | Ga0070680_1000056396 | 252 |
| 103 | 3300005338 | Ga0068868_100017924 | Ga0068868_1000179243 | 252 |
| 104 | 3300005339 | Ga0070660_100122077 | Ga0070660_1001220773 | 252 |
| 105 | 3300005340 | Ga0070689_100014474 | Ga0070689_1000144746 | 252 |
| 106 | 3300005344 | Ga0070661_100157052 | Ga0070661_1001570522 | 252 |
| 107 | 3300005347 | Ga0070668_100008123 | Ga0070668_10000812310 | 252 |
| 108 | 3300005353 | Ga0070669_100007923 | Ga0070669_1000079232 | 252 |
| 109 | 3300005353 | Ga0070669_100144690 | Ga0070669_1001446902 | 252 |
| 110 | 3300005355 | Ga0070671_100025197 | Ga0070671_1000251972 | 252 |
| 111 | 3300005355 | Ga0070671_100066674 | Ga0070671_1000666742 | 252 |
| 112 | 3300005356 | Ga0070674_100135820 | Ga0070674_1001358202 | 252 |
| 113 | 3300005364 | Ga0070673_100023817 | Ga0070673_1000238174 | 252 |
| 114 | 3300005366 | Ga0070659_100046160 | Ga0070659_1000461604 | 252 |
| 115 | 3300005366 | Ga0070659_100423456 | Ga0070659_1004234562 | 252 |
| 116 | 3300005367 | Ga0070667_100000261 | Ga0070667_10000026144 | 252 |
| 117 | 3300005367 | Ga0070667_100051379 | Ga0070667_1000513792 | 252 |
| 118 | 3300005406 | Ga0070703_10001502 | Ga0070703_100015023 | 252 |
| 119 | 3300005438 | Ga0070701_10070679 | Ga0070701_100706792 | 252 |
| 120 | 3300005440 | Ga0070705_100000029 | Ga0070705_1000000293 | 252 |
| 121 | 3300005441 | Ga0070700_100001253 | Ga0070700_1000012533 | 252 |
| 122 | 3300005444 | Ga0070694_100000919 | Ga0070694_10000091918 | 252 |
| 123 | 3300005444 | Ga0070694_100315002 | Ga0070694_1003150022 | 252 |
| 124 | 3300005445 | Ga0070708_100006293 | Ga0070708_1000062934 | 252 |
| 125 | 3300005455 | Ga0070663_100194215 | Ga0070663_1001942152 | 252 |
| 126 | 3300005456 | Ga0070678_100133617 | Ga0070678_1001336172 | 252 |
| 127 | 3300005456 | Ga0070678_100155585 | Ga0070678_1001555851 | 252 |
| 128 | 3300005457 | Ga0070662_100035916 | Ga0070662_1000359162 | 252 |
| 129 | 3300005457 | Ga0070662_100051070 | Ga0070662_1000510702 | 252 |
| 130 | 3300005467 | Ga0070706_100044439 | Ga0070706_1000444394 | 252 |
| 131 | 3300005468 | Ga0070707_100126917 | Ga0070707_1001269173 | 252 |
| 132 | 3300005518 | Ga0070699_100000435 | Ga0070699_10000043524 | 252 |
| 133 | 3300005530 | Ga0070679_100007617 | Ga0070679_1000076176 | 252 |
| 134 | 3300005535 | Ga0070684_100081807 | Ga0070684_1000818071 | 252 |
| 135 | 3300005539 | Ga0068853_100098460 | Ga0068853_1000984604 | 252 |
| 136 | 3300005544 | Ga0070686_100011189 | Ga0070686_1000111896 | 252 |
| 137 | 3300005545 | Ga0070695_100002983 | Ga0070695_1000029834 | 252 |
| 138 | 3300005546 | Ga0070696_100002652 | Ga0070696_1000026524 | 252 |
| 139 | 3300005548 | Ga0070665_100000319 | Ga0070665_10000031963 | 252 |
| 140 | 3300005548 | Ga0070665_100086223 | Ga0070665_1000862232 | 252 |
| 141 | 3300005549 | Ga0070704_100007062 | Ga0070704_1000070624 | 252 |
| 142 | 3300005549 | Ga0070704_100054095 | Ga0070704_1000540952 | 252 |
| 143 | 3300005563 | Ga0068855_100037402 | Ga0068855_1000374022 | 252 |
| 144 | 3300005563 | Ga0068855_100085627 | Ga0068855_1000856272 | 252 |
| 145 | 3300005564 | Ga0070664_100026073 | Ga0070664_1000260732 | 252 |
| 146 | 3300005577 | Ga0068857_100006642 | Ga0068857_1000066427 | 252 |
| 147 | 3300005578 | Ga0068854_100018076 | Ga0068854_1000180764 | 252 |
| 148 | 3300005614 | Ga0068856_100052815 | Ga0068856_1000528152 | 252 |
| 149 | 3300005614 | Ga0068856_100180161 | Ga0068856_1001801612 | 252 |
| 150 | 3300005616 | Ga0068852_100000169 | Ga0068852_10000016934 | 252 |
| 151 | 3300005616 | Ga0068852_100027497 | Ga0068852_1000274972 | 252 |
| 152 | 3300005616 | Ga0068852_100259592 | Ga0068852_1002595922 | 252 |
| 153 | 3300005617 | Ga0068859_100013037 | Ga0068859_1000130374 | 252 |
| 154 | 3300005617 | Ga0068859_100030922 | Ga0068859_1000309223 | 252 |
| 155 | 3300005617 | Ga0068859_100115614 | Ga0068859_1001156143 | 252 |
| 156 | 3300005617 | Ga0068859_100185092 | Ga0068859_1001850922 | 252 |
| 157 | 3300005618 | Ga0068864_100001072 | Ga0068864_10000107216 | 252 |
| 158 | 3300005719 | Ga0068861_100013822 | Ga0068861_1000138221 | 252 |
| 159 | 3300005719 | Ga0068861_100061981 | Ga0068861_1000619814 | 252 |
| 160 | 3300005841 | Ga0068863_100002594 | Ga0068863_1000025948 | 252 |
| 161 | 3300005841 | Ga0068863_100004664 | Ga0068863_1000046643 | 252 |
| 162 | 3300005842 | Ga0068858_100004870 | Ga0068858_1000048703 | 252 |
| 163 | 3300005842 | Ga0068858_100165988 | Ga0068858_1001659883 | 252 |
| 164 | 3300005843 | Ga0068860_100009800 | Ga0068860_1000098004 | 252 |
| 165 | 3300005843 | Ga0068860_100029758 | Ga0068860_1000297582 | 252 |
| 166 | 3300005843 | Ga0068860_100039467 | Ga0068860_1000394671 | 252 |
| 167 | 3300005843 | Ga0068860_100065597 | Ga0068860_1000655972 | 252 |
