F466876

General Info

Members Datasets Scaffolds Average Seq Length
589 400 452 432

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10045849|Ga0307406_100458492
Length 482
Sequence VSSTPSTSPAASGTARIYDFAGIGVGPFNLGLAALTEPVKGVHGVFLERRPSFDWHPGMMLEPAHLQVPFMADLVTLADPTSPYSFLNFLKQTGRLYRFYIRENFYPLRAEYNQYCQWVAGQLDSVRFGTDVTNITFDDGVYRLAVDGPDGPDVVLARRLVLGTGTSPYVPEACAGVVDAGGLVLHNAEYLPRKAELQQQRSITIVGSGQSAAEIYYELLQEIDVHGYQLNWVTRSGRFFPLEYTKLTLEMTSPDYVDYFHSLPQERRDGLIRSQKNLYKGINSELIDAIYDLLYTKSLTGLTDTRLLTHSALTGAAWDPATGTHTLQLRHEEQDSGYSIESDAVVLATGYTYREPAFLAGIHHRISRDNSGRFAVERNYSTGVVPGEIFVQNAELHTHGFVTPDLGMAAYRNSCILREITGREVYAVERTIAFQEFGAPAALRQPDDLPPLPEQMEFSMSQSHVPSASQASQPIDRIGETA

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
7 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
8 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
9 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
10 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
11 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
12 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
13 2643221647 Streptomyces sp. Root369 Isolate Unclassified
14 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
15 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
16 2643221714 Streptomyces sp. Root264 Isolate Unclassified
17 2643221716 Flavobacterium sp. Root901 Isolate Unclassified
18 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
19 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
20 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
21 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
22 2738541302 Pedobacter sp. CF074 Isolate Unclassified
23 2739367651 Pedobacter sp. OK291 Isolate Unclassified
24 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
25 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
26 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
27 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
28 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
29 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
30 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
31 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
32 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
33 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
34 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
35 2808606448 Streptomyces sp. 193411 Isolate Unclassified
36 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
37 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
38 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
39 2818991437 Pedobacter terrae 518 Isolate Unclassified
40 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
41 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
42 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
43 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
44 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
45 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
46 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
47 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
48 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
49 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
50 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
51 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
52 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
53 2857613821 Flavobacterium sp. R-72247 Isolate Unclassified
54 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
55 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
56 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
57 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
58 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
59 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
60 2862574272 Streptomyces sp. AcE210 Isolate Nodule
61 2865014394 Pantoea sp. R-71966 Isolate Unclassified
62 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
63 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
64 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
65 2867428634 Streptomyces sp. RP5T Isolate Unclassified
66 2867475112 Streptomyces sp. TM32 Isolate Unclassified
67 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
68 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
69 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
70 2891562705 Microbispora tritici MT50 Isolate Unclassified
71 2904419702 Flavobacterium sp. 1355 Isolate Rhizosphere
72 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
73 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
74 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
75 2904504865 Serratia marcescens 1822 Isolate Unclassified
76 2904555929 Flavobacterium sp. 1750 Isolate Rhizosphere
77 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
78 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
79 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
80 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
81 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
82 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
83 2919150387 Rahnella aceris 1817 Isolate Unclassified
84 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
85 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
86 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
87 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
88 2927143783 Rahnella sp. 2050 Isolate Unclassified
89 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
90 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
91 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
92 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
93 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
94 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
95 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
96 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
97 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
98 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
99 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
100 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
101 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
102 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
103 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
104 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
105 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
106 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
107 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
108 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
109 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
110 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
111 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
112 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
113 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
114 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
115 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
116 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
117 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
118 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
119 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
120 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
121 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
122 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
123 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
124 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
125 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
126 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
127 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
128 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
129 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
130 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
131 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
132 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
133 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
134 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
135 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
136 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
137 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
138 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
139 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
140 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
141 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
142 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
143 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
144 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
145 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
146 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
147 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
148 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
149 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
150 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
155 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
156 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
157 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
158 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
159 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
163 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
164 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
165 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
166 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