| 168 | 3300005843 | Ga0068860_100116951 | Ga0068860_1001169513 | 252 |
| 169 | 3300005844 | Ga0068862_100000866 | Ga0068862_10000086617 | 252 |
| 170 | 3300005844 | Ga0068862_100010264 | Ga0068862_1000102642 | 252 |
| 171 | 3300005844 | Ga0068862_100485827 | Ga0068862_1004858271 | 252 |
| 172 | 3300006042 | Ga0075368_10002950 | Ga0075368_100029509 | 252 |
| 173 | 3300006051 | Ga0075364_10003873 | Ga0075364_100038737 | 252 |
| 174 | 3300006051 | Ga0075364_10127801 | Ga0075364_101278011 | 252 |
| 175 | 3300006051 | Ga0075364_10313664 | Ga0075364_103136642 | 252 |
| 176 | 3300006058 | Ga0075432_10000822 | Ga0075432_100008227 | 252 |
| 177 | 3300006163 | Ga0070715_10218681 | Ga0070715_102186811 | 252 |
| 178 | 3300006237 | Ga0097621_100071890 | Ga0097621_1000718905 | 252 |
| 179 | 3300006353 | Ga0075370_10027382 | Ga0075370_100273822 | 252 |
| 180 | 3300006844 | Ga0075428_100020451 | Ga0075428_1000204516 | 252 |
| 181 | 3300006844 | Ga0075428_100204819 | Ga0075428_1002048193 | 252 |
| 182 | 3300006846 | Ga0075430_100003913 | Ga0075430_1000039133 | 252 |
| 183 | 3300006846 | Ga0075430_100023915 | Ga0075430_1000239157 | 252 |
| 184 | 3300006846 | Ga0075430_100039705 | Ga0075430_1000397053 | 252 |
| 185 | 3300006847 | Ga0075431_100002086 | Ga0075431_10000208621 | 252 |
| 186 | 3300006847 | Ga0075431_100003429 | Ga0075431_1000034293 | 252 |
| 187 | 3300006847 | Ga0075431_100069487 | Ga0075431_1000694873 | 252 |
| 188 | 3300006847 | Ga0075431_100247449 | Ga0075431_1002474494 | 252 |
| 189 | 3300006871 | Ga0075434_100274530 | Ga0075434_1002745302 | 252 |
| 190 | 3300006871 | Ga0075434_100374265 | Ga0075434_1003742652 | 252 |
| 191 | 3300006880 | Ga0075429_100016736 | Ga0075429_1000167363 | 252 |
| 192 | 3300006880 | Ga0075429_100178803 | Ga0075429_1001788032 | 252 |
| 193 | 3300006931 | Ga0097620_100013038 | Ga0097620_1000130387 | 252 |
| 194 | 3300006931 | Ga0097620_100030922 | Ga0097620_1000309223 | 252 |
| 195 | 3300006931 | Ga0097620_100115614 | Ga0097620_1001156143 | 252 |
| 196 | 3300006931 | Ga0097620_100185089 | Ga0097620_1001850892 | 252 |
| 197 | 3300009011 | Ga0105251_10003236 | Ga0105251_1000323613 | 252 |
| 198 | 3300009093 | Ga0105240_10157543 | Ga0105240_101575435 | 252 |
| 199 | 3300009093 | Ga0105240_10321550 | Ga0105240_103215502 | 252 |
| 200 | 3300009094 | Ga0111539_10007982 | Ga0111539_100079824 | 252 |
| 201 | 3300009094 | Ga0111539_10008813 | Ga0111539_100088138 | 252 |
| 202 | 3300009094 | Ga0111539_10197472 | Ga0111539_101974722 | 252 |
| 203 | 3300009094 | Ga0111539_10322534 | Ga0111539_103225342 | 252 |
| 204 | 3300009098 | Ga0105245_10001093 | Ga0105245_1000109317 | 252 |
| 205 | 3300009101 | Ga0105247_10008448 | Ga0105247_100084489 | 252 |
| 206 | 3300009147 | Ga0114129_10072454 | Ga0114129_100724544 | 252 |
| 207 | 3300009147 | Ga0114129_10093102 | Ga0114129_100931023 | 252 |
| 208 | 3300009147 | Ga0114129_10846949 | Ga0114129_108469492 | 252 |
| 209 | 3300009148 | Ga0105243_10156740 | Ga0105243_101567402 | 252 |
| 210 | 3300009176 | Ga0105242_10133911 | Ga0105242_101339114 | 252 |
| 211 | 3300009177 | Ga0105248_10006421 | Ga0105248_1000642113 | 252 |
| 212 | 3300009177 | Ga0105248_10033092 | Ga0105248_100330923 | 252 |
| 213 | 3300009177 | Ga0105248_10043494 | Ga0105248_100434942 | 252 |
| 214 | 3300009551 | Ga0105238_10010483 | Ga0105238_1001048314 | 252 |
| 215 | 3300009551 | Ga0105238_10151448 | Ga0105238_101514482 | 252 |
| 216 | 3300009553 | Ga0105249_10007276 | Ga0105249_100072763 | 252 |
| 217 | 3300010375 | Ga0105239_10288921 | Ga0105239_102889213 | 252 |
| 218 | 3300010375 | Ga0105239_10502248 | Ga0105239_105022482 | 252 |
| 219 | 3300011119 | Ga0105246_10002251 | Ga0105246_1000225111 | 252 |
| 220 | 3300011119 | Ga0105246_10004894 | Ga0105246_100048945 | 252 |
| 221 | 3300011119 | Ga0105246_10023691 | Ga0105246_100236913 | 252 |
| 222 | 3300013100 | Ga0157373_10057593 | Ga0157373_100575932 | 252 |
| 223 | 3300013296 | Ga0157374_10001203 | Ga0157374_1000120310 | 252 |
| 224 | 3300013297 | Ga0157378_10132606 | Ga0157378_101326062 | 252 |
| 225 | 3300013306 | Ga0163162_10005300 | Ga0163162_1000530011 | 252 |
| 226 | 3300014325 | Ga0163163_10000433 | Ga0163163_100004333 | 252 |
| 227 | 3300014326 | Ga0157380_10077684 | Ga0157380_100776841 | 252 |
| 228 | 3300014326 | Ga0157380_10544337 | Ga0157380_105443372 | 252 |
| 229 | 3300014968 | Ga0157379_10049871 | Ga0157379_100498713 | 252 |
| 230 | 3300014968 | Ga0157379_10345608 | Ga0157379_103456081 | 252 |
| 231 | 3300014969 | Ga0157376_10044510 | Ga0157376_100445102 | 252 |
| 232 | 3300014969 | Ga0157376_10169559 | Ga0157376_101695592 | 252 |
| 233 | 3300025298 | Ga0209050_1000119 | Ga0209050_100011984 | 252 |
| 234 | 3300025315 | Ga0207697_10157776 | Ga0207697_101577761 | 252 |
| 235 | 3300025321 | Ga0207656_10051290 | Ga0207656_100512902 | 252 |
| 236 | 3300025735 | Ga0207713_1002886 | Ga0207713_100288613 | 252 |
| 237 | 3300025885 | Ga0207653_10001041 | Ga0207653_100010416 | 252 |
| 238 | 3300025901 | Ga0207688_10154189 | Ga0207688_101541892 | 252 |
| 239 | 3300025903 | Ga0207680_10015444 | Ga0207680_100154443 | 252 |
| 240 | 3300025903 | Ga0207680_10152458 | Ga0207680_101524582 | 252 |
| 241 | 3300025904 | Ga0207647_10029148 | Ga0207647_100291482 | 252 |
| 242 | 3300025904 | Ga0207647_10041236 | Ga0207647_100412362 | 252 |
| 243 | 3300025909 | Ga0207705_10000009 | Ga0207705_10000009506 | 252 |
| 244 | 3300025910 | Ga0207684_10056161 | Ga0207684_100561612 | 252 |
| 245 | 3300025913 | Ga0207695_10237313 | Ga0207695_102373132 | 252 |
| 246 | 3300025913 | Ga0207695_10257545 | Ga0207695_102575452 | 252 |
| 247 | 3300025917 | Ga0207660_10005228 | Ga0207660_100052287 | 252 |
| 248 | 3300025917 | Ga0207660_10296688 | Ga0207660_102966882 | 252 |
| 249 | 3300025918 | Ga0207662_10256699 | Ga0207662_102566992 | 252 |
| 250 | 3300025919 | Ga0207657_10126446 | Ga0207657_101264463 | 252 |
| 251 | 3300025920 | Ga0207649_10032403 | Ga0207649_100324034 | 252 |
| 252 | 3300025920 | Ga0207649_10188362 | Ga0207649_101883622 | 252 |
| 253 | 3300025921 | Ga0207652_10015079 | Ga0207652_100150791 | 252 |
| 254 | 3300025921 | Ga0207652_10545003 | Ga0207652_105450032 | 252 |
| 255 | 3300025922 | Ga0207646_10073923 | Ga0207646_100739232 | 252 |
| 256 | 3300025923 | Ga0207681_10124332 | Ga0207681_101243322 | 252 |
| 257 | 3300025924 | Ga0207694_10045398 | Ga0207694_100453986 | 252 |
| 258 | 3300025924 | Ga0207694_10047515 | Ga0207694_100475152 | 252 |
| 259 | 3300025925 | Ga0207650_10210150 | Ga0207650_102101502 | 252 |
| 260 | 3300025925 | Ga0207650_10515334 | Ga0207650_105153341 | 252 |
| 261 | 3300025927 | Ga0207687_10007530 | Ga0207687_1000753010 | 252 |
| 262 | 3300025931 | Ga0207644_10006124 | Ga0207644_1000612410 | 252 |
| 263 | 3300025931 | Ga0207644_10006524 | Ga0207644_100065244 | 252 |
| 264 | 3300025931 | Ga0207644_10023896 | Ga0207644_100238966 | 252 |
| 265 | 3300025931 | Ga0207644_10100479 | Ga0207644_101004793 | 252 |
| 266 | 3300025932 | Ga0207690_10041295 | Ga0207690_100412953 | 252 |
| 267 | 3300025933 | Ga0207706_10029117 | Ga0207706_100291174 | 252 |
| 268 | 3300025933 | Ga0207706_10058619 | Ga0207706_100586195 | 252 |
| 269 | 3300025933 | Ga0207706_10075982 | Ga0207706_100759824 | 252 |
| 270 | 3300025934 | Ga0207686_10048899 | Ga0207686_100488992 | 252 |
| 271 | 3300025936 | Ga0207670_10010867 | Ga0207670_100108677 | 252 |
| 272 | 3300025941 | Ga0207711_10003182 | Ga0207711_1000318213 | 252 |
| 273 | 3300025941 | Ga0207711_10019446 | Ga0207711_100194463 | 252 |
| 274 | 3300025942 | Ga0207689_10025646 | Ga0207689_100256466 | 252 |
| 275 | 3300025944 | Ga0207661_10022029 | Ga0207661_100220299 | 252 |
| 276 | 3300025944 | Ga0207661_10255779 | Ga0207661_102557792 | 252 |
| 277 | 3300025945 | Ga0207679_10012194 | Ga0207679_100121942 | 252 |
| 278 | 3300025949 | Ga0207667_10008852 | Ga0207667_100088526 | 252 |
| 279 | 3300025949 | Ga0207667_10064815 | Ga0207667_100648152 | 252 |
| 280 | 3300025961 | Ga0207712_10002056 | Ga0207712_100020564 | 252 |
| 281 | 3300025981 | Ga0207640_10013218 | Ga0207640_100132184 | 252 |
| 282 | 3300025986 | Ga0207658_10004197 | Ga0207658_100041972 | 252 |
| 283 | 3300025986 | Ga0207658_10046198 | Ga0207658_100461986 | 252 |
| 284 | 3300025986 | Ga0207658_10241403 | Ga0207658_102414032 | 252 |
| 285 | 3300026023 | Ga0207677_10010473 | Ga0207677_100104732 | 252 |
| 286 | 3300026035 | Ga0207703_10011608 | Ga0207703_100116088 | 252 |
| 287 | 3300026035 | Ga0207703_10158029 | Ga0207703_101580293 | 252 |
| 288 | 3300026041 | Ga0207639_10100612 | Ga0207639_101006124 | 252 |
| 289 | 3300026067 | Ga0207678_10019221 | Ga0207678_1001922110 | 252 |
| 290 | 3300026075 | Ga0207708_10001278 | Ga0207708_100012787 | 252 |
| 291 | 3300026075 | Ga0207708_10033844 | Ga0207708_100338446 | 252 |
| 292 | 3300026078 | Ga0207702_10059447 | Ga0207702_100594475 | 252 |
| 293 | 3300026078 | Ga0207702_10147627 | Ga0207702_101476272 | 252 |
| 294 | 3300026088 | Ga0207641_10004522 | Ga0207641_1000452216 | 252 |
| 295 | 3300026088 | Ga0207641_10031498 | Ga0207641_100314982 | 252 |
| 296 | 3300026095 | Ga0207676_10001795 | Ga0207676_100017956 | 252 |
| 297 | 3300026095 | Ga0207676_10139196 | Ga0207676_101391963 | 252 |
| 298 | 3300026116 | Ga0207674_10006724 | Ga0207674_100067248 | 252 |
| 299 | 3300026118 | Ga0207675_100024013 | Ga0207675_1000240137 | 252 |
| 300 | 3300026118 | Ga0207675_100142996 | Ga0207675_1001429966 | 252 |