167 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
171 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
172 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
173 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
174 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
175 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
178 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
184 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
186 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
187 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
190 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
191 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
214 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
215 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
216 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
217 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
218 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
219 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
220 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
221 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
222 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
223 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
229 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
230 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
231 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
232 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
233 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
234 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
235 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
236 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
237 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
242 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
243 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
244 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
245 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
246 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
247 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
248 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
249 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
250 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
251 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
252 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
253 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
254 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
255 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
256 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
257 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
258 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
259 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
260 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
261 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
262 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
263 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
266 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
267 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
268 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
269 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
270 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
271 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
272 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
273 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
274 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
275 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
278 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
279 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
280 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
281 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
282 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
290 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
291 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
292 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
293 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
294 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
295 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
296 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
297 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
298 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
299 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
300 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
301 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
304 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
305 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
306 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
311 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
312 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
313 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
314 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
315 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
319 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
320 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
321 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
322 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
323 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
324 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
325 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
326 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
327 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
328 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
329 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
330 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
331 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
332 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
333 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
334 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
335 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
336 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
337 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
338 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
339 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
340 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
341 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
347 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
348 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
349 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
350 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
353 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
358 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
366 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
368 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
369 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
370 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
371 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
372 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
373 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
374 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
375 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
376 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
379 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
380 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
381 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
384 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
385 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
386 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
387 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
388 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
389 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified
390 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
391 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
392 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
393 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
394 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
395 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
396 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
397 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
398 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
399 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
400 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.74
Metatranscriptomes 0
Isolates 23.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.68
Bulb 0
Endosphere 10.19
Nodule 0.68
Rhizoplane 2.38
Rhizosphere 64.86
Stem 0
Stem Tuber 0
Unclassified 21.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10000375 3300001989 Bacteria 15393
2 JGI25162J39368_1000009 3300002737 Bacteria 389795
3 JGI25162J39368_1000258 3300002737 Bacteria 50724
4 JGI25154J39366_1000021 3300002738 Bacteria 221559
5 JGI25163J39215_1000038 3300002771 Bacteria 60053
6 JGI25164J39214_1000002 3300002772 Bacteria 406570
7 JGI25152J39213_1000045 3300002773 Bacteria 86127
8 rootH2_10045220 3300003320 Bacteria 7529
9 rootL2_10027395 3300003322 Bacteria 15216
10 rootH1_10013607 3300003323 Bacteria 4584
11 rootH1_10051261 3300003323 Bacteria 5019
12 JGI25160J50197_1013124 3300003354 Bacteria 2839
13 JGI25160J50197_1016147 3300003354 Bacteria 2417
14 Ga0055538_1000015 3300003751 Bacteria 311166
15 Ga0055539_1000009 3300003752 Bacteria 406566