| 301 | 3300026121 | Ga0207683_10063050 | Ga0207683_100630502 | 252 |
| 302 | 3300026121 | Ga0207683_10183930 | Ga0207683_101839302 | 252 |
| 303 | 3300026142 | Ga0207698_10000111 | Ga0207698_100001112 | 252 |
| 304 | 3300026142 | Ga0207698_10039004 | Ga0207698_100390042 | 252 |
| 305 | 3300026142 | Ga0207698_10152756 | Ga0207698_101527563 | 252 |
| 306 | 3300027665 | Ga0209983_1022670 | Ga0209983_10226701 | 252 |
| 307 | 3300027866 | Ga0209813_10000069 | Ga0209813_1000006929 | 252 |
| 308 | 3300027876 | Ga0209974_10018229 | Ga0209974_100182292 | 252 |
| 309 | 3300027907 | Ga0207428_10061910 | Ga0207428_100619107 | 252 |
| 310 | 3300028379 | Ga0268266_10000212 | Ga0268266_1000021253 | 252 |
| 311 | 3300028379 | Ga0268266_10078012 | Ga0268266_100780122 | 252 |
| 312 | 3300028380 | Ga0268265_10001316 | Ga0268265_1000131613 | 252 |
| 313 | 3300028380 | Ga0268265_10420562 | Ga0268265_104205622 | 252 |
| 314 | 3300028381 | Ga0268264_10002022 | Ga0268264_1000202215 | 252 |
| 315 | 3300028381 | Ga0268264_10019868 | Ga0268264_100198685 | 252 |
| 316 | 3300028381 | Ga0268264_10020743 | Ga0268264_100207437 | 252 |
| 317 | 3300028381 | Ga0268264_10068302 | Ga0268264_100683024 | 252 |
| 318 | 3300028381 | Ga0268264_10096796 | Ga0268264_100967962 | 252 |
| 319 | 3300031548 | Ga0307408_100154730 | Ga0307408_1001547303 | 252 |
| 320 | 3300031731 | Ga0307405_10048602 | Ga0307405_100486022 | 252 |
| 321 | 3300031731 | Ga0307405_10255104 | Ga0307405_102551042 | 252 |
| 322 | 3300031824 | Ga0307413_10166255 | Ga0307413_101662552 | 252 |
| 323 | 3300031824 | Ga0307413_10261186 | Ga0307413_102611862 | 252 |
| 324 | 3300031852 | Ga0307410_10240700 | Ga0307410_102407002 | 252 |
| 325 | 3300031852 | Ga0307410_10601513 | Ga0307410_106015131 | 252 |
| 326 | 3300031911 | Ga0307412_10052654 | Ga0307412_100526543 | 252 |
| 327 | 3300031911 | Ga0307412_10070762 | Ga0307412_100707622 | 252 |
| 328 | 3300031995 | Ga0307409_100067198 | Ga0307409_1000671982 | 252 |
| 329 | 3300032002 | Ga0307416_100321413 | Ga0307416_1003214132 | 252 |
| 330 | 3300032004 | Ga0307414_10016727 | Ga0307414_100167272 | 252 |
| 331 | 3300035114 | Ga0373939_0051112 | Ga0373939_0051112_388_1158 | 252 |
| 332 | 3300035117 | Ga0373953_0026198 | Ga0373953_0026198_1145_1957 | 252 |
| 333 | 3300035172 | Ga0373955_0010662 | Ga0373955_0010662_699_1511 | 252 |
| 334 | 3300035695 | Ga0373927_0112708 | Ga0373927_0112708_122_892 | 252 |
| 335 | 3300035724 | Ga0373933_0157221 | Ga0373933_0157221_135_947 | 252 |
| 336 | 3300036401 | Ga0373937_0002739 | Ga0373937_0002739_3978_4790 | 252 |
| 337 | 3300036401 | Ga0373937_0201219 | Ga0373937_0201219_564_1334 | 252 |
| 338 | 3300036647 | Ga0316582_0205738 | Ga0316582_0205738_550_1308 | 252 |
| 339 | 3300036712 | Ga0316584_0114864 | Ga0316584_0114864_834_1592 | 252 |
| 340 | 3300038726 | Ga0400490_22429 | Ga0400490_22429_229_999 | 252 |
| 341 | 3300038735 | Ga0400485_08081 | Ga0400485_08081_1295_2065 | 252 |
| 342 | 3300038742 | Ga0400486_10851 | Ga0400486_10851_481_1251 | 252 |
| 343 | 3300038742 | Ga0400486_17016 | Ga0400486_17016_1402_2172 | 252 |
| 344 | 3300039110 | Ga0400487_18928 | Ga0400487_18928_533_1303 | 252 |
| 345 | 3300042015 | Ga0439462_0038649 | Ga0439462_0038649_69_827 | 252 |
| 346 | 3300042125 | Ga0450923_014528 | Ga0450923_014528_21_791 | 252 |
| 347 | 3300046500 | Ga0495596_0000625 | Ga0495596_0000625_1511_2281 | 252 |
| 348 | 3300046500 | Ga0495596_0000662 | Ga0495596_0000662_5094_5864 | 252 |
| 349 | 3300046501 | Ga0495607_0016306 | Ga0495607_0016306_3249_4019 | 252 |
| 350 | 3300046506 | Ga0495583_0062925 | Ga0495583_0062925_818_1588 | 252 |
| 351 | 3300046507 | Ga0495606_0139508 | Ga0495606_0139508_428_1198 | 252 |
| 352 | 3300046512 | Ga0495610_0000104 | Ga0495610_0000104_27963_28733 | 252 |
| 353 | 3300046512 | Ga0495610_0027769 | Ga0495610_0027769_338_1108 | 252 |
| 354 | 3300046522 | Ga0495643_0000023 | Ga0495643_0000023_90143_90913 | 252 |
| 355 | 3300046522 | Ga0495643_0014027 | Ga0495643_0014027_630_1400 | 252 |
| 356 | 3300046522 | Ga0495643_0030092 | Ga0495643_0030092_945_1703 | 252 |
| 357 | 3300046522 | Ga0495643_0105758 | Ga0495643_0105758_289_1059 | 252 |
| 358 | 3300046538 | Ga0495609_0004365 | Ga0495609_0004365_1765_2535 | 252 |
| 359 | 3300046539 | Ga0495621_0030410 | Ga0495621_0030410_820_1578 | 252 |
| 360 | 3300046558 | Ga0495633_0076284 | Ga0495633_0076284_205_975 | 252 |
| 361 | 3300046692 | Ga0495671_0043114 | Ga0495671_0043114_1368_2138 | 252 |
| 362 | 3300047472 | Ga0495686_0107327 | Ga0495686_0107327_25_795 | 252 |
| 363 | 3300047673 | Ga0495593_0055035 | Ga0495593_0055035_1173_1943 | 252 |
| 364 | 3300048090 | Ga0495615_0044902 | Ga0495615_0044902_281_1039 | 252 |
| 365 | 3300048091 | Ga0495626_0029271 | Ga0495626_0029271_477_1247 | 252 |
| 366 | 3300048903 | Ga0496100_0095089 | Ga0496100_0095089_720_1478 | 252 |
| 367 | 3300048903 | Ga0496100_0408491 | Ga0496100_0408491_57_827 | 252 |
| 368 | 3300048904 | Ga0496101_0432345 | Ga0496101_0432345_155_913 | 252 |
| 369 | 3300048904 | Ga0496101_0573739 | Ga0496101_0573739_53_823 | 252 |
| 370 | 3300048905 | Ga0496102_0000972 | Ga0496102_0000972_25692_26462 | 252 |
| 371 | 3300048905 | Ga0496102_0328410 | Ga0496102_0328410_176_946 | 252 |
| 372 | 3300048906 | Ga0496103_0004335 | Ga0496103_0004335_6817_7575 | 252 |
| 373 | 3300048906 | Ga0496103_0053713 | Ga0496103_0053713_521_1291 | 252 |
| 374 | 3300048909 | Ga0496106_0000362 | Ga0496106_0000362_16882_17652 | 252 |
| 375 | 3300048910 | Ga0496107_0004589 | Ga0496107_0004589_4616_5386 | 252 |
| 376 | 3300048911 | Ga0496108_0093028 | Ga0496108_0093028_783_1553 | 252 |
| 377 | 3300048912 | Ga0496109_0038655 | Ga0496109_0038655_1158_1928 | 252 |
| 378 | 3300048913 | Ga0496110_0177457 | Ga0496110_0177457_959_1729 | 252 |
| 379 | 3300048915 | Ga0496112_0011257 | Ga0496112_0011257_2040_2810 | 252 |
| 380 | 3300048916 | Ga0496113_0204939 | Ga0496113_0204939_404_1174 | 252 |
| 381 | 3300048917 | Ga0496114_0132028 | Ga0496114_0132028_318_1088 | 252 |
| 382 | 3300048918 | Ga0496115_0017172 | Ga0496115_0017172_3833_4603 | 252 |
| 383 | 3300048919 | Ga0496116_0000035 | Ga0496116_0000035_65717_66475 | 252 |
| 384 | 3300048920 | Ga0496117_0019809 | Ga0496117_0019809_584_1342 | 252 |
| 385 | 3300048921 | Ga0496118_0047174 | Ga0496118_0047174_2324_3082 | 252 |
| 386 | 3300048921 | Ga0496118_0055728 | Ga0496118_0055728_1233_1991 | 252 |
| 387 | 3300048922 | Ga0496119_0244269 | Ga0496119_0244269_51_809 | 252 |
| 388 | 3300048924 | Ga0496121_0000070 | Ga0496121_0000070_247024_247785 | 252 |
| 389 | 3300048924 | Ga0496121_0004707 | Ga0496121_0004707_400_1158 | 252 |
| 390 | 3300048924 | Ga0496121_0043487 | Ga0496121_0043487_1288_2046 | 252 |
| 391 | 3300048925 | Ga0496122_0014798 | Ga0496122_0014798_4823_5581 | 252 |
| 392 | 3300048926 | Ga0496123_0002019 | Ga0496123_0002019_18334_19092 | 252 |
| 393 | 3300048926 | Ga0496123_0088671 | Ga0496123_0088671_1070_1828 | 252 |
| 394 | 3300048927 | Ga0496124_0029744 | Ga0496124_0029744_1332_2090 | 252 |
| 395 | 3300048927 | Ga0496124_0194940 | Ga0496124_0194940_188_946 | 252 |
| 396 | 3300048928 | Ga0496125_0032235 | Ga0496125_0032235_3563_4321 | 252 |
| 397 | 3300048928 | Ga0496125_0038471 | Ga0496125_0038471_2143_2901 | 252 |
| 398 | 3300048928 | Ga0496125_0134486 | Ga0496125_0134486_637_1395 | 252 |
| 399 | 3300048929 | Ga0496126_0000084 | Ga0496126_0000084_167522_168280 | 252 |
| 400 | 3300049570 | Ga0501033_0061089 | Ga0501033_0061089_28_798 | 252 |
| 401 | 3300049571 | Ga0501034_0394210 | Ga0501034_0394210_451_1209 | 252 |
| 402 | 3300049572 | Ga0501036_0135871 | Ga0501036_0135871_148_912 | 252 |
| 403 | 3300049573 | Ga0501037_0168949 | Ga0501037_0168949_40_804 | 252 |
| 404 | 3300049575 | Ga0501039_0209794 | Ga0501039_0209794_693_1463 | 252 |
| 405 | 3300049575 | Ga0501039_0367136 | Ga0501039_0367136_258_1028 | 252 |
| 406 | 3300049577 | Ga0501041_0032229 | Ga0501041_0032229_276_1046 | 252 |
| 407 | 3300049577 | Ga0501041_0088537 | Ga0501041_0088537_892_1662 | 252 |
| 408 | 3300049581 | Ga0501047_0140060 | Ga0501047_0140060_261_1025 | 252 |
| 409 | 3300049582 | Ga0501048_0014311 | Ga0501048_0014311_4470_5240 | 252 |
| 410 | 3300049582 | Ga0501048_0230005 | Ga0501048_0230005_502_1272 | 252 |
| 411 | 3300049583 | Ga0501067_0179247 | Ga0501067_0179247_28_798 | 252 |
| 412 | 3300049587 | Ga0501071_0056867 | Ga0501071_0056867_1434_2204 | 252 |
| 413 | 3300049588 | Ga0501072_0033785 | Ga0501072_0033785_1336_2106 | 252 |
| 414 | 3300049589 | Ga0501073_0152073 | Ga0501073_0152073_232_1050 | 252 |
| 415 | 3300049590 | Ga0501074_0258066 | Ga0501074_0258066_412_1182 | 252 |
| 416 | 3300049591 | Ga0501075_0011677 | Ga0501075_0011677_3731_4501 | 252 |
| 417 | 3300049591 | Ga0501075_0187710 | Ga0501075_0187710_466_1236 | 252 |
| 418 | 3300049591 | Ga0501075_0353471 | Ga0501075_0353471_323_1093 | 252 |
| 419 | 3300049592 | Ga0501076_0051403 | Ga0501076_0051403_1775_2545 | 252 |
| 420 | 3300049592 | Ga0501076_0122140 | Ga0501076_0122140_980_1750 | 252 |
| 421 | 3300049592 | Ga0501076_0153263 | Ga0501076_0153263_215_985 | 252 |
| 422 | 3300049592 | Ga0501076_0652279 | Ga0501076_0652279_37_807 | 252 |
| 423 | 3300049593 | Ga0501077_0038047 | Ga0501077_0038047_1609_2379 | 252 |
| 424 | 3300049593 | Ga0501077_0045855 | Ga0501077_0045855_1555_2325 | 252 |
| 425 | 3300049593 | Ga0501077_0378079 | Ga0501077_0378079_92_862 | 252 |
| 426 | 3300049741 | Ga0501079_0003608 | Ga0501079_0003608_2909_3679 | 252 |