16 Ga0055533_1000012 3300003756 Bacteria 406566
17 Ga0055525_1000014 3300003759 Bacteria 406566
18 Ga0055535_1003778 3300003761 Bacteria 4046
19 Ga0055542_1003577 3300003762 Bacteria 4124
20 Ga0055536_1000001 3300003781 Bacteria 630663
21 Ga0055530_10005300 3300003791 Bacteria 6191
22 Ga0055531_10000138 3300003794 Bacteria 82997
23 Ga0055541_1000006 3300003841 Bacteria 406566
24 Ga0058692_1000038 3300003856 Bacteria 140136
25 Ga0058692_1000103 3300003856 Bacteria 56448
26 Ga0058692_1003971 3300003856 Bacteria 4468
27 Ga0065165_1001877 3300005262 Bacteria 20331
28 Ga0065165_1004984 3300005262 Bacteria 7787
29 Ga0065714_10006281 3300005288 Bacteria 3658
30 Ga0065714_10064459 3300005288 Bacteria 66711
31 Ga0065704_10000548 3300005289 Bacteria 25183
32 Ga0070668_100002334 3300005347 Bacteria 13953
33 Ga0070668_100031833 3300005347 Bacteria 4014
34 Ga0068860_100096725 3300005843 Bacteria 2814
35 Ga0068862_100150931 3300005844 Bacteria 2068
36 Ga0081455_10017897 3300005937 Bacteria 6772
37 Ga0081540_1018037 3300005983 Bacteria 4345
38 Ga0075367_10000578 3300006178 Bacteria 14009
39 Ga0105251_10003091 3300009011 Bacteria 12376
40 Ga0105251_10046776 3300009011 Bacteria 2081
41 Ga0105251_10079361 3300009011 Bacteria 1519
42 Ga0105244_10000047 3300009036 Bacteria 142097
43 Ga0105244_10000319 3300009036 Bacteria 46053
44 Ga0105244_10001080 3300009036 Bacteria 22687
45 Ga0105244_10014383 3300009036 Bacteria 4579
46 Ga0105250_10000007 3300009092 Bacteria 355249
47 Ga0105250_10022598 3300009092 Bacteria 2535
48 Ga0105243_10002478 3300009148 Bacteria 15406
49 Ga0105237_10004307 3300009545 Bacteria 16504
50 Ga0105237_10004581 3300009545 Bacteria 15959
51 Ga0105238_10172150 3300009551 Bacteria 2141
52 Ga0105239_10000478 3300010375 Bacteria 58328
53 Ga0105239_10276013 3300010375 Unclassified 1891
54 Ga0105246_10003995 3300011119 Bacteria 8946
55 Ga0105246_10016172 3300011119 Bacteria 4720
56 Ga0105246_10033667 3300011119 Bacteria 3408
57 Ga0105246_10129955 3300011119 Bacteria 1879
58 Ga0157373_10001546 3300013100 Bacteria 17563
59 Ga0157371_10000008 3300013102 Bacteria 393028
60 Ga0157371_10000021 3300013102 Bacteria 301017
61 Ga0157371_10000766 3300013102 Bacteria 37124
62 Ga0157370_10000075 3300013104 Bacteria 108060
63 Ga0157370_10000276 3300013104 Bacteria 65208
64 Ga0157370_10002996 3300013104 Bacteria 20062
65 Ga0157370_10023681 3300013104 Bacteria 6094
66 Ga0157369_10000008 3300013105 Bacteria 309315
67 Ga0157369_10023989 3300013105 Bacteria 6786
68 Ga0163162_10000502 3300013306 Bacteria 36447
69 Ga0163162_10213866 3300013306 Bacteria 2058
70 Ga0163162_10223642 3300013306 Bacteria 2012
71 Ga0157372_10003482 3300013307 Bacteria 16971
72 Ga0157372_10008915 3300013307 Bacteria 10658
73 Ga0157372_10017301 3300013307 Bacteria 7739
74 Ga0157372_10053107 3300013307 Bacteria 4515
75 Ga0182008_10001691 3300014497 Bacteria 14494
76 Ga0182006_1000408 3300015261 Bacteria 34758
77 Ga0182006_1001891 3300015261 Bacteria 11948
78 Ga0182006_1055550 3300015261 Bacteria 1511
79 Ga0182007_10000003 3300015262 Bacteria 548244
80 Ga0182005_1000153 3300015265 Bacteria 48357
81 Ga0183373_1001 3300015682 Bacteria 1410374
82 Ga0183367_1006 3300015688 Bacteria 648044
83 Ga0163161_10000164 3300017792 Bacteria 61295
84 Ga0163161_10000219 3300017792 Bacteria 52250
85 Ga0163161_10013759 3300017792 Bacteria 5636
86 Ga0163161_10128046 3300017792 Bacteria 1913
87 Ga0209760_100040 3300025207 Bacteria 118059
88 Ga0209784_100001 3300025224 Bacteria 3600592
89 Ga0209566_100001 3300025225 Bacteria 3600765
90 Ga0209674_100002 3300025226 Bacteria 3600592
91 Ga0209563_100002 3300025230 Bacteria 2045675
92 Ga0207427_100020 3300025231 Bacteria 507515
93 Ga0209437_100001 3300025233 Bacteria 2045675
94 Ga0209437_100032 3300025233 Bacteria 520075
95 Ga0209437_100361 3300025233 Bacteria 50797
96 Ga0209258_100145 3300025242 Bacteria 163672
97 Ga0209646_1000050 3300025246 Bacteria 296599
98 Ga0209026_1000240 3300025250 Bacteria 71671
99 Ga0209677_100002 3300025253 Bacteria 2045675
100 Ga0209148_1000177 3300025254 Bacteria 127365
101 Ga0209129_1000068 3300025258 Bacteria 217385
102 Ga0209233_1010218 3300025261 Bacteria 2823
103 Ga0209676_1000008 3300025292 Bacteria 991778
104 Ga0209025_1000045 3300025294 Bacteria 349118
105 Ga0209758_1004595 3300025297 Bacteria 11348
106 Ga0209758_1025897 3300025297 Bacteria 2558
107 Ga0209050_1000045 3300025298 Bacteria 388022
108 Ga0207426_1000073 3300025302 Bacteria 323756
109 Ga0207426_1000293 3300025302 Bacteria 98805
110 Ga0207426_1002867 3300025302 Bacteria 10229
111 Ga0207426_1016904 3300025302 Bacteria 2604
112 Ga0209051_1004119 3300025303 Bacteria 9105
113 Ga0209051_1009516 3300025303 Bacteria 5000
114 Ga0209257_1000001 3300025304 Bacteria 2274655
115 Ga0207697_10002451 3300025315 Bacteria 9607
116 Ga0207696_1000029 3300025711 Bacteria 398074
117 Ga0207696_1000498 3300025711 Bacteria 32915
118 Ga0207696_1001476 3300025711 Bacteria 12725
119 Ga0207655_1000030 3300025728 Bacteria 413221
120 Ga0207655_1001287 3300025728 Bacteria 23796
121 Ga0207655_1001970 3300025728 Bacteria 17529
122 Ga0207655_1016409 3300025728 Bacteria 4051
123 Ga0207713_1000011 3300025735 Bacteria 507224
124 Ga0207713_1004736 3300025735 Bacteria 8751
125 Ga0207713_1011079 3300025735 Bacteria 4935
126 Ga0207671_10005027 3300025914 Bacteria 12364
127 Ga0207671_10006628 3300025914 Bacteria 10272
128 Ga0207694_10198630 3300025924 Bacteria 1631
129 Ga0207709_10016870 3300025935 Bacteria 4068
130 Ga0207709_10064625 3300025935 Bacteria 2298
131 Ga0207691_10177831 3300025940 Bacteria 1860
132 Ga0207667_10071873 3300025949 Unclassified 3597
133 Ga0209371_1000034 3300027312 Bacteria 379021
134 Ga0209371_1000093 3300027312 Bacteria 171050
135 Ga0209371_1002919 3300027312 Bacteria 8922
136 Ga0209371_1002968 3300027312 Bacteria 8819
137 Ga0207428_10036427 3300027907 Bacteria 4013
138 Ga0268265_10083626 3300028380 Bacteria 2528
139 Ga0268264_10037949 3300028381 Bacteria 3974
140 Ga0307517_10012094 3300028786 Bacteria 11894
141 Ga0307515_10006210 3300028794 Bacteria 23997
142 Ga0268256_1000043 3300030500 Bacteria 331360
143 Ga0268256_1000081 3300030500 Bacteria 171742
144 Ga0268256_1000752 3300030500 Bacteria 23724
145 Ga0268256_1002629 3300030500 Bacteria 8922
146 Ga0268256_1027661 3300030500 Bacteria 1409
147 Ga0307511_10000477 3300030521 Bacteria 43424
148 Ga0307512_10002642 3300030522 Bacteria 22156
149 Ga0316177_1045554 3300030731 Bacteria 5881
150 Ga0316176_1220125 3300030732 Bacteria 12538
151 Ga0316181_1278021 3300030744 Bacteria 2338
152 Ga0307513_10029380 3300031456 Bacteria 6269
153 Ga0307513_10121885 3300031456 Bacteria 2572
154 Ga0307509_10008150 3300031507 Bacteria 13433
155 Ga0307509_10104489 3300031507 Bacteria 2857
156 Ga0307408_100003548 3300031548 Bacteria 10627
157 Ga0307408_100008343 3300031548 Bacteria 6842
158 Ga0307408_100025838 3300031548 Bacteria 4025
159 Ga0307408_100028204 3300031548 Bacteria 3877
160 Ga0307408_100068269 3300031548 Bacteria 2617
161 Ga0307408_100185848 3300031548 Bacteria 1670
162 Ga0307508_10006664 3300031616 Bacteria 10843
163 Ga0307508_10053295 3300031616 Bacteria 3590
164 Ga0307514_10001878 3300031649 Bacteria 23182
165 Ga0307514_10128783 3300031649 Bacteria 1747
166 Ga0307516_10004046 3300031730 Bacteria 18371
167 Ga0307516_10206490 3300031730 Bacteria 1681
168 Ga0307405_10000032 3300031731 Bacteria 98354
169 Ga0307405_10035535 3300031731 Bacteria 2977
170 Ga0307405_10107398 3300031731 Bacteria 1884
171 Ga0307413_10000107 3300031824 Bacteria 21411
172 Ga0307410_10002372 3300031852 Bacteria 9081
173 Ga0307410_10024906 3300031852 Bacteria 3745
174 Ga0307410_10075191 3300031852 Bacteria 2354
175 Ga0307410_10212405 3300031852 Bacteria 1483
176 Ga0307406_10000003 3300031901 Bacteria 251998
177 Ga0307406_10045849 3300031901 Bacteria 2747
178 Ga0307406_10181130 3300031901 Bacteria 1534
179 Ga0307407_10008580 3300031903 Bacteria 4702
180 Ga0307407_10025963 3300031903 Bacteria 3096
181 Ga0307412_10004093 3300031911 Bacteria 8124
182 Ga0307412_10012753 3300031911 Bacteria 4905
183 Ga0307412_10063452 3300031911 Bacteria 2492
184 Ga0307412_10075047 3300031911 Bacteria 2318
185 Ga0307409_100014800 3300031995 Bacteria 5091
186 Ga0307409_100016645 3300031995 Bacteria 4872
187 Ga0307409_100206287 3300031995 Bacteria 1763
188 Ga0307416_100021725 3300032002 Bacteria 4614
189 Ga0307416_100048321 3300032002 Bacteria 3375
190 Ga0307416_100065107 3300032002 Bacteria 2993
191 Ga0307414_10000001 3300032004 Bacteria 1352954
192 Ga0307414_10034930 3300032004 Bacteria 3339
193 Ga0307414_10149835 3300032004 Bacteria 1839
194 Ga0307411_10000001 3300032005 Bacteria 931810
195 Ga0307415_100030434 3300032126 Bacteria 3465
196 Ga0307507_10031590 3300033179 Bacteria 5553
197 Ga0307507_10066512 3300033179 Bacteria 3303
198 Ga0307507_10157204 3300033179 Bacteria 1691
199 Ga0307510_10024274 3300033180 Bacteria 7008
200 Ga0395900_0068666 3300037418 Bacteria 3642
201 Ga0395900_0073730 3300037418 Bacteria 3510
202 Ga0395900_0264439 3300037418 Bacteria 1717
203 Ga0395898_0099194 3300037466 Bacteria 2797
204 Ga0395898_0099820 3300037466 Bacteria 2788
205 Ga0395901_0086921 3300038443 Bacteria 3269
206 Ga0439438_003563 3300041405 Bacteria 6248
207 Ga0439439_0008890 3300041406 Bacteria 2378
208 Ga0439447_003550 3300041407 Bacteria 5526
209 Ga0439447_017741 3300041407 Bacteria 1934
210 Ga0439466_0002667 3300041411 Bacteria 6974
211 Ga0451837_0044792 3300041494 Bacteria 3048
212 Ga0451853_0467392 3300041512 Bacteria 7839
213 Ga0451853_1828395 3300041512 Bacteria 2519