| 427 | 3300049741 | Ga0501079_0053287 | Ga0501079_0053287_686_1456 | 252 |
| 428 | 3300049741 | Ga0501079_0109992 | Ga0501079_0109992_543_1313 | 252 |
| 429 | 3300049743 | Ga0501081_0033845 | Ga0501081_0033845_2510_3280 | 252 |
| 430 | 3300049743 | Ga0501081_0112997 | Ga0501081_0112997_1127_1897 | 252 |
| 431 | 3300049744 | Ga0501083_0160499 | Ga0501083_0160499_119_889 | 252 |
| 432 | 3300049823 | Ga0501044_0002739 | Ga0501044_0002739_1620_2378 | 252 |
| 433 | 3300049824 | Ga0501045_0071462 | Ga0501045_0071462_721_1491 | 252 |
| 434 | 3300050489 | nmdc:mga03683_582_c1 | nmdc:mga03683_582_c1_2873_3634 | 252 |
| 435 | 3300050489 | nmdc:mga03683_582_c1 | nmdc:mga03683_582_c1_6841_7602 | 252 |
| 436 | 3300050490 | nmdc:mga03n38_34195_c1 | nmdc:mga03n38_34195_c1_940_1701 | 252 |
| 437 | 3300050491 | nmdc:mga00v17_1542_c2 | nmdc:mga00v17_1542_c2_3015_3776 | 252 |
| 438 | 3300050491 | nmdc:mga00v17_2152_c1 | nmdc:mga00v17_2152_c1_3948_4709 | 252 |
| 439 | 3300050494 | nmdc:mga06z11_12519_c1 | nmdc:mga06z11_12519_c1_1379_2140 | 252 |
| 440 | 3300050495 | nmdc:mga04h51_710_c1 | nmdc:mga04h51_710_c1_2873_3634 | 252 |
| 441 | 3300050496 | nmdc:mga07m45_185997_c1 | nmdc:mga07m45_185997_c1_205_966 | 252 |
| 442 | 3300050496 | nmdc:mga07m45_53_c1 | nmdc:mga07m45_53_c1_49623_50384 | 252 |
| 443 | 3300050496 | nmdc:mga07m45_66488_c1 | nmdc:mga07m45_66488_c1_276_1037 | 252 |
| 444 | 3300050507 | nmdc:mga05p37_128250_c1 | nmdc:mga05p37_128250_c1_695_1465 | 252 |
| 445 | 3300050508 | nmdc:mga09592_59967_c1 | nmdc:mga09592_59967_c1_1768_2538 | 252 |
| 446 | 3300050509 | nmdc:mga0qj67_11371_c1 | nmdc:mga0qj67_11371_c1_2127_2897 | 252 |
| 447 | 3300050509 | nmdc:mga0qj67_2771_c1 | nmdc:mga0qj67_2771_c1_10882_11652 | 252 |
| 448 | 3300050509 | nmdc:mga0qj67_89701_c1 | nmdc:mga0qj67_89701_c1_1055_1825 | 252 |
| 449 | 3300050510 | nmdc:mga06r32_265446_c1 | nmdc:mga06r32_265446_c1_208_978 | 252 |
| 450 | 3300050510 | nmdc:mga06r32_41488_c1 | nmdc:mga06r32_41488_c1_2525_3295 | 252 |
| 451 | 3300050510 | nmdc:mga06r32_6820_c1 | nmdc:mga06r32_6820_c1_1724_2494 | 252 |
| 452 | 3300050510 | nmdc:mga06r32_8867_c1 | nmdc:mga06r32_8867_c1_2730_3500 | 252 |
| 453 | 3300050511 | nmdc:mga08y16_28067_c1 | nmdc:mga08y16_28067_c1_3792_4562 | 252 |
| 454 | 3300050515 | nmdc:mga0a205_9747_c1 | nmdc:mga0a205_9747_c1_1954_2724 | 252 |
| 455 | 3300050516 | nmdc:mga0sz30_18348_c1 | nmdc:mga0sz30_18348_c1_1533_2294 | 252 |
| 456 | 3300050516 | nmdc:mga0sz30_404_c1 | nmdc:mga0sz30_404_c1_6355_7116 | 252 |
| 457 | 3300053077 | Ga0495601_0056833 | Ga0495601_0056833_63_833 | 252 |
| 458 | 3300053085 | Ga0495619_0230278 | Ga0495619_0230278_253_1023 | 252 |
| 459 | 3300053087 | Ga0500643_000001 | Ga0500643_000001_1122985_1123743 | 252 |
| 460 | 3300053125 | Ga0500618_028617 | Ga0500618_028617_47_814 | 252 |
| 461 | 3300053153 | Ga0500616_0003651 | Ga0500616_0003651_524_1282 | 252 |
| 462 | 3300054114 | Ga0501084_0019344 | Ga0501084_0019344_4100_4870 | 252 |
| 463 | 3300054114 | Ga0501084_0310092 | Ga0501084_0310092_19_789 | 252 |
| 464 | 3300054114 | Ga0501084_0371144 | Ga0501084_0371144_323_1093 | 252 |
| 465 | 3300060353 | Ga0501082_0017447 | Ga0501082_0017447_1045_1815 | 252 |
| 466 | 3300060353 | Ga0501082_0046733 | Ga0501082_0046733_2243_3013 | 252 |
| 467 | 3300060353 | Ga0501082_0121387 | Ga0501082_0121387_1314_2084 | 252 |
| 468 | 3300060353 | Ga0501082_0197962 | Ga0501082_0197962_543_1313 | 252 |
| 469 | 3300060353 | Ga0501082_0281339 | Ga0501082_0281339_288_1058 | 252 |
| 470 | 3300060353 | Ga0501082_0526225 | Ga0501082_0526225_52_822 | 252 |
| 471 | 3300061734 | Ga0530510_0008259 | Ga0530510_0008259_3519_4289 | 252 |
| 472 | 3300061734 | Ga0530510_0015817 | Ga0530510_0015817_4080_4850 | 252 |
| 473 | 2162886007 | SwRhRL2b_contig_1439351 | SwRhRL2b_0755.00003710 | 253 |
| 474 | 3300002239 | JGI24034J26672_10021882 | JGI24034J26672_100218821 | 253 |
| 475 | 3300005289 | Ga0065704_10201327 | Ga0065704_102013272 | 253 |
| 476 | 3300005327 | Ga0070658_10005251 | Ga0070658_100052513 | 253 |
| 477 | 3300005327 | Ga0070658_10228142 | Ga0070658_102281422 | 253 |
| 478 | 3300005327 | Ga0070658_10265901 | Ga0070658_102659012 | 253 |
| 479 | 3300005329 | Ga0070683_100176196 | Ga0070683_1001761962 | 253 |
| 480 | 3300005335 | Ga0070666_10210481 | Ga0070666_102104812 | 253 |
| 481 | 3300005336 | Ga0070680_100011300 | Ga0070680_1000113002 | 253 |
| 482 | 3300005339 | Ga0070660_100004077 | Ga0070660_10000407711 | 253 |
| 483 | 3300005339 | Ga0070660_100022443 | Ga0070660_1000224437 | 253 |
| 484 | 3300005344 | Ga0070661_100000735 | Ga0070661_10000073524 | 253 |
| 485 | 3300005347 | Ga0070668_100023165 | Ga0070668_1000231654 | 253 |
| 486 | 3300005353 | Ga0070669_100000357 | Ga0070669_10000035721 | 253 |
| 487 | 3300005353 | Ga0070669_100186302 | Ga0070669_1001863022 | 253 |
| 488 | 3300005355 | Ga0070671_100002926 | Ga0070671_1000029263 | 253 |
| 489 | 3300005366 | Ga0070659_100002707 | Ga0070659_10000270710 | 253 |
| 490 | 3300005366 | Ga0070659_100173382 | Ga0070659_1001733822 | 253 |
| 491 | 3300005367 | Ga0070667_100000703 | Ga0070667_10000070315 | 253 |
| 492 | 3300005455 | Ga0070663_100008334 | Ga0070663_1000083349 | 253 |
| 493 | 3300005457 | Ga0070662_100000685 | Ga0070662_10000068513 | 253 |
| 494 | 3300005458 | Ga0070681_10005216 | Ga0070681_1000521610 | 253 |
| 495 | 3300005530 | Ga0070679_100122670 | Ga0070679_1001226702 | 253 |
| 496 | 3300005535 | Ga0070684_100068427 | Ga0070684_1000684273 | 253 |
| 497 | 3300005539 | Ga0068853_100000358 | Ga0068853_1000003588 | 253 |
| 498 | 3300005548 | Ga0070665_100009283 | Ga0070665_1000092838 | 253 |
| 499 | 3300005563 | Ga0068855_100002925 | Ga0068855_10000292511 | 253 |
| 500 | 3300005564 | Ga0070664_100007055 | Ga0070664_1000070552 | 253 |
| 501 | 3300005577 | Ga0068857_100019286 | Ga0068857_1000192867 | 253 |
| 502 | 3300005578 | Ga0068854_100008377 | Ga0068854_1000083779 | 253 |
| 503 | 3300005614 | Ga0068856_100005500 | Ga0068856_10000550010 | 253 |
| 504 | 3300005618 | Ga0068864_100098965 | Ga0068864_1000989652 | 253 |
| 505 | 3300005841 | Ga0068863_100000014 | Ga0068863_10000001451 | 253 |
| 506 | 3300005841 | Ga0068863_100474111 | Ga0068863_1004741112 | 253 |
| 507 | 3300005842 | Ga0068858_100055327 | Ga0068858_1000553272 | 253 |
| 508 | 3300009092 | Ga0105250_10025545 | Ga0105250_100255453 | 253 |
| 509 | 3300009101 | Ga0105247_10065288 | Ga0105247_100652882 | 253 |
| 510 | 3300013100 | Ga0157373_10040948 | Ga0157373_100409483 | 253 |
| 511 | 3300013102 | Ga0157371_10004503 | Ga0157371_100045033 | 253 |
| 512 | 3300013104 | Ga0157370_10009970 | Ga0157370_1000997012 | 253 |
| 513 | 3300013104 | Ga0157370_10061361 | Ga0157370_100613613 | 253 |
| 514 | 3300013105 | Ga0157369_10126508 | Ga0157369_101265082 | 253 |
| 515 | 3300013306 | Ga0163162_10120766 | Ga0163162_101207662 | 253 |
| 516 | 3300013306 | Ga0163162_10171604 | Ga0163162_101716042 | 253 |
| 517 | 3300013307 | Ga0157372_10149186 | Ga0157372_101491862 | 253 |
| 518 | 3300013307 | Ga0157372_10322834 | Ga0157372_103228342 | 253 |
| 519 | 3300025711 | Ga0207696_1010467 | Ga0207696_10104673 | 253 |
| 520 | 3300025903 | Ga0207680_10247337 | Ga0207680_102473372 | 253 |
| 521 | 3300025909 | Ga0207705_10009562 | Ga0207705_100095626 | 253 |
| 522 | 3300025909 | Ga0207705_10042290 | Ga0207705_100422902 | 253 |
| 523 | 3300025912 | Ga0207707_10021788 | Ga0207707_100217882 | 253 |
| 524 | 3300025917 | Ga0207660_10057433 | Ga0207660_100574331 | 253 |
| 525 | 3300025919 | Ga0207657_10000077 | Ga0207657_1000007730 | 253 |
| 526 | 3300025919 | Ga0207657_10062671 | Ga0207657_100626715 | 253 |
| 527 | 3300025920 | Ga0207649_10009270 | Ga0207649_100092703 | 253 |
| 528 | 3300025921 | Ga0207652_10018222 | Ga0207652_100182229 | 253 |
| 529 | 3300025923 | Ga0207681_10000321 | Ga0207681_1000032119 | 253 |
| 530 | 3300025923 | Ga0207681_10000667 | Ga0207681_1000066727 | 253 |
| 531 | 3300025931 | Ga0207644_10014842 | Ga0207644_100148426 | 253 |
| 532 | 3300025932 | Ga0207690_10001427 | Ga0207690_1000142711 | 253 |
| 533 | 3300025933 | Ga0207706_10000204 | Ga0207706_100002043 | 253 |
| 534 | 3300025944 | Ga0207661_10003474 | Ga0207661_1000347411 | 253 |
| 535 | 3300025949 | Ga0207667_10011937 | Ga0207667_100119372 | 253 |
| 536 | 3300025972 | Ga0207668_10015821 | Ga0207668_100158216 | 253 |
| 537 | 3300025981 | Ga0207640_10007531 | Ga0207640_1000753110 | 253 |
| 538 | 3300025986 | Ga0207658_10000514 | Ga0207658_1000051418 | 253 |
| 539 | 3300026035 | Ga0207703_10043897 | Ga0207703_100438972 | 253 |
| 540 | 3300026041 | Ga0207639_10000847 | Ga0207639_100008473 | 253 |
| 541 | 3300026067 | Ga0207678_10338154 | Ga0207678_103381541 | 253 |
| 542 | 3300026078 | Ga0207702_10015456 | Ga0207702_1001545610 | 253 |
| 543 | 3300026088 | Ga0207641_10000126 | Ga0207641_1000012652 | 253 |
| 544 | 3300026095 | Ga0207676_10017419 | Ga0207676_100174193 | 253 |
| 545 | 3300026116 | Ga0207674_10053594 | Ga0207674_100535943 | 253 |
| 546 | 3300028379 | Ga0268266_10007074 | Ga0268266_100070748 | 253 |
| 547 | 3300028381 | Ga0268264_10113621 | Ga0268264_101136214 | 253 |
| 548 | 3300031548 | Ga0307408_100065485 | Ga0307408_1000654852 | 253 |
| 549 | 3300031824 | Ga0307413_10027011 | Ga0307413_100270112 | 253 |
| 550 | 3300031824 | Ga0307413_10146567 | Ga0307413_101465673 | 253 |
| 551 | 3300031852 | Ga0307410_10113003 | Ga0307410_101130031 | 253 |