214 Ga0439433_0000053 3300041999 Bacteria 14113
215 Ga0439433_0002239 3300041999 Bacteria 4084
216 Ga0439433_0004488 3300041999 Bacteria 3005
217 Ga0439433_0006640 3300041999 Bacteria 2493
218 Ga0439442_000693 3300042002 Bacteria 7093
219 Ga0439442_011592 3300042002 Bacteria 1796
220 Ga0439432_005694 3300042006 Bacteria 4478
221 Ga0439432_025935 3300042006 Bacteria 1920
222 Ga0439449_0003710 3300042007 Bacteria 5924
223 Ga0439449_0010144 3300042007 Bacteria 3561
224 Ga0439449_0019001 3300042007 Bacteria 2576
225 Ga0439452_000004 3300042010 Bacteria 764268
226 Ga0439457_000197 3300042014 Bacteria 15955
227 Ga0439462_0006281 3300042015 Bacteria 2948
228 Ga0439463_012084 3300042016 Bacteria 2122
229 Ga0450898_003379 3300042134 Bacteria 2292
230 Ga0450907_000088 3300042146 Bacteria 36401
231 Ga0439434_0000246 3300042435 Bacteria 15180
232 Ga0466972_0004414 3300044658 Bacteria 7031
233 Ga0466965_0000319 3300044683 Bacteria 16121
234 Ga0466966_0003509 3300044684 Bacteria 10343
235 Ga0466961_0003370 3300044693 Bacteria 9978
236 Ga0466963_0000410 3300044694 Bacteria 19654
237 Ga0466963_0002165 3300044694 Bacteria 10853
238 Ga0466964_0002518 3300044706 Bacteria 6516
239 Ga0466971_0000916 3300044719 Bacteria 12093
240 Ga0466970_0001045 3300044765 Bacteria 13386
241 Ga0466957_0001204 3300044842 Bacteria 13488
242 Ga0466959_0005690 3300045049 Bacteria 8577
243 Ga0466958_0005059 3300045836 Bacteria 7044
244 Ga0466967_0002249 3300045976 Bacteria 11891
245 Ga0466967_0252189 3300045976 Bacteria 1686
246 Ga0466967_0300016 3300045976 Bacteria 1545
247 Ga0495627_016036 3300046453 Bacteria 2575
248 Ga0495592_0001976 3300046454 Bacteria 14475
249 Ga0495592_0026544 3300046454 Bacteria 4390
250 Ga0495603_0018588 3300046455 Bacteria 4205
251 Ga0495603_0025560 3300046455 Bacteria 3571
252 Ga0495603_0130224 3300046455 Bacteria 1465
253 Ga0495591_000318 3300046458 Bacteria 43617
254 Ga0495629_0009575 3300046459 Bacteria 7079
255 Ga0495629_0041470 3300046459 Bacteria 3239
256 Ga0495629_0043656 3300046459 Bacteria 3147
257 Ga0495629_0074193 3300046459 Bacteria 2376
258 Ga0495638_0026710 3300046460 Bacteria 3741
259 Ga0495651_0056599 3300046462 Bacteria 3011
260 Ga0495650_0000026 3300046471 Bacteria 476029
261 Ga0495650_0000148 3300046471 Bacteria 159533
262 Ga0495580_0027812 3300046472 Bacteria 4113
263 Ga0495582_0020680 3300046473 Bacteria 3603
264 Ga0495605_0040680 3300046474 Bacteria 2319
265 Ga0495639_0018843 3300046475 Bacteria 3008
266 Ga0495662_0000971 3300046476 Bacteria 14034
267 Ga0495662_0010134 3300046476 Bacteria 4620
268 Ga0495664_0000582 3300046477 Bacteria 18410
269 Ga0495584_0015385 3300046491 Bacteria 3897
270 Ga0495585_0029402 3300046492 Bacteria 3128
271 Ga0495594_0015368 3300046499 Bacteria 4021
272 Ga0495607_0012103 3300046501 Bacteria 5708
273 Ga0495607_0062225 3300046501 Bacteria 2117
274 Ga0495606_0001190 3300046507 Bacteria 36711
275 Ga0495606_0027669 3300046507 Bacteria 4014
276 Ga0495606_0048779 3300046507 Bacteria 2782
277 Ga0495610_0000066 3300046512 Bacteria 124205
278 Ga0495610_0000150 3300046512 Bacteria 76876
279 Ga0495610_0062455 3300046512 Bacteria 1767
280 Ga0495616_0036265 3300046513 Bacteria 2545
281 Ga0495618_0021816 3300046514 Bacteria 3950
282 Ga0495618_0049327 3300046514 Bacteria 2658
283 Ga0495620_0016985 3300046515 Bacteria 3638
284 Ga0495620_0028901 3300046515 Bacteria 2571
285 Ga0495628_0056421 3300046516 Bacteria 3091
286 Ga0495637_0018958 3300046520 Bacteria 3186
287 Ga0495643_0017202 3300046522 Bacteria 4231
288 Ga0495643_0017796 3300046522 Bacteria 4145
289 Ga0495644_0018923 3300046523 Bacteria 2628
290 Ga0495648_0004181 3300046524 Bacteria 12410
291 Ga0495648_0005979 3300046524 Bacteria 10002
292 Ga0495648_0043592 3300046524 Bacteria 2810
293 Ga0495652_0027359 3300046529 Bacteria 5024
294 Ga0495654_0000069 3300046530 Bacteria 120853
295 Ga0495654_0016590 3300046530 Bacteria 3889
296 Ga0495640_0102063 3300046533 Bacteria 1882
297 Ga0495587_0001380 3300046536 Bacteria 16149
298 Ga0495609_0010008 3300046538 Bacteria 4567
299 Ga0495609_0018516 3300046538 Bacteria 3226
300 Ga0495597_0023556 3300046542 Bacteria 2847
301 Ga0495633_0000017 3300046558 Bacteria 249973
302 Ga0495667_0165376 3300046559 Bacteria 1422
303 Ga0495668_0017862 3300046616 Bacteria 4109
304 Ga0495634_0000830 3300046642 Bacteria 29781
305 Ga0495634_0115747 3300046642 Bacteria 1720
306 Ga0495611_0068315 3300046648 Bacteria 1622
307 Ga0495625_0009187 3300046660 Bacteria 8304
308 Ga0495625_0057999 3300046660 Bacteria 2751
309 Ga0495625_0059382 3300046660 Bacteria 2714
310 Ga0495625_0158507 3300046660 Bacteria 1517
311 Ga0495635_0000558 3300046663 Bacteria 23721
312 Ga0495635_0057845 3300046663 Bacteria 2667
313 Ga0495635_0112200 3300046663 Bacteria 1862
314 Ga0495588_0009910 3300046674 Bacteria 4415
315 Ga0495657_0013733 3300046675 Bacteria 5962
316 Ga0495657_0014539 3300046675 Bacteria 5774
317 Ga0495599_0092798 3300046678 Bacteria 1884
318 Ga0495646_0000540 3300046680 Bacteria 20365
319 Ga0495658_0071995 3300046683 Bacteria 2009
320 Ga0495613_0001710 3300046689 Bacteria 16714
321 Ga0495624_0016482 3300046690 Bacteria 4973
322 Ga0495671_0002279 3300046692 Bacteria 12197
323 Ga0495671_0012573 3300046692 Bacteria 4617
324 Ga0495649_0025880 3300046694 Bacteria 3267
325 Ga0495649_0046936 3300046694 Bacteria 2350
326 Ga0495649_0067934 3300046694 Bacteria 1912
327 Ga0495660_0000016 3300046810 Bacteria 321859
328 Ga0495660_0000046 3300046810 Bacteria 150057
329 Ga0495581_0016468 3300047315 Bacteria 4297
330 Ga0495581_0080760 3300047315 Bacteria 1882
331 Ga0495604_0006812 3300047317 Bacteria 9054
332 Ga0495636_0000508 3300047318 Bacteria 14307
333 Ga0495672_0000001 3300047320 Bacteria 1458820
334 Ga0495672_0000096 3300047320 Bacteria 143686
335 Ga0495672_0092023 3300047320 Bacteria 1663
336 Ga0495676_0024438 3300047321 Bacteria 5230
337 Ga0495676_0048061 3300047321 Bacteria 3443
338 Ga0495676_0082625 3300047321 Bacteria 2430
339 Ga0495680_0006988 3300047322 Bacteria 10408
340 Ga0495683_0025686 3300047323 Bacteria 3017
341 Ga0495683_0051056 3300047323 Bacteria 2069
342 Ga0495687_002174 3300047443 Bacteria 16321
343 Ga0495687_002993 3300047443 Bacteria 12768
344 Ga0495675_0020782 3300047444 Bacteria 4178
345 Ga0495675_0024142 3300047444 Bacteria 3876
346 Ga0495673_0000352 3300047469 Bacteria 57266
347 Ga0495681_0007136 3300047470 Bacteria 7198
348 Ga0495681_0035398 3300047470 Bacteria 2479
349 Ga0495681_0052656 3300047470 Bacteria 1908
350 Ga0495684_0025460 3300047471 Bacteria 4547
351 Ga0495686_0095037 3300047472 Bacteria 1805
352 Ga0495593_0004506 3300047673 Bacteria 8274
353 Ga0495602_0005106 3300048088 Bacteria 13753
354 Ga0495614_0008313 3300048089 Bacteria 4619
355 Ga0496100_0010304 3300048903 Bacteria 5289
356 Ga0496102_0020408 3300048905 Bacteria 5855
357 Ga0496102_0023924 3300048905 Bacteria 5429
358 Ga0496103_0018526 3300048906 Bacteria 4177
359 Ga0496104_0000869 3300048907 Bacteria 26029
360 Ga0496105_0013974 3300048908 Bacteria 6385
361 Ga0496105_0103453 3300048908 Bacteria 2352
362 Ga0496108_0188897 3300048911 Bacteria 1785
363 Ga0496109_0198258 3300048912 Bacteria 1887
364 Ga0496110_0106922 3300048913 Bacteria 2511
365 Ga0496112_0034536 3300048915 Bacteria 4922
366 Ga0496116_0000086 3300048919 Bacteria 217597
367 Ga0496116_0000162 3300048919 Bacteria 135528
368 Ga0496116_0000715 3300048919 Bacteria 42503
369 Ga0496116_0014976 3300048919 Bacteria 6153
370 Ga0496117_0000017 3300048920 Bacteria 490421
371 Ga0496117_0002870 3300048920 Bacteria 20944
372 Ga0496117_0017601 3300048920 Bacteria 5962
373 Ga0496118_0000018 3300048921 Bacteria 490421
374 Ga0496118_0001909 3300048921 Bacteria 29643
375 Ga0496118_0003468 3300048921 Bacteria 19799
376 Ga0496118_0006090 3300048921 Bacteria 13409
377 Ga0496118_0008283 3300048921 Bacteria 10774
378 Ga0496119_0000005 3300048922 Bacteria 529799
379 Ga0496119_0001168 3300048922 Bacteria 32871
380 Ga0496119_0004892 3300048922 Bacteria 13106
381 Ga0496119_0084299 3300048922 Bacteria 1822
382 Ga0496120_0000005 3300048923 Bacteria 529797
383 Ga0496120_0000010 3300048923 Bacteria 385791
384 Ga0496120_0000028 3300048923 Bacteria 230249
385 Ga0496120_0000917 3300048923 Bacteria 41032
386 Ga0496120_0015134 3300048923 Bacteria 5102
387 Ga0496121_0000011 3300048924 Bacteria 792193
388 Ga0496121_0019814 3300048924 Bacteria 6701
389 Ga0496122_0000007 3300048925 Bacteria 606493
390 Ga0496122_0000779 3300048925 Bacteria 61202
391 Ga0496122_0001506 3300048925 Bacteria 37139
392 Ga0496123_0000004 3300048926 Bacteria 777230
393 Ga0496123_0000185 3300048926 Bacteria 126153
394 Ga0496123_0001997 3300048926 Bacteria 26369
395 Ga0496123_0021922 3300048926 Bacteria 4945
396 Ga0496124_0000627 3300048927 Bacteria 58705
397 Ga0496124_0000749 3300048927 Bacteria 53271
398 Ga0496124_0005227 3300048927 Bacteria 14726
399 Ga0496124_0110581 3300048927 Bacteria 2212
400 Ga0496125_0000013 3300048928 Bacteria 628761
401 Ga0496126_0001673 3300048929 Bacteria 33280
402 Ga0496126_0020820 3300048929 Bacteria 6419
403 Ga0495678_001115 3300049459 Bacteria 22363
404 Ga0495682_0000001 3300049460 Bacteria 1559116
405 Ga0501032_0001566 3300049569 Bacteria 18242
406 Ga0501032_0036987 3300049569 Bacteria 3330
407 Ga0501032_0117289 3300049569 Bacteria 1760
408 Ga0501033_0021816 3300049570 Bacteria 4832
409 Ga0501034_0000075 3300049571 Bacteria 175296
410 Ga0501034_0001007 3300049571 Bacteria 40401
411 Ga0501034_0062104 3300049571 Bacteria 3751
412 Ga0501034_0069253 3300049571 Bacteria 3539
413 Ga0501036_0001470 3300049572 Bacteria 18124
414 Ga0501036_0024253 3300049572 Bacteria 5113
415 Ga0501037_0109783 3300049573 Bacteria 1987
416 Ga0501038_0005410 3300049574 Bacteria 11870
417 Ga0501038_0026377 3300049574 Bacteria 5175
418 Ga0501043_0002005 3300049579 Bacteria 17378
419 Ga0501043_0017867 3300049579 Bacteria 5561
420 Ga0501043_0073885 3300049579 Bacteria 2678
421 Ga0501047_0005814 3300049581 Bacteria 11611
422 Ga0501047_0007876 3300049581 Bacteria 10044
423 Ga0501047_0093061 3300049581 Bacteria 2893
424 Ga0501070_0011531 3300049586 Bacteria 7462
425 Ga0501074_0000798 3300049590 Bacteria 19915
426 Ga0501235_031133 3300049669 Bacteria 1204
427 Ga0501238_000145 3300049671 Bacteria 10904
428 Ga0501241_000517 3300049758 Bacteria 8323
429 Ga0501280_000196 3300049776 Bacteria 15178
430 Ga0501035_0004496 3300049822 Bacteria 13231
431 Ga0501035_0029841 3300049822 Bacteria 4974
432 Ga0501044_0002168 3300049823 Bacteria 22515
433 Ga0501044_0007814 3300049823 Bacteria 11757
434 Ga0501044_0055641 3300049823 Bacteria 4062
435 Ga0501044_0072797 3300049823 Bacteria 3493
436 nmdc:mga00v17_2596_c1 3300050491 Bacteria 9262
437 nmdc:mga04h51_2012_c1 3300050495 Bacteria 4758
438 Ga0495619_0030831 3300053085 Bacteria 3472
439 Ga0500640_004894 3300053095 Bacteria 4920
440 Ga0500560_002698 3300053107 Bacteria 3450
441 Ga0500621_000002 3300053126 Bacteria 849473
442 Ga0500658_0000024 3300053134 Bacteria 117952
443 Ga0500658_0023596 3300053134 Bacteria 2350
444 Ga0500559_0012033 3300053136 Bacteria 3686
445 Ga0500564_038108 3300053138 Bacteria 2216
446 Ga0500568_0038161 3300053139 Bacteria 1945
447 Ga0500620_011558 3300053155 Bacteria 2372
448 Ga0500620_076056 3300053155 Bacteria 1159
449 Ga0500622_0000249 3300053156 Bacteria 54675
450 Ga0500661_004354 3300055283 Unclassified 2652
451 Ga0466962_0001800 3300061719 Bacteria 10079
452 Ga0466962_0028224 3300061719 Bacteria 2689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053155 Ga0500620_076056 Ga0500620_076056_17_1132 342
2 3300042015 Ga0439462_0006281 Ga0439462_0006281_1843_2928 360
3 3300047320 Ga0495672_0092023 Ga0495672_0092023_565_1650 360
4 3300049569 Ga0501032_0117289 Ga0501032_0117289_649_1743 360
5 3300048912 Ga0496109_0198258 Ga0496109_0198258_19_1119 362
6 3300041999 Ga0439433_0006640 Ga0439433_0006640_1283_2467 365
7 3300046694 Ga0495649_0046936 Ga0495649_0046936_1186_2307 372
8 3300049669 Ga0501235_031133 Ga0501235_031133_41_1168 374
9 3300017792 Ga0163161_10000164 Ga0163161_1000016434 375
10 3300046524 Ga0495648_0004181 Ga0495648_0004181_11_1162 383
11 3300046648 Ga0495611_0068315 Ga0495611_0068315_448_1602 384
12 3300048922 Ga0496119_0084299 Ga0496119_0084299_642_1802 384
13 3300046663 Ga0495635_0057845 Ga0495635_0057845_1356_2633 401
14 3300046454 Ga0495592_0026544 Ga0495592_0026544_1259_2545 404
15 3300046462 Ga0495651_0056599 Ga0495651_0056599_264_1550 404
16 3300046514 Ga0495618_0049327 Ga0495618_0049327_1360_2646 404
17 3300047444 Ga0495675_0024142 Ga0495675_0024142_1740_3026 404
18 3300046690 Ga0495624_0016482 Ga0495624_0016482_2165_3451 405
19 3300047322 Ga0495680_0006988 Ga0495680_0006988_1402_2688 405
20 3300044694 Ga0466963_0002165 Ga0466963_0002165_7923_9230 407
21 3300014497 Ga0182008_10001691 Ga0182008_100016913 410
22 3300015261 Ga0182006_1055550 Ga0182006_10555501 410
23 3300041999 Ga0439433_0002239 Ga0439433_0002239_2032_3267 410
24 3300042007 Ga0439449_0019001 Ga0439449_0019001_152_1387 410
25 3300042014 Ga0439457_000197 Ga0439457_000197_11199_12434 410
26 3300046455 Ga0495603_0018588 Ga0495603_0018588_1394_2749 410
27 3300046459 Ga0495629_0041470 Ga0495629_0041470_1775_3010 410
28 3300046694 Ga0495649_0067934 Ga0495649_0067934_518_1753 410
29 3300011119 Ga0105246_10003995 Ga0105246_100039956 412
30 3300046512 Ga0495610_0062455 Ga0495610_0062455_265_1599 412
31 3300049823 Ga0501044_0002168 Ga0501044_0002168_8892_10133 412
32 3300053134 Ga0500658_0023596 Ga0500658_0023596_275_1606 412
33 3300053155 Ga0500620_011558 Ga0500620_011558_604_1938 412
34 iso_pu_bacteria 2643221551 2643777263 412
35 iso_pu_bacteria 2643221555 2643795711 412
36 iso_pu_bacteria 2751185782 2753267976 412
37 iso_pu_bacteria 2862382967 2862387544 412
38 3300048919 Ga0496116_0000086 Ga0496116_0000086_45425_46714 413
39 3300048922 Ga0496119_0001168 Ga0496119_0001168_18091_19380 413
40 3300048923 Ga0496120_0000917 Ga0496120_0000917_5799_7088 413
41 3300031730 Ga0307516_10206490 Ga0307516_102064902 414
42 3300048929 Ga0496126_0020820 Ga0496126_0020820_2331_3659 414
43 3300015688 Ga0183367_1006 Ga0183367_1006264 415
44 3300025935 Ga0207709_10064625 Ga0207709_100646252 415
45 3300046455 Ga0495603_0025560 Ga0495603_0025560_1911_3188 415
46 3300046455 Ga0495603_0130224 Ga0495603_0130224_41_1318 415
47 3300046458 Ga0495591_000318 Ga0495591_000318_39534_40823 415
48 3300046459 Ga0495629_0043656 Ga0495629_0043656_180_1457 415
49 3300046475 Ga0495639_0018843 Ga0495639_0018843_564_1841 415
50 3300046476 Ga0495662_0010134 Ga0495662_0010134_629_1906 415
51 3300046499 Ga0495594_0015368 Ga0495594_0015368_2369_3646 415
52 3300046663 Ga0495635_0112200 Ga0495635_0112200_153_1430 415
53 3300046675 Ga0495657_0014539 Ga0495657_0014539_700_1977 415
54 3300047318 Ga0495636_0000508 Ga0495636_0000508_2349_3626 415
55 3300047444 Ga0495675_0020782 Ga0495675_0020782_2335_3615 415
56 iso_pu_bacteria 2582581313 2585309261 415
57 iso_pu_bacteria 2643221647 2644263273 415
58 iso_pu_bacteria 2643221678 2644436578 415
59 iso_pu_bacteria 2643221714 2644625586 415
60 iso_pu_bacteria 2784746768 2785368806 415
61 iso_pu_bacteria 2808606359 2808841471 415
62 iso_pu_bacteria 2808606375 2808920036 415
63 iso_pu_bacteria 2811994879 2812358776 415
64 iso_pu_bacteria 2852635781 2852641935 415
65 iso_pu_bacteria 2867428634 2867434895 415
66 iso_pu_bacteria 2877676314 2877681706 415
67 iso_pu_bacteria 2919468124 2919473524 415
68 iso_pu_bacteria 2946072368 2946075393 415
69 iso_pu_bacteria 2947224130 2947230141 415
70 iso_pu_bacteria 2954380949 2954386854 415
71 iso_pu_bacteria 2954691527 2954697674 415
72 iso_pu_bacteria 2954701450 2954704542 415
73 iso_pu_bacteria 2954711539 2954716809 415
74 iso_pu_bacteria 2954721474 2954726757 415
75 iso_pu_bacteria 2954731030 2954735039 415
76 iso_pu_bacteria 2954740390 2954745679 415
77 iso_pu_bacteria 2954749733 2954753910 415
78 iso_pu_bacteria 2954759201 2954764653 415
79 3300005347 Ga0070668_100031833 Ga0070668_1000318333 416
80 3300005843 Ga0068860_100096725 Ga0068860_1000967252 416
81 3300005844 Ga0068862_100150931 Ga0068862_1001509312 416
82 3300028380 Ga0268265_10083626 Ga0268265_100836262 416
83 3300028381 Ga0268264_10037949 Ga0268264_100379492 416
84 3300037418 Ga0395900_0073730 Ga0395900_0073730_760_2043 416
85 3300044683 Ga0466965_0000319 Ga0466965_0000319_3764_5038 416
86 3300044684 Ga0466966_0003509 Ga0466966_0003509_4722_5996 416
87 3300044693 Ga0466961_0003370 Ga0466961_0003370_4476_5750 416
88 3300044694 Ga0466963_0000410 Ga0466963_0000410_12725_13999 416
89 3300044706 Ga0466964_0002518 Ga0466964_0002518_3800_5074 416
90 3300044719 Ga0466971_0000916 Ga0466971_0000916_4473_5747 416
91 3300044765 Ga0466970_0001045 Ga0466970_0001045_8602_9876 416
92 3300044842 Ga0466957_0001204 Ga0466957_0001204_7986_9260 416
93 3300045049 Ga0466959_0005690 Ga0466959_0005690_3341_4615 416
94 3300045836 Ga0466958_0005059 Ga0466958_0005059_3341_4615 416
95 3300045976 Ga0466967_0002249 Ga0466967_0002249_6852_8126 416
96 3300045976 Ga0466967_0300016 Ga0466967_0300016_150_1433 416
97 3300049570 Ga0501033_0021816 Ga0501033_0021816_1420_2697 416
98 3300049822 Ga0501035_0029841 Ga0501035_0029841_2068_3345 416
99 3300049823 Ga0501044_0007814 Ga0501044_0007814_9973_11256 416
100 3300061719 Ga0466962_0001800 Ga0466962_0001800_4705_5979 416
101 3300061719 Ga0466962_0028224 Ga0466962_0028224_1365_2642 416
102 iso_pu_bacteria 2537561592 2537899477 416
103 iso_pu_bacteria 2554235005 2554258417 416
104 iso_pu_bacteria 2808606982 2811848421 416
105 iso_pu_bacteria 2818991442 2819577502 416
106 iso_pu_bacteria 2929239360 2929242594 416
107 iso_pu_bacteria 3006393351 3006397814 416
108 3300003323 rootH1_10013607 rootH1_100136071 417
109 3300005937 Ga0081455_10017897 Ga0081455_100178974 417
110 3300005983 Ga0081540_1018037 Ga0081540_10180372 417
111 3300006178 Ga0075367_10000578 Ga0075367_100005785 417
112 3300025297 Ga0209758_1004595 Ga0209758_10045953 417
113 3300030522 Ga0307512_10002642 Ga0307512_1000264213 417
114 3300031456 Ga0307513_10029380 Ga0307513_100293804 417
115 3300031507 Ga0307509_10104489 Ga0307509_101044893 417
116 3300031548 Ga0307408_100025838 Ga0307408_1000258383 417
117 3300031616 Ga0307508_10053295 Ga0307508_100532952 417
118 3300031649 Ga0307514_10001878 Ga0307514_1000187812 417
119 3300031730 Ga0307516_10004046 Ga0307516_1000404611 417
120 3300031995 Ga0307409_100206287 Ga0307409_1002062872 417
121 3300032002 Ga0307416_100021725 Ga0307416_1000217253 417
122 3300033179 Ga0307507_10157204 Ga0307507_101572042 417
123 3300037418 Ga0395900_0264439 Ga0395900_0264439_278_1555 417
124 3300041512 Ga0451853_0467392 Ga0451853_0467392_3456_4742 417
125 3300042002 Ga0439442_011592 Ga0439442_011592_92_1378 417
126 3300042007 Ga0439449_0010144 Ga0439449_0010144_406_1689 417
127 3300044658 Ga0466972_0004414 Ga0466972_0004414_55_1338 417
128 3300049571 Ga0501034_0062104 Ga0501034_0062104_229_1515 417
129 3300049574 Ga0501038_0005410 Ga0501038_0005410_895_2181 417
130 3300049581 Ga0501047_0007876 Ga0501047_0007876_2015_3301 417
131 3300049581 Ga0501047_0093061 Ga0501047_0093061_419_1705 417
132 3300049823 Ga0501044_0055641 Ga0501044_0055641_1032_2318 417
133 3300049823 Ga0501044_0072797 Ga0501044_0072797_356_1642 417
134 3300050495 nmdc:mga04h51_2012_c1 nmdc:mga04h51_2012_c1_18_1304 417
135 iso_pu_bacteria 2818991463 2819693499 417
136 iso_pu_bacteria 2849281842 2849284629 417
137 iso_pu_bacteria 2912715099 2912720671 417
138 iso_pu_bacteria 2946064051 2946067101 417
139 iso_pu_bacteria 2990059506 2990065585 417
140 iso_pu_bacteria 8008574985 8008579381 417
141 iso_pu_bacteria 8056829672 8056830242 417
142 3300017792 Ga0163161_10128046 Ga0163161_101280462 418
143 3300031456 Ga0307513_10121885 Ga0307513_101218852 418
144 3300031649 Ga0307514_10128783 Ga0307514_101287831 418
145 3300041512 Ga0451853_1828395 Ga0451853_1828395_1031_2311 418
146 3300046453 Ga0495627_016036 Ga0495627_016036_641_1927 418
147 3300046459 Ga0495629_0074193 Ga0495629_0074193_431_1711 418
148 3300046460 Ga0495638_0026710 Ga0495638_0026710_536_1822 418
149 3300046472 Ga0495580_0027812 Ga0495580_0027812_1492_2778 418
150 3300046474 Ga0495605_0040680 Ga0495605_0040680_226_1512 418
151 3300046501 Ga0495607_0062225 Ga0495607_0062225_311_1591 418
152 3300046507 Ga0495606_0027669 Ga0495606_0027669_2090_3376 418
153 3300046513 Ga0495616_0036265 Ga0495616_0036265_848_2134 418
154 3300046515 Ga0495620_0016985 Ga0495620_0016985_1034_2320 418
155 3300046515 Ga0495620_0028901 Ga0495620_0028901_43_1329 418
156 3300046520 Ga0495637_0018958 Ga0495637_0018958_1571_2857 418
157 3300046522 Ga0495643_0017796 Ga0495643_0017796_2649_3935 418
158 3300046524 Ga0495648_0043592 Ga0495648_0043592_1039_2325 418
159 3300046530 Ga0495654_0016590 Ga0495654_0016590_273_1559 418
160 3300046533 Ga0495640_0102063 Ga0495640_0102063_474_1760 418
161 3300046538 Ga0495609_0018516 Ga0495609_0018516_1091_2377 418
162 3300046542 Ga0495597_0023556 Ga0495597_0023556_86_1372 418
163 3300046559 Ga0495667_0165376 Ga0495667_0165376_50_1336 418
164 3300046616 Ga0495668_0017862 Ga0495668_0017862_1618_2904 418
165 3300046642 Ga0495634_0115747 Ga0495634_0115747_174_1460 418
166 3300046660 Ga0495625_0009187 Ga0495625_0009187_3476_4762 418
167 3300046660 Ga0495625_0059382 Ga0495625_0059382_852_2132 418
168 3300046660 Ga0495625_0158507 Ga0495625_0158507_65_1351 418
169 3300046694 Ga0495649_0025880 Ga0495649_0025880_1057_2343 418
170 3300047315 Ga0495581_0080760 Ga0495581_0080760_303_1589 418
171 3300047321 Ga0495676_0048061 Ga0495676_0048061_183_1469 418
172 3300047321 Ga0495676_0082625 Ga0495676_0082625_1050_2336 418
173 3300047470 Ga0495681_0035398 Ga0495681_0035398_560_1846 418
174 3300047472 Ga0495686_0095037 Ga0495686_0095037_438_1724 418
175 3300048927 Ga0496124_0110581 Ga0496124_0110581_264_1568 418
176 iso_pu_bacteria 2547132111 2547407001 418
177 iso_pu_bacteria 2616644814 2616697641 418
178 iso_pu_bacteria 2643221681 2644455716 418
179 iso_pu_bacteria 2738541302 2738855696 418
180 iso_pu_bacteria 2739367651 2739590587 418
181 iso_pu_bacteria 2784132148 2784588035 418
182 iso_pu_bacteria 2808606448 2809231635 418
183 iso_pu_bacteria 2818991437 2819549986 418
184 iso_pu_bacteria 2842722452 2842724892 418
185 iso_pu_bacteria 2842909656 2842913087 418
186 iso_pu_bacteria 2862178590 2862184737 418
187 iso_pu_bacteria 2862281513 2862287907 418
188 iso_pu_bacteria 2862574272 2862579818 418
189 iso_pu_bacteria 2884791551 2884792540 418
190 iso_pu_bacteria 2904445276 2904449366 418
191 iso_pu_bacteria 2912723979 2912724832 418
192 iso_pu_bacteria 2954016120 2954018717 418
193 iso_pu_bacteria 3006493962 3006496333 418
194 iso_pu_bacteria 8008558824 8008559765 418
195 iso_pu_bacteria 8023623736 8023631041 418
196 3300003761 Ga0055535_1003778 Ga0055535_10037782 419
197 3300003762 Ga0055542_1003577 Ga0055542_10035772 419
198 3300003781 Ga0055536_1000001 Ga0055536_1000001176 419
199 3300003791 Ga0055530_10005300 Ga0055530_100053002 419
200 3300009092 Ga0105250_10022598 Ga0105250_100225982 419
201 3300009551 Ga0105238_10172150 Ga0105238_101721502 419
202 3300015265 Ga0182005_1000153 Ga0182005_100015312 419
203 3300025242 Ga0209258_100145 Ga0209258_10014556 419
204 3300025254 Ga0209148_1000177 Ga0209148_100017794 419
205 3300025292 Ga0209676_1000008 Ga0209676_1000008683 419
206 3300025298 Ga0209050_1000045 Ga0209050_1000045102 419
207 3300025924 Ga0207694_10198630 Ga0207694_101986301 419
208 3300028786 Ga0307517_10012094 Ga0307517_100120942 419
209 3300028794 Ga0307515_10006210 Ga0307515_100062108 419
210 3300030521 Ga0307511_10000477 Ga0307511_1000047712 419
211 3300031507 Ga0307509_10008150 Ga0307509_100081503 419
212 3300033179 Ga0307507_10031590 Ga0307507_100315902 419
213 3300033179 Ga0307507_10066512 Ga0307507_100665123 419
214 3300033180 Ga0307510_10024274 Ga0307510_100242744 419
215 3300042134 Ga0450898_003379 Ga0450898_003379_536_1822 419
216 3300045976 Ga0466967_0252189 Ga0466967_0252189_87_1370 419
217 3300046454 Ga0495592_0001976 Ga0495592_0001976_11076_12359 419
218 3300046459 Ga0495629_0009575 Ga0495629_0009575_2369_3652 419
219 3300046473 Ga0495582_0020680 Ga0495582_0020680_2303_3586 419
220 3300046476 Ga0495662_0000971 Ga0495662_0000971_11244_12527 419
221 3300046477 Ga0495664_0000582 Ga0495664_0000582_14978_16261 419
222 3300046514 Ga0495618_0021816 Ga0495618_0021816_2265_3548 419
223 3300046516 Ga0495628_0056421 Ga0495628_0056421_86_1369 419
224 3300046529 Ga0495652_0027359 Ga0495652_0027359_2344_3627 419
225 3300046536 Ga0495587_0001380 Ga0495587_0001380_12437_13720 419
226 3300046642 Ga0495634_0000830 Ga0495634_0000830_14564_15847 419
227 3300046660 Ga0495625_0057999 Ga0495625_0057999_791_2074 419
228 3300046663 Ga0495635_0000558 Ga0495635_0000558_20886_22169 419
229 3300046674 Ga0495588_0009910 Ga0495588_0009910_1537_2820 419
230 3300046675 Ga0495657_0013733 Ga0495657_0013733_2079_3362 419
231 3300046678 Ga0495599_0092798 Ga0495599_0092798_467_1750 419
232 3300046680 Ga0495646_0000540 Ga0495646_0000540_1677_2960 419
233 3300046683 Ga0495658_0071995 Ga0495658_0071995_675_1958 419
234 3300046689 Ga0495613_0001710 Ga0495613_0001710_4960_6243 419
235 3300046692 Ga0495671_0002279 Ga0495671_0002279_1386_2669 419
236 3300047315 Ga0495581_0016468 Ga0495581_0016468_1376_2659 419
237 3300047317 Ga0495604_0006812 Ga0495604_0006812_5420_6703 419
238 3300047321 Ga0495676_0024438 Ga0495676_0024438_2399_3682 419
239 3300047323 Ga0495683_0051056 Ga0495683_0051056_50_1333 419
240 3300047443 Ga0495687_002174 Ga0495687_002174_3796_5079 419
241 3300047443 Ga0495687_002993 Ga0495687_002993_312_1595 419
242 3300047470 Ga0495681_0007136 Ga0495681_0007136_581_1864 419
243 3300047471 Ga0495684_0025460 Ga0495684_0025460_751_2034 419
244 3300047673 Ga0495593_0004506 Ga0495593_0004506_4372_5655 419
245 3300048088 Ga0495602_0005106 Ga0495602_0005106_11260_12543 419
246 3300048089 Ga0495614_0008313 Ga0495614_0008313_754_2037 419
247 3300048911 Ga0496108_0188897 Ga0496108_0188897_57_1349 419
248 3300049571 Ga0501034_0001007 Ga0501034_0001007_33742_35025 419
249 3300049571 Ga0501034_0069253 Ga0501034_0069253_809_2092 419
250 3300049572 Ga0501036_0001470 Ga0501036_0001470_1104_2387 419
251 3300049572 Ga0501036_0024253 Ga0501036_0024253_79_1362 419
252 3300049574 Ga0501038_0026377 Ga0501038_0026377_3237_4520 419
253 3300049579 Ga0501043_0002005 Ga0501043_0002005_3181_4464 419
254 3300049581 Ga0501047_0005814 Ga0501047_0005814_2425_3708 419
255 3300049590 Ga0501074_0000798 Ga0501074_0000798_2322_3605 419
256 3300049822 Ga0501035_0004496 Ga0501035_0004496_2054_3337 419
257 3300053085 Ga0495619_0030831 Ga0495619_0030831_1578_2861 419
258 3300053095 Ga0500640_004894 Ga0500640_004894_1152_2435 419
259 3300053107 Ga0500560_002698 Ga0500560_002698_1041_2324 419
260 3300055283 Ga0500661_004354 Ga0500661_004354_416_1708 419
261 iso_pu_bacteria 2582581314 2585319756 419
262 iso_pu_bacteria 2811994917 2812481070 419
263 iso_pu_bacteria 2842903701 2842904697 419
264 iso_pu_bacteria 2862507626 2862511533 419
265 iso_pu_bacteria 2929921140 2929922511 419
266 iso_pu_bacteria 8003151029 8003156388 419
267 3300002737 JGI25162J39368_1000258 JGI25162J39368_100025829 420
268 3300009545 Ga0105237_10004307 Ga0105237_100043072 420
269 3300009545 Ga0105237_10004581 Ga0105237_100045812 420
270 3300010375 Ga0105239_10000478 Ga0105239_1000047825 420
271 3300013104 Ga0157370_10002996 Ga0157370_1000299615 420
272 3300013306 Ga0163162_10213866 Ga0163162_102138661 420
273 3300025233 Ga0209437_100361 Ga0209437_10036114 420
274 3300025914 Ga0207671_10005027 Ga0207671_100050272 420
275 3300025914 Ga0207671_10006628 Ga0207671_100066283 420
276 3300025949 Ga0207667_10071873 Ga0207667_100718733 420
277 3300031548 Ga0307408_100008343 Ga0307408_1000083432 420
278 3300031852 Ga0307410_10075191 Ga0307410_100751912 420
279 3300031901 Ga0307406_10181130 Ga0307406_101811302 420
280 3300032004 Ga0307414_10034930 Ga0307414_100349303 420
281 3300041406 Ga0439439_0008890 Ga0439439_0008890_926_2368 420
282 3300041494 Ga0451837_0044792 Ga0451837_0044792_650_1942 420
283 3300041999 Ga0439433_0000053 Ga0439433_0000053_12384_13826 420
284 3300048905 Ga0496102_0023924 Ga0496102_0023924_2203_3570 420
285 3300048924 Ga0496121_0000011 Ga0496121_0000011_178470_179768 420
286 3300048925 Ga0496122_0001506 Ga0496122_0001506_14362_15672 420
287 3300048926 Ga0496123_0001997 Ga0496123_0001997_915_2225 420
288 3300048926 Ga0496123_0021922 Ga0496123_0021922_1987_3297 420
289 3300050491 nmdc:mga00v17_2596_c1 nmdc:mga00v17_2596_c1_3931_5247 420
290 3300053138 Ga0500564_038108 Ga0500564_038108_797_2086 420
291 iso_pu_bacteria 2802429296 2804845035 420
292 iso_pu_bacteria 8003856774 8003857624 420
293 iso_pu_bacteria 8025413630 8025418999 420
294 iso_pu_bacteria 8033684223 8033686913 420
295 iso_pu_bacteria 8055412473 8055414110 420
296 3300005288 Ga0065714_10006281 Ga0065714_100062812 421
297 3300005288 Ga0065714_10064459 Ga0065714_1006445933 421
298 3300013102 Ga0157371_10000021 Ga0157371_10000021259 421
299 3300013104 Ga0157370_10023681 Ga0157370_100236812 421
300 3300013105 Ga0157369_10000008 Ga0157369_1000000898 421
301 3300013306 Ga0163162_10000502 Ga0163162_1000050229 421
302 3300015261 Ga0182006_1000408 Ga0182006_10004088 421
303 3300015262 Ga0182007_10000003 Ga0182007_10000003165 421
304 3300015682 Ga0183373_1001 Ga0183373_1001804 421
305 3300017792 Ga0163161_10000219 Ga0163161_1000021931 421
306 3300031548 Ga0307408_100003548 Ga0307408_1000035485 421
307 3300031548 Ga0307408_100185848 Ga0307408_1001858482 421
308 3300031731 Ga0307405_10000032 Ga0307405_1000003210 421
309 3300031852 Ga0307410_10024906 Ga0307410_100249062 421
310 3300031903 Ga0307407_10025963 Ga0307407_100259632 421
311 3300031911 Ga0307412_10075047 Ga0307412_100750472 421
312 3300031995 Ga0307409_100016645 Ga0307409_1000166455 421
313 3300032002 Ga0307416_100048321 Ga0307416_1000483212 421
314 3300032002 Ga0307416_100065107 Ga0307416_1000651072 421
315 3300046507 Ga0495606_0048779 Ga0495606_0048779_561_1901 421
316 3300046512 Ga0495610_0000066 Ga0495610_0000066_82686_84026 421
317 3300046512 Ga0495610_0000150 Ga0495610_0000150_65875_67221 421
318 iso_pu_bacteria 2808606370 2808893906 421
319 iso_pu_bacteria 2856741275 2856747676 421
320 iso_pu_bacteria 2867302475 2867302533 421
321 iso_pu_bacteria 2891562705 2891565219 421
322 iso_pu_bacteria 2984576629 2984576681 421
323 iso_pu_bacteria 2990256926 2990258445 421
324 3300002738 JGI25154J39366_1000021 JGI25154J39366_100002165 422
325 3300003323 rootH1_10051261 rootH1_100512611 422
326 3300003794 Ga0055531_10000138 Ga0055531_1000013846 422
327 3300005262 Ga0065165_1004984 Ga0065165_10049844 422
328 3300009036 Ga0105244_10000319 Ga0105244_1000031914 422
329 3300010375 Ga0105239_10276013 Ga0105239_102760132 422
330 3300013307 Ga0157372_10003482 Ga0157372_100034829 422
331 3300013307 Ga0157372_10017301 Ga0157372_100173014 422
332 3300025246 Ga0209646_1000050 Ga0209646_1000050190 422
333 3300025250 Ga0209026_1000240 Ga0209026_100024018 422
334 3300025297 Ga0209758_1025897 Ga0209758_10258972 422
335 3300025302 Ga0207426_1000293 Ga0207426_100029378 422
336 3300025304 Ga0209257_1000001 Ga0209257_1000001377 422
337 3300025728 Ga0207655_1000030 Ga0207655_100003066 422
338 3300030731 Ga0316177_1045554 Ga0316177_10455544 422
339 3300030732 Ga0316176_1220125 Ga0316176_12201258 422
340 3300030744 Ga0316181_1278021 Ga0316181_12780212 422
341 3300031548 Ga0307408_100028204 Ga0307408_1000282043 422
342 3300031548 Ga0307408_100068269 Ga0307408_1000682693 422
343 3300031731 Ga0307405_10035535 Ga0307405_100355353 422
344 3300037466 Ga0395898_0099194 Ga0395898_0099194_1319_2659 422
345 3300037466 Ga0395898_0099820 Ga0395898_0099820_985_2346 422
346 3300038443 Ga0395901_0086921 Ga0395901_0086921_697_2037 422
347 3300042002 Ga0439442_000693 Ga0439442_000693_5545_6915 422
348 3300042006 Ga0439432_025935 Ga0439432_025935_330_1700 422
349 3300042146 Ga0450907_000088 Ga0450907_000088_384_1754 422
350 3300042435 Ga0439434_0000246 Ga0439434_0000246_12001_13371 422
351 3300048915 Ga0496112_0034536 Ga0496112_0034536_1163_2503 422
352 3300048919 Ga0496116_0014976 Ga0496116_0014976_4263_5555 422
353 3300048923 Ga0496120_0000028 Ga0496120_0000028_116716_118008 422
354 3300049569 Ga0501032_0036987 Ga0501032_0036987_1028_2368 422
355 3300049586 Ga0501070_0011531 Ga0501070_0011531_3048_4388 422
356 3300049758 Ga0501241_000517 Ga0501241_000517_4942_6270 422
357 3300053139 Ga0500568_0038161 Ga0500568_0038161_415_1749 422
358 3300053156 Ga0500622_0000249 Ga0500622_0000249_19408_20736 422
359 iso_pu_bacteria 2808606360 2808850828 422
360 iso_pu_bacteria 2867312974 2867314567 422
361 iso_pu_bacteria 2867319477 2867323393 422
362 iso_pu_bacteria 2867475112 2867479098 422
363 iso_pu_bacteria 2910809715 2910810399 422
364 iso_pu_bacteria 2945916053 2945916408 422
365 iso_pu_bacteria 2946059875 2946060208 422
366 iso_pu_bacteria 2997451912 2997454001 422
367 iso_pu_bacteria 8054160619 8054167223 422
368 3300003354 JGI25160J50197_1016147 JGI25160J50197_10161472 423
369 3300011119 Ga0105246_10033667 Ga0105246_100336673 423
370 3300013100 Ga0157373_10001546 Ga0157373_1000154613 423
371 3300025302 Ga0207426_1002867 Ga0207426_10028673 423
372 3300025302 Ga0207426_1016904 Ga0207426_10169042 423
373 3300031616 Ga0307508_10006664 Ga0307508_100066646 423
374 3300041999 Ga0439433_0004488 Ga0439433_0004488_477_1862 423
375 3300046538 Ga0495609_0010008 Ga0495609_0010008_2042_3385 423
376 iso_pu_bacteria 2919391150 2919391995 423
377 3300002773 JGI25152J39213_1000045 JGI25152J39213_100004554 424
378 3300003320 rootH2_10045220 rootH2_100452206 424
379 3300003322 rootL2_10027395 rootL2_100273956 424
380 3300009092 Ga0105250_10000007 Ga0105250_10000007120 424
381 3300009148 Ga0105243_10002478 Ga0105243_1000247811 424
382 3300011119 Ga0105246_10129955 Ga0105246_101299552 424
383 3300025258 Ga0209129_1000068 Ga0209129_1000068101 424
384 3300025294 Ga0209025_1000045 Ga0209025_1000045223 424
385 3300025303 Ga0209051_1004119 Ga0209051_10041193 424
386 3300025303 Ga0209051_1009516 Ga0209051_10095162 424
387 3300025315 Ga0207697_10002451 Ga0207697_100024514 424
388 3300025711 Ga0207696_1000029 Ga0207696_1000029156 424
389 3300025728 Ga0207655_1016409 Ga0207655_10164093 424
390 3300025935 Ga0207709_10016870 Ga0207709_100168702 424
391 3300025940 Ga0207691_10177831 Ga0207691_101778312 424
392 3300027907 Ga0207428_10036427 Ga0207428_100364272 424
393 3300031731 Ga0307405_10107398 Ga0307405_101073982 424
394 3300031852 Ga0307410_10212405 Ga0307410_102124052 424
395 3300031901 Ga0307406_10045849 Ga0307406_100458492 424
396 3300031911 Ga0307412_10004093 Ga0307412_100040933 424
397 3300031911 Ga0307412_10012753 Ga0307412_100127532 424
398 3300031995 Ga0307409_100014800 Ga0307409_1000148003 424
399 3300032004 Ga0307414_10149835 Ga0307414_101498352 424
400 3300032126 Ga0307415_100030434 Ga0307415_1000304342 424
401 3300037418 Ga0395900_0068666 Ga0395900_0068666_1303_2682 424
402 3300042007 Ga0439449_0003710 Ga0439449_0003710_754_2184 424
403 3300048906 Ga0496103_0018526 Ga0496103_0018526_415_1821 424
404 3300049569 Ga0501032_0001566 Ga0501032_0001566_159_1493 424
405 3300049571 Ga0501034_0000075 Ga0501034_0000075_124910_126244 424
406 3300049573 Ga0501037_0109783 Ga0501037_0109783_337_1680 424
407 3300049579 Ga0501043_0017867 Ga0501043_0017867_1510_2901 424
408 3300049579 Ga0501043_0073885 Ga0501043_0073885_228_1562 424
409 iso_pu_bacteria 2690315906 2691512400 424
410 iso_pu_bacteria 2844849076 2844851136 424
411 iso_pu_bacteria 2857740372 2857743087 424
412 iso_pu_bacteria 2904497146 2904497352 424
413 iso_pu_bacteria 2904776348 2904780003 424
414 iso_pu_bacteria 2919034639 2919038446 424
415 iso_pu_bacteria 2919538618 2919539990 424
416 iso_pu_bacteria 2932426870 2932428850 424
417 iso_pu_bacteria 2933418574 2933421787 424
418 iso_pu_bacteria 2939647034 2939647763 424
419 iso_pu_bacteria 2939674588 2939678198 424
420 iso_pu_bacteria 2945920336 2945923455 424
421 iso_pu_bacteria 2945956166 2945956754 424
422 iso_pu_bacteria 2946024296 2946024471 424
423 iso_pu_bacteria 2946037020 2946040821 424
424 iso_pu_bacteria 2953998280 2954002064 424
425 iso_pu_bacteria 2974302888 2974304372 424
426 iso_pu_bacteria 8054107350 8054111320 424
427 iso_pu_bacteria 2852103415 2852104518 425
428 3300003354 JGI25160J50197_1013124 JGI25160J50197_10131242 426
429 3300025302 Ga0207426_1000073 Ga0207426_10000739 426
430 3300048921 Ga0496118_0003468 Ga0496118_0003468_6530_7816 426
431 iso_pu_bacteria 2599185299 2599928124 426
432 iso_pu_bacteria 2643221600 2644008391 426
433 iso_pu_bacteria 2643221716 2644640168 426
434 iso_pu_bacteria 2648501693 2650900220 426
435 iso_pu_bacteria 2684622997 2686354459 426
436 iso_pu_bacteria 2808606414 2809124253 426
437 iso_pu_bacteria 2844528606 2844529947 426
438 iso_pu_bacteria 2846540461 2846544567 426
439 iso_pu_bacteria 2847797336 2847801312 426
440 iso_pu_bacteria 2857613821 2857614660 426
441 iso_pu_bacteria 2857618242 2857618266 426
442 iso_pu_bacteria 2865014394 2865018786 426
443 iso_pu_bacteria 2881609920 2881611197 426
444 iso_pu_bacteria 2904419702 2904419953 426
445 iso_pu_bacteria 2904555929 2904556748 426
446 iso_pu_bacteria 2919059106 2919063581 426
447 iso_pu_bacteria 2919191525 2919195475 426
448 iso_pu_bacteria 2945951305 2945956151 426
449 iso_pu_bacteria 2978975091 2978975181 426
450 iso_pu_bacteria 2984494565 2984498143 426
451 iso_pu_bacteria 2990261002 2990265159 426
452 iso_pu_bacteria 2904504865 2904506389 427
453 iso_pu_bacteria 2739367857 2740001002 428
454 iso_pu_bacteria 2739367858 2740005818 428
455 3300046471 Ga0495650_0000026 Ga0495650_0000026_424007_425296 429
456 3300046491 Ga0495584_0015385 Ga0495584_0015385_1261_2550 429
457 3300046501 Ga0495607_0012103 Ga0495607_0012103_2980_4269 429
458 3300046507 Ga0495606_0001190 Ga0495606_0001190_7335_8624 429
459 3300046523 Ga0495644_0018923 Ga0495644_0018923_881_2170 429
460 3300046524 Ga0495648_0005979 Ga0495648_0005979_2617_3906 429
461 3300046530 Ga0495654_0000069 Ga0495654_0000069_87780_89069 429
462 3300046692 Ga0495671_0012573 Ga0495671_0012573_1896_3185 429
463 3300046810 Ga0495660_0000016 Ga0495660_0000016_238666_239955 429
464 3300047320 Ga0495672_0000001 Ga0495672_0000001_468687_469976 429
465 3300047323 Ga0495683_0025686 Ga0495683_0025686_1224_2513 429
466 3300047469 Ga0495673_0000352 Ga0495673_0000352_9296_10585 429
467 3300049459 Ga0495678_001115 Ga0495678_001115_19859_21148 429
468 3300049460 Ga0495682_0000001 Ga0495682_0000001_630554_631843 429
469 3300053126 Ga0500621_000002 Ga0500621_000002_637271_638560 429
470 3300001989 JGI24739J22299_10000375 JGI24739J22299_100003758 430
471 3300002737 JGI25162J39368_1000009 JGI25162J39368_100000987 430
472 3300002771 JGI25163J39215_1000038 JGI25163J39215_100003827 430
473 3300002772 JGI25164J39214_1000002 JGI25164J39214_1000002258 430
474 3300003751 Ga0055538_1000015 Ga0055538_100001511 430
475 3300003752 Ga0055539_1000009 Ga0055539_1000009102 430
476 3300003756 Ga0055533_1000012 Ga0055533_1000012257 430
477 3300003759 Ga0055525_1000014 Ga0055525_1000014102 430
478 3300003841 Ga0055541_1000006 Ga0055541_1000006257 430
479 3300003856 Ga0058692_1000038 Ga0058692_100003866 430
480 3300003856 Ga0058692_1000103 Ga0058692_100010346 430
481 3300003856 Ga0058692_1003971 Ga0058692_10039713 430
482 3300005262 Ga0065165_1001877 Ga0065165_10018775 430
483 3300005289 Ga0065704_10000548 Ga0065704_100005488 430
484 3300005347 Ga0070668_100002334 Ga0070668_1000023343 430
485 3300009011 Ga0105251_10003091 Ga0105251_100030917 430
486 3300009011 Ga0105251_10046776 Ga0105251_100467762 430
487 3300009011 Ga0105251_10079361 Ga0105251_100793611 430
488 3300009036 Ga0105244_10000047 Ga0105244_1000004750 430
489 3300009036 Ga0105244_10001080 Ga0105244_100010809 430
490 3300009036 Ga0105244_10014383 Ga0105244_100143832 430
491 3300011119 Ga0105246_10016172 Ga0105246_100161723 430
492 3300013102 Ga0157371_10000008 Ga0157371_1000000850 430
493 3300013102 Ga0157371_10000766 Ga0157371_1000076616 430
494 3300013104 Ga0157370_10000075 Ga0157370_1000007576 430
495 3300013104 Ga0157370_10000276 Ga0157370_100002768 430
496 3300013105 Ga0157369_10023989 Ga0157369_100239894 430
497 3300013306 Ga0163162_10223642 Ga0163162_102236422 430
498 3300013307 Ga0157372_10008915 Ga0157372_100089152 430
499 3300013307 Ga0157372_10053107 Ga0157372_100531072 430
500 3300015261 Ga0182006_1001891 Ga0182006_10018919 430
501 3300017792 Ga0163161_10013759 Ga0163161_100137593 430
502 3300025207 Ga0209760_100040 Ga0209760_10004070 430
503 3300025224 Ga0209784_100001 Ga0209784_1000012141 430
504 3300025225 Ga0209566_100001 Ga0209566_1000012141 430
505 3300025226 Ga0209674_100002 Ga0209674_1000022141 430
506 3300025230 Ga0209563_100002 Ga0209563_100002676 430
507 3300025231 Ga0207427_100020 Ga0207427_100020100 430
508 3300025233 Ga0209437_100001 Ga0209437_100001676 430
509 3300025233 Ga0209437_100032 Ga0209437_10003227 430
510 3300025253 Ga0209677_100002 Ga0209677_100002676 430
511 3300025261 Ga0209233_1010218 Ga0209233_10102182 430
512 3300025711 Ga0207696_1000498 Ga0207696_100049819 430
513 3300025711 Ga0207696_1001476 Ga0207696_10014764 430
514 3300025728 Ga0207655_1001287 Ga0207655_100128720 430
515 3300025728 Ga0207655_1001970 Ga0207655_100197011 430
516 3300025735 Ga0207713_1000011 Ga0207713_100001179 430
517 3300025735 Ga0207713_1004736 Ga0207713_10047362 430
518 3300025735 Ga0207713_1011079 Ga0207713_10110794 430
519 3300027312 Ga0209371_1000034 Ga0209371_100003444 430
520 3300027312 Ga0209371_1000093 Ga0209371_100009370 430
521 3300027312 Ga0209371_1002919 Ga0209371_10029192 430
522 3300027312 Ga0209371_1002968 Ga0209371_10029687 430
523 3300030500 Ga0268256_1000043 Ga0268256_1000043281 430
524 3300030500 Ga0268256_1000081 Ga0268256_100008193 430
525 3300030500 Ga0268256_1000752 Ga0268256_100075219 430
526 3300030500 Ga0268256_1002629 Ga0268256_10026295 430
527 3300030500 Ga0268256_1027661 Ga0268256_10276611 430
528 3300031824 Ga0307413_10000107 Ga0307413_100001079 430
529 3300031852 Ga0307410_10002372 Ga0307410_100023725 430
530 3300031901 Ga0307406_10000003 Ga0307406_10000003155 430
531 3300031903 Ga0307407_10008580 Ga0307407_100085802 430
532 3300031911 Ga0307412_10063452 Ga0307412_100634522 430
533 3300032004 Ga0307414_10000001 Ga0307414_10000001900 430
534 3300032005 Ga0307411_10000001 Ga0307411_10000001739 430
535 3300041405 Ga0439438_003563 Ga0439438_003563_4047_5339 430
536 3300041407 Ga0439447_003550 Ga0439447_003550_3052_4344 430
537 3300041407 Ga0439447_017741 Ga0439447_017741_604_1896 430
538 3300041411 Ga0439466_0002667 Ga0439466_0002667_2275_3567 430
539 3300042006 Ga0439432_005694 Ga0439432_005694_649_1941 430
540 3300042010 Ga0439452_000004 Ga0439452_000004_536982_538274 430
541 3300042016 Ga0439463_012084 Ga0439463_012084_207_1499 430
542 3300046471 Ga0495650_0000148 Ga0495650_0000148_35008_36318 430
543 3300046492 Ga0495585_0029402 Ga0495585_0029402_1681_2973 430
544 3300046522 Ga0495643_0017202 Ga0495643_0017202_1960_3252 430
545 3300046558 Ga0495633_0000017 Ga0495633_0000017_44647_45981 430
546 3300046810 Ga0495660_0000046 Ga0495660_0000046_71109_72419 430
547 3300047320 Ga0495672_0000096 Ga0495672_0000096_115908_117200 430
548 3300047470 Ga0495681_0052656 Ga0495681_0052656_282_1574 430
549 3300048903 Ga0496100_0010304 Ga0496100_0010304_3670_4962 430
550 3300048905 Ga0496102_0020408 Ga0496102_0020408_4153_5445 430
551 3300048907 Ga0496104_0000869 Ga0496104_0000869_20437_21747 430
552 3300048908 Ga0496105_0013974 Ga0496105_0013974_3023_4315 430
553 3300048908 Ga0496105_0103453 Ga0496105_0103453_824_2131 430
554 3300048913 Ga0496110_0106922 Ga0496110_0106922_687_1979 430
555 3300048919 Ga0496116_0000162 Ga0496116_0000162_45148_46458 430
556 3300048919 Ga0496116_0000715 Ga0496116_0000715_25190_26482 430
557 3300048920 Ga0496117_0000017 Ga0496117_0000017_202045_203337 430
558 3300048920 Ga0496117_0002870 Ga0496117_0002870_19187_20479 430
559 3300048920 Ga0496117_0017601 Ga0496117_0017601_2820_4112 430
560 3300048921 Ga0496118_0000018 Ga0496118_0000018_202045_203337 430
561 3300048921 Ga0496118_0001909 Ga0496118_0001909_7642_8934 430
562 3300048921 Ga0496118_0006090 Ga0496118_0006090_11490_12800 430
563 3300048921 Ga0496118_0008283 Ga0496118_0008283_3212_4504 430
564 3300048922 Ga0496119_0000005 Ga0496119_0000005_86175_87482 430
565 3300048922 Ga0496119_0004892 Ga0496119_0004892_2838_4130 430
566 3300048923 Ga0496120_0000005 Ga0496120_0000005_126142_127449 430
567 3300048923 Ga0496120_0000010 Ga0496120_0000010_53868_55160 430
568 3300048923 Ga0496120_0015134 Ga0496120_0015134_2033_3343 430
569 3300048924 Ga0496121_0019814 Ga0496121_0019814_3543_4835 430
570 3300048925 Ga0496122_0000007 Ga0496122_0000007_64328_65638 430
571 3300048925 Ga0496122_0000779 Ga0496122_0000779_18958_20250 430
572 3300048926 Ga0496123_0000004 Ga0496123_0000004_711592_712902 430
573 3300048926 Ga0496123_0000185 Ga0496123_0000185_87125_88417 430
574 3300048927 Ga0496124_0000627 Ga0496124_0000627_29396_30688 430
575 3300048927 Ga0496124_0000749 Ga0496124_0000749_34866_36176 430
576 3300048927 Ga0496124_0005227 Ga0496124_0005227_11892_13184 430
577 3300048928 Ga0496125_0000013 Ga0496125_0000013_578040_579350 430
578 3300048929 Ga0496126_0001673 Ga0496126_0001673_12227_13537 430
579 3300049671 Ga0501238_000145 Ga0501238_000145_334_1665 430
580 3300049776 Ga0501280_000196 Ga0501280_000196_9554_10885 430
581 3300053134 Ga0500658_0000024 Ga0500658_0000024_82787_84118 430
582 3300053136 Ga0500559_0012033 Ga0500559_0012033_1302_2639 430
583 iso_pu_bacteria 2585427591 2585829683 430
584 iso_pu_bacteria 2585427592 2585834230 430
585 iso_pu_bacteria 2667528173 2671108938 430
586 iso_pu_bacteria 2904474040 2904477365 430
587 iso_pu_bacteria 2919150387 2919153533 430
588 iso_pu_bacteria 2927143783 2927144159 430
589 iso_pu_bacteria 8055693939 8055694573 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13434

Lys_Orn_oxgnase

L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase

16

353

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5o8p-assembly1.cif.gz_B the crystal structure of dfoa bound to fad, the desferrioxamine biosynthetic pathway cadaverine monooxygenase from the fire blight disease pathogen erwinia amylovora 0.9615 3 430
7us3-assembly1.cif.gz_B structure of putrescine n-hydroxylase involved complexed with nadp+ 0.9595 3 429
5o8p-assembly1.cif.gz_B the crystal structure of dfoa bound to fad, the desferrioxamine biosynthetic pathway cadaverine monooxygenase from the fire blight disease pathogen erwinia amylovora 0.9593 3 430
6xbb-assembly1.cif.gz_C crystal structure of streptomyces sviceus ssdesb in complex with nadp+ 0.9575 4 426
6xbb-assembly1.cif.gz_C crystal structure of streptomyces sviceus ssdesb in complex with nadp+ 0.9553 4 426
ID Description Score Start End Superfamily
4tlzA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8896 4 410 3.50.50.60
af_A0A0G2K6D5_23_292_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.8802 117 151 3.30.830.10
4tlzA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8714 4 410 3.50.50.60
3s61B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8627 4 409 3.50.50.60
5ckuA00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8615 1 409 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7X2SZ00-F1-model_v4 SidA/IucD/PvdA family monooxygenase 0.968 141 309 GO:0004497
AF-A0A7X9EMA0-F1-model_v4 deleted 0.9649 1 371
AF-A0A1W6B8H9-F1-model_v4 Alcaligin biosynthesis protein 0.9629 1 430 GO:0016491
AF-E5B9Q8-F1-model_v4 L-lysine 6-monooxygenase involved in desferrioxamine biosynthesis (EC 1.14.13.59) 0.9614 1 430 GO:0047091
AF-A0A1A9HXP3-F1-model_v4 Alcaligin biosynthesis protein 0.9612 2 428 GO:0016491

Feature Viewer

pLDDT pTM Quality
85.91 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map