| 552 | 3300031852 | Ga0307410_10394934 | Ga0307410_103949342 | 253 |
| 553 | 3300031901 | Ga0307406_10133779 | Ga0307406_101337792 | 253 |
| 554 | 3300031903 | Ga0307407_10015575 | Ga0307407_100155754 | 253 |
| 555 | 3300031911 | Ga0307412_10050317 | Ga0307412_100503173 | 253 |
| 556 | 3300031995 | Ga0307409_100680112 | Ga0307409_1006801121 | 253 |
| 557 | 3300032002 | Ga0307416_100019598 | Ga0307416_1000195982 | 253 |
| 558 | 3300032002 | Ga0307416_100775921 | Ga0307416_1007759212 | 253 |
| 559 | 3300032126 | Ga0307415_100050391 | Ga0307415_1000503914 | 253 |
| 560 | 3300042530 | Ga0450916_010780 | Ga0450916_010780_190_957 | 253 |
| 561 | 3300046537 | Ga0495598_0064611 | Ga0495598_0064611_209_976 | 253 |
| 562 | 3300048904 | Ga0496101_0245672 | Ga0496101_0245672_314_1075 | 253 |
| 563 | 3300048905 | Ga0496102_0000106 | Ga0496102_0000106_116100_116861 | 253 |
| 564 | 3300048905 | Ga0496102_0106739 | Ga0496102_0106739_1405_2175 | 253 |
| 565 | 3300048906 | Ga0496103_0000128 | Ga0496103_0000128_12200_12961 | 253 |
| 566 | 3300048906 | Ga0496103_0039010 | Ga0496103_0039010_1523_2293 | 253 |
| 567 | 3300048907 | Ga0496104_0004170 | Ga0496104_0004170_11118_11984 | 253 |
| 568 | 3300048907 | Ga0496104_0006287 | Ga0496104_0006287_16_786 | 253 |
| 569 | 3300048908 | Ga0496105_0002625 | Ga0496105_0002625_11206_11976 | 253 |
| 570 | 3300048908 | Ga0496105_0021662 | Ga0496105_0021662_266_1132 | 253 |
| 571 | 3300048909 | Ga0496106_0393528 | Ga0496106_0393528_230_991 | 253 |
| 572 | 3300048910 | Ga0496107_0084985 | Ga0496107_0084985_515_1276 | 253 |
| 573 | 3300048917 | Ga0496114_0488566 | Ga0496114_0488566_259_1026 | 253 |
| 574 | 3300048919 | Ga0496116_0044661 | Ga0496116_0044661_1928_2689 | 253 |
| 575 | 3300048920 | Ga0496117_0003021 | Ga0496117_0003021_12888_13649 | 253 |
| 576 | 3300048921 | Ga0496118_0019621 | Ga0496118_0019621_1724_2494 | 253 |
| 577 | 3300048921 | Ga0496118_0068432 | Ga0496118_0068432_1486_2247 | 253 |
| 578 | 3300048921 | Ga0496118_0189644 | Ga0496118_0189644_140_910 | 253 |
| 579 | 3300048922 | Ga0496119_0001217 | Ga0496119_0001217_3567_4433 | 253 |
| 580 | 3300048923 | Ga0496120_0007787 | Ga0496120_0007787_5847_6713 | 253 |
| 581 | 3300048924 | Ga0496121_0000222 | Ga0496121_0000222_108165_108935 | 253 |
| 582 | 3300048924 | Ga0496121_0354773 | Ga0496121_0354773_198_959 | 253 |
| 583 | 3300048925 | Ga0496122_0129332 | Ga0496122_0129332_135_896 | 253 |
| 584 | 3300048925 | Ga0496122_0129440 | Ga0496122_0129440_607_1473 | 253 |
| 585 | 3300048927 | Ga0496124_0000417 | Ga0496124_0000417_32678_33439 | 253 |
| 586 | 3300048929 | Ga0496126_0000493 | Ga0496126_0000493_69451_70317 | 253 |
| 587 | 3300049823 | Ga0501044_0167309 | Ga0501044_0167309_131_895 | 253 |
| 588 | 3300049823 | Ga0501044_0192861 | Ga0501044_0192861_780_1550 | 253 |
| 589 | 3300053122 | Ga0500608_003606 | Ga0500608_003606_2961_3722 | 253 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xm8-assembly2.cif.gz_B | x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 | 0.9723 | 3 | 252 |
| 1qh5-assembly1.cif.gz_B | human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl)glutathione | 0.958 | 3 | 253 |
| 1xm8-assembly2.cif.gz_B | x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 | 0.9572 | 3 | 252 |
| 8ewo-assembly2.cif.gz_B | crystal structure of putative glyoxylase ii from pseudomonas aeruginosa | 0.9529 | 1 | 252 |
| 2qed-assembly1.cif.gz_A | crystal structure of salmonella thyphimurium lt2 glyoxalase ii | 0.9511 | 1 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1MD49_73_326_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9753 | 3 | 252 | 3.60.15.10 |
| af_O35952_50_309_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9607 | 3 | 253 | 3.60.15.10 |
| af_I1MD49_73_326_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9602 | 3 | 252 | 3.60.15.10 |
| af_Q8N490_119_385_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9589 | 3 | 253 | 3.60.15.10 |
| af_A0A1D6K1V4_1_276_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.9572 | 3 | 253 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2E949-F1-model_v4 | deleted | 0.9997 | 129 | 252 |
|
| AF-A0A2N3B0W4-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 0.9964 | 1 | 252 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-A0A4V1V7I5-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) | 0.9931 | 1 | 221 |
GO:0004416
GO:0019243 GO:0046872 |
| AF-A0A258HXA9-F1-model_v4 | hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) | 0.9927 | 160 | 252 |
GO:0016787
GO:0046872 |
| AF-A0A2N3B0W4-F1-model_v4 | Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) | 0.9924 | 1 | 252 |
GO:0004416
GO:0019243 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar