F466797

General Info

Members Datasets Scaffolds Average Seq Length
588 434 1176 376

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0015178|Ga0466965_0015178_1902_3215
Length 437
Sequence MRCIAADALYFGAVSRVQKVQNGLRASVTSFNNTGAPHFMSGLRARSACVAMMLAALAPLLAGCDESSSAVSSAPPSDPDVSIVIVKPQPRAVVRELPGRIAPTRVSDVRPRVSGIVVERLFRQGSEVKAGDPLYRIDPRPFEVEVLAQQAAVAKAEAALMQAKQQAHRIATLTKDRAAPEAENEKAIAAERQAHADVEGRKADLARAKLNLDYATVRAPIDGVVGAALVSEGALVVQNETNLASIQQLDPIYADFTQSVTELNQLRRAFETGDLERIASDAAKVRLVLDDNTTYALDGKLLFSDAKVDAHTGQVTLRGEFPNPKRELLPGMYVRVRIDQGLDSDAIAVPQQAIQRNGGXXSEVFVVKDDNHIAVQAVRTGSVQDGLWFVTEGLKAGDKVVVEGFQKFAAGDKVKPQSWSEADATADNRHAAQQLTR

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
65 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
66 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
67 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
68 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
103 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
104 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
105 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
106 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
107 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
116 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
135 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
141 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
142 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
143 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
144 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
152 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
153 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
154 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
155 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
174 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
177 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
212 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
213 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
221 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
222 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
223 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
224 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
225 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
229 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
230 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
231 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
232 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
233 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
234 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
235 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
236 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
237 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
238 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
239 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
240 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
241 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
242 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
243 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
244 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
245 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
246 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
247 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
248 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
249 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
252 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
253 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
254 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
255 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
256 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
257 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
258 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
259 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
260 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
261 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
262 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
263 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
264 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
265 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
266 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
267 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
268 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
269 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
270 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
271 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
272 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
273 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
274 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
275 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
276 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
277 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
278 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
279 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
280 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
281 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
282 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
283 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
284 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
285 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
286 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
287 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
288 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
289 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
290 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
291 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
292 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
293 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
294 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
295 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
296 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
297 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
298 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
299 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
300 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
301 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
302 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
303 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
304 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
305 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
306 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
307 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
308 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
309 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
310 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
311 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
312 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
313 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
314 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
315 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
316 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
317 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
318 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
319 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
320 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
321 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
322 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
323 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
324 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
325 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
326 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
327 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
328 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
329 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
330 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
331 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
332 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
333 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
334 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
335 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
336 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
337 2922368715
338 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
339 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
340 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
341 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
342 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
343 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
344 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
345 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
346 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
347 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
348 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
349 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
350 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
351 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
352 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
353 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
354 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
355 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
356 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
357 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
358 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
359 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
360 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
361 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
362 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
363 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
364 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
365 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
366 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
367 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
368 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
369 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
370 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
371 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
372 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
373 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
374 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
375 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
376 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
377 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
378 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
379 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
380 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
381 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
382 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
383 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
384 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
385 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
386 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
387 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
388 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
389 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
390 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
391 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
392 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
393 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
394 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
395 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
396 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
397 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
398 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
399 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
400 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
401 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
402 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
403 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
404 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
405 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
406 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
407 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
408 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
409 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
410 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
411 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
412 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
413 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
414 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
415 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
416 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
417 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
418 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
419 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
420 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
421 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
422 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
423 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
424 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
425 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
426 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
427 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
428 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
429 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
430 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
431 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
432 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
433 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
434 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69.51
Metatranscriptomes 0
Isolates 30.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.76
Nodule 24.66
Rhizoplane 6.97
Rhizosphere 43.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0015178 3300044683 Bacteria 3658
2 JGI24739J22299_10043505 3300001989 Bacteria 1485
3 JGI25406J46586_10000061 3300003203 Bacteria 49973
4 JGI25406J46586_10002926 3300003203 Bacteria 8053
5 JGI25153J46596_10007329 3300003215 Bacteria 5446
6 JGI25153J46596_10007506 3300003215 Bacteria 5345
7 JGI25153J46596_10009158 3300003215 Bacteria 4637
8 JGI25153J46596_10009708 3300003215 Bacteria 4430
9 rootH1_10059455 3300003323 Bacteria 2739
10 JGI25160J50197_1004274 3300003354 Bacteria 6197
11 Ga0055531_10005976 3300003794 Bacteria 6994
12 Ga0055543_1002065 3300004625 Bacteria 7017
13 Ga0065165_1006941 3300005262 Bacteria 5744
14 Ga0065165_1008326 3300005262 Bacteria 4878
15 Ga0065165_1009278 3300005262 Bacteria 4435
16 Ga0070683_100046439 3300005329 Bacteria 4012
17 Ga0070670_100060523 3300005331 Bacteria 3251
18 Ga0070682_100029609 3300005337 Bacteria 3298
19 Ga0068868_100209437 3300005338 Bacteria 1629
20 Ga0070659_100154129 3300005366 Bacteria 1875
21 Ga0070709_10018793 3300005434 Bacteria 3988
22 Ga0070709_10077841 3300005434 Bacteria 2157
23 Ga0070710_10011154 3300005437 Bacteria 4433
24 Ga0070711_100003965 3300005439 Bacteria 8698
25 Ga0070711_100193728 3300005439 Bacteria 1564
26 Ga0070711_100208074 3300005439 Bacteria 1513
27 Ga0070663_100023707 3300005455 Bacteria 4117
28 Ga0070663_100053468 3300005455 Bacteria 2883
29 Ga0070663_100240534 3300005455 Bacteria 1428
30 Ga0070678_100207328 3300005456 Bacteria 1622
31 Ga0070662_100087163 3300005457 Bacteria 2337
32 Ga0070681_10072265 3300005458 Bacteria 3413
33 Ga0070681_10109887 3300005458 Bacteria 2697
34 Ga0070706_100151771 3300005467 Bacteria 2162
35 Ga0070707_100055536 3300005468 Bacteria 3796
36 Ga0070679_100031394 3300005530 Bacteria 5247
37 Ga0070679_100076837 3300005530 Bacteria 3328
38 Ga0070684_100006601 3300005535 Bacteria 8987
39 Ga0070684_100353629 3300005535 Bacteria 1351
40 Ga0068853_100084286 3300005539 Bacteria 2785
41 Ga0068853_100193324 3300005539 Bacteria 1849
42 Ga0068853_100204287 3300005539 Bacteria 1799
43 Ga0070665_100058573 3300005548 Bacteria 3861
44 Ga0070665_100085548 3300005548 Bacteria 3159
45 Ga0068855_100096919 3300005563 Bacteria 3397
46 Ga0068855_100366805 3300005563 Bacteria 1584
47 Ga0070664_100167293 3300005564 Bacteria 1949
48 Ga0068857_100029286 3300005577 Bacteria 4859
49 Ga0068857_100118821 3300005577 Bacteria 2379
50 Ga0068854_100209216 3300005578 Bacteria 1538
51 Ga0068856_100124878 3300005614 Bacteria 2576
52 Ga0068856_100206869 3300005614 Bacteria 1977
53 Ga0068852_100013221 3300005616 Bacteria 6309
54 Ga0068864_100054928 3300005618 Bacteria 3437
55 Ga0068858_100073291 3300005842 Bacteria 3179
56 Ga0068858_100374944 3300005842 Bacteria 1365
57 Ga0081455_10002701 3300005937 Bacteria 20939
58 Ga0081455_10005942 3300005937 Bacteria 13249
59 Ga0081455_10034626 3300005937 Bacteria 4523
60 Ga0081455_10036437 3300005937 Bacteria 4380
61 Ga0081455_10163638 3300005937 Bacteria 1702
62 Ga0081540_1002550 3300005983 Bacteria 14780
63 Ga0081540_1036707 3300005983 Bacteria 2609
64 Ga0081540_1040383 3300005983 Bacteria 2433
65 Ga0081539_10000950 3300005985 Bacteria 54335
66 Ga0081539_10001094 3300005985 Bacteria 49286
67 Ga0081539_10032112 3300005985 Bacteria 3221
68 Ga0075365_10032443 3300006038 Bacteria 3357
69 Ga0070712_100027483 3300006175 Bacteria 3800
70 Ga0075366_10033931 3300006195 Bacteria 3007
71 Ga0075370_10015462 3300006353 Bacteria 4087
72 Ga0075434_100006415 3300006871 Bacteria 10779
73 Ga0075436_100068171 3300006914 Bacteria 2458
74 Ga0099825_1024210 3300006941 Bacteria 3590
75 Ga0105240_10013649 3300009093 Bacteria 11142
76 Ga0105240_10032873 3300009093 Bacteria 6708
77 Ga0105245_10058858 3300009098 Bacteria 3459
78 Ga0105247_10025446 3300009101 Bacteria 3570
79 Ga0105241_10173850 3300009174 Bacteria 1781
80 Ga0105237_10336487 3300009545 Bacteria 1514
81 Ga0105238_10098522 3300009551 Bacteria 2907
82 Ga0105238_10317484 3300009551 Bacteria 1543
83 Ga0105239_10204927 3300010375 Bacteria 2210
84 Ga0105246_10012111 3300011119 Bacteria 5374
85 Ga0105246_10046848 3300011119 Bacteria 2950
86 Ga0157370_10099297 3300013104 Bacteria 2729
87 Ga0157369_10001922 3300013105 Bacteria 25071
88 Ga0157369_10017723 3300013105 Bacteria 7998
89 Ga0157374_10037204 3300013296 Bacteria 4465
90 Ga0157378_10031719 3300013297 Bacteria 4667
91 Ga0163162_10064953 3300013306 Bacteria 3695
92 Ga0163162_10161348 3300013306 Bacteria 2363
93 Ga0157372_10045208 3300013307 Bacteria 4883
94 Ga0157372_10536336 3300013307 Bacteria 1364
95 Ga0157375_10008290 3300013308 Bacteria 9102
96 Ga0163163_10026416 3300014325 Bacteria 5550
97 Ga0163163_10031857 3300014325 Bacteria 5092
98 Ga0163163_10050608 3300014325 Bacteria 4091
99 Ga0157377_10023326 3300014745 Bacteria 3278
100 Ga0157376_10006879 3300014969 Bacteria 8051
101 Ga0214544_1000011 3300021320 Bacteria 262952
102 Ga0214542_1000009 3300021321 Bacteria 262861
103 Ga0214545_1000007 3300021324 Bacteria 262984
104 Ga0214543_1000020 3300021327 Bacteria 262861
105 Ga0209563_102279 3300025230 Bacteria 4420
106 Ga0209677_102371 3300025253 Bacteria 7197
107 Ga0209564_1003334 3300025295 Bacteria 11152
108 Ga0209564_1014649 3300025295 Bacteria 3243
109 Ga0209758_1000206 3300025297 Bacteria 130177
110 Ga0209758_1002220 3300025297 Bacteria 20194
111 Ga0209758_1005133 3300025297 Bacteria 10339
112 Ga0209758_1006073 3300025297 Bacteria 8893
113 Ga0209758_1010714 3300025297 Bacteria 5441
114 Ga0209758_1032722 3300025297 Bacteria 2104
115 Ga0209256_1004119 3300025299 Bacteria 9413
116 Ga0207426_1000644 3300025302 Bacteria 43409
117 Ga0207426_1001144 3300025302 Bacteria 23895
118 Ga0207426_1015608 3300025302 Bacteria 2751
119 Ga0207426_1018741 3300025302 Bacteria 2434
120 Ga0207426_1024489 3300025302 Bacteria 2047
121 Ga0209257_1015135 3300025304 Bacteria 3242
122 Ga0207692_10005728 3300025898 Bacteria 4995
123 Ga0207692_10015547 3300025898 Bacteria 3351
124 Ga0207688_10122697 3300025901 Bacteria 1517
125 Ga0207699_10018595 3300025906 Bacteria 3685
126 Ga0207699_10037828 3300025906 Bacteria 2761
127 Ga0207684_10119018 3300025910 Bacteria 2264
128 Ga0207707_10000597 3300025912 Bacteria 36412
129 Ga0207707_10104419 3300025912 Bacteria 2476
130 Ga0207707_10125059 3300025912 Bacteria 2249
131 Ga0207695_10000006 3300025913 Bacteria 1135309
132 Ga0207695_10069569 3300025913 Bacteria 3601
133 Ga0207695_10074723 3300025913 Bacteria 3450
134 Ga0207671_10003789 3300025914 Bacteria 14844
135 Ga0207671_10111631 3300025914 Bacteria 2080
136 Ga0207693_10004165 3300025915 Bacteria 12271
137 Ga0207663_10031936 3300025916 Bacteria 3121
138 Ga0207663_10038130 3300025916 Bacteria 2902
139 Ga0207660_10162269 3300025917 Bacteria 1725
140 Ga0207652_10046582 3300025921 Bacteria 3700
141 Ga0207694_10039255 3300025924 Bacteria 3643
142 Ga0207694_10186792 3300025924 Bacteria 1682
143 Ga0207650_10165294 3300025925 Bacteria 1756
144 Ga0207687_10102774 3300025927 Bacteria 2106
145 Ga0207664_10029582 3300025929 Bacteria 4174
146 Ga0207706_10115165 3300025933 Bacteria 2364
147 Ga0207706_10363246 3300025933 Bacteria 1258
148 Ga0207709_10030034 3300025935 Bacteria 3158
149 Ga0207691_10163435 3300025940 Bacteria 1952
150 Ga0207661_10010641 3300025944 Bacteria 6628
151 Ga0207661_10015685 3300025944 Bacteria 5581
152 Ga0207640_10192092 3300025981 Bacteria 1540
153 Ga0207703_10111631 3300026035 Bacteria 2334
154 Ga0207639_10088336 3300026041 Bacteria 2473
155 Ga0207639_10091210 3300026041 Bacteria 2439
156 Ga0207678_10039029 3300026067 Bacteria 4122
157 Ga0207678_10045255 3300026067 Bacteria 3806
158 Ga0207678_10109863 3300026067 Bacteria 2352
159 Ga0207641_10058908 3300026088 Bacteria 3270
160 Ga0207641_10321437 3300026088 Bacteria 1468
161 Ga0207674_10061330 3300026116 Bacteria 3800
162 Ga0207674_10104737 3300026116 Bacteria 2807
163 Ga0207683_10050528 3300026121 Bacteria 3642
164 Ga0207698_10284537 3300026142 Bacteria 1531
165 Ga0209389_1000034 3300027296 Bacteria 127289
166 Ga0209389_1000039 3300027296 Bacteria 124545
167 Ga0209589_1000038 3300027357 Bacteria 127285
168 Ga0209489_100023 3300027361 Bacteria 198829
169 Ga0209489_100087 3300027361 Bacteria 124545
170 Ga0209700_100090 3300027363 Bacteria 124545
171 Ga0209813_10012099 3300027866 Bacteria 2271
172 Ga0268266_10061980 3300028379 Bacteria 3226
173 Ga0268266_10101786 3300028379 Bacteria 2533
174 Ga0307517_10003697 3300028786 Bacteria 23771
175 Ga0307515_10091152 3300028794 Bacteria 3812
176 Ga0307513_10082990 3300031456 Bacteria 3297
177 Ga0265314_10007325 3300031711 Bacteria 9581
178 Ga0307405_10179045 3300031731 Bacteria 1520
179 Ga0307510_10032063 3300033180 Bacteria 5927
180 Ga0373926_0008027 3300035083 Bacteria 3517
181 Ga0373934_0033191 3300035086 Bacteria 2026
182 Ga0373934_0084044 3300035086 Bacteria 1280
183 Ga0373944_0016823 3300035089 Bacteria 2068
184 Ga0373943_0026320 3300035170 Bacteria 2724
185 Ga0373946_0001304 3300035171 Bacteria 8625
186 Ga0373955_0015191 3300035172 Bacteria 3764
187 Ga0373924_0005630 3300035410 Bacteria 4441
188 Ga0373935_0000150 3300035692 Bacteria 32035
189 Ga0373927_0000849 3300035695 Bacteria 23310
190 Ga0373927_0058450 3300035695 Bacteria 2494
191 Ga0373947_0002265 3300035725 Bacteria 11625
192 Ga0373925_0003962 3300037068 Bacteria 11287
193 Ga0373925_0018790 3300037068 Bacteria 5023
194 Ga0395900_0002138 3300037418 Bacteria 22118
195 Ga0395900_0064833 3300037418 Bacteria 3753
196 Ga0395898_0011071 3300037466 Bacteria 9393
197 Ga0395898_0070075 3300037466 Bacteria 3391
198 Ga0395898_0074589 3300037466 Bacteria 3277
199 Ga0395905_0021013 3300037471 Bacteria 6181
200 Ga0395905_0031619 3300037471 Bacteria 4981
201 Ga0395901_0054161 3300038443 Bacteria 4169
202 Ga0395901_0074079 3300038443 Bacteria 3552
203 Ga0395901_0215195 3300038443 Bacteria 2010
204 Ga0436365_1589836 3300039437 Bacteria 3362
205 Ga0466972_0000053 3300044658 Bacteria 112876
206 Ga0466972_0001271 3300044658 Bacteria 12177
207 Ga0466965_0117073 3300044683 Bacteria 1373
208 Ga0466966_0000488 3300044684 Bacteria 25462
209 Ga0466961_0000025 3300044693 Bacteria 96344
210 Ga0466961_0055373 3300044693 Bacteria 2529
211 Ga0466963_0064045 3300044694 Bacteria 2462
212 Ga0466964_0025967 3300044706 Bacteria 2290
213 Ga0466964_0049870 3300044706 Bacteria 1715
214 Ga0466968_0015700 3300044735 Bacteria 3006
215 Ga0466968_0088505 3300044735 Bacteria 1369
216 Ga0466957_0111923 3300044842 Bacteria 1732
217 Ga0466960_0047270 3300044901 Bacteria 2063
218 Ga0466959_0016959 3300045049 Bacteria 5331
219 Ga0495592_0021938 3300046454 Bacteria 4859
220 Ga0495592_0073873 3300046454 Bacteria 2478
221 Ga0495603_0001788 3300046455 Bacteria 12687
222 Ga0495629_0003196 3300046459 Bacteria 12401
223 Ga0495629_0022212 3300046459 Bacteria 4525
224 Ga0495629_0039767 3300046459 Bacteria 3309
225 Ga0495641_0001278 3300046461 Bacteria 21607
226 Ga0495651_0085797 3300046462 Bacteria 2370
227 Ga0495653_0146781 3300046463 Bacteria 1652
228 Ga0495580_0000235 3300046472 Bacteria 43597
229 Ga0495580_0081280 3300046472 Bacteria 2258
230 Ga0495582_0000357 3300046473 Bacteria 24964
231 Ga0495605_0046548 3300046474 Bacteria 2132
232 Ga0495639_0037693 3300046475 Bacteria 2168
233 Ga0495639_0044547 3300046475 Bacteria 2005
234 Ga0495662_0000109 3300046476 Bacteria 30711
235 Ga0495662_0007117 3300046476 Bacteria 5550
236 Ga0495664_0037024 3300046477 Bacteria 2878
237 Ga0495594_0000190 3300046499 Bacteria 29942
238 Ga0495606_0001194 3300046507 Bacteria 36568
239 Ga0495606_0170293 3300046507 Bacteria 1264
240 Ga0495608_0066583 3300046511 Bacteria 2358
241 Ga0495608_0066934 3300046511 Bacteria 2351
242 Ga0495618_0106787 3300046514 Bacteria 1793
243 Ga0495628_0041344 3300046516 Bacteria 3680
244 Ga0495630_0115578 3300046517 Bacteria 2033
245 Ga0495643_0015710 3300046522 Bacteria 4465
246 Ga0495648_0089596 3300046524 Bacteria 1726
247 Ga0495666_0025805 3300046526 Bacteria 2901
248 Ga0495666_0036661 3300046526 Bacteria 2388
249 Ga0495652_0024779 3300046529 Bacteria 5309
250 Ga0495652_0041524 3300046529 Bacteria 3970
251 Ga0495652_0073221 3300046529 Bacteria 2853
252 Ga0495665_0000082 3300046531 Bacteria 41861
253 Ga0495665_0132917 3300046531 Bacteria 1302
254 Ga0495640_0000178 3300046533 Bacteria 41951
255 Ga0495587_0035144 3300046536 Bacteria 3020
256 Ga0495645_0064949 3300046543 Bacteria 2640
257 Ga0495645_0175860 3300046543 Bacteria 1470
258 Ga0495622_0005081 3300046557 Bacteria 6097
259 Ga0495667_0004636 3300046559 Bacteria 9296
260 Ga0495634_0000680 3300046642 Bacteria 33027
261 Ga0495634_0022298 3300046642 Bacteria 4462
262 Ga0495625_0108209 3300046660 Bacteria 1902
263 Ga0495635_0000908 3300046663 Bacteria 19418
264 Ga0495635_0005707 3300046663 Bacteria 8672
265 Ga0495588_0006664 3300046674 Bacteria 5216
266 Ga0495657_0010355 3300046675 Bacteria 7017
267 Ga0495657_0038369 3300046675 Bacteria 3296
268 Ga0495599_0075718 3300046678 Bacteria 2101
269 Ga0495623_0085560 3300046679 Bacteria 1944
270 Ga0495646_0014282 3300046680 Bacteria 5052
271 Ga0495646_0032806 3300046680 Bacteria 3230
272 Ga0495646_0091233 3300046680 Bacteria 1758
273 Ga0495658_0000329 3300046683 Bacteria 26513
274 Ga0495613_0003140 3300046689 Bacteria 12372
275 Ga0495624_0001433 3300046690 Bacteria 18540
276 Ga0495624_0018936 3300046690 Bacteria 4600
277 Ga0495649_0029084 3300046694 Bacteria 3060
278 Ga0495600_0066729 3300046809 Bacteria 2352
279 Ga0495581_0000006 3300047315 Bacteria 77433
280 Ga0495581_0020268 3300047315 Bacteria 3860
281 Ga0495604_0146503 3300047317 Bacteria 1682
282 Ga0495674_0000380 3300047319 Bacteria 39781
283 Ga0495674_0035652 3300047319 Bacteria 4486
284 Ga0495672_0025149 3300047320 Bacteria 3818
285 Ga0495672_0075178 3300047320 Bacteria 1900
286 Ga0495676_0026290 3300047321 Bacteria 5013
287 Ga0495676_0039229 3300047321 Bacteria 3925
288 Ga0495680_0008895 3300047322 Bacteria 9079
289 Ga0495680_0038062 3300047322 Bacteria 3848
290 Ga0495687_009988 3300047443 Bacteria 5246
291 Ga0495687_067780 3300047443 Bacteria 1443
292 Ga0495675_0013085 3300047444 Bacteria 5234
293 Ga0495684_0005148 3300047471 Bacteria 10195
294 Ga0495684_0007364 3300047471 Bacteria 8531
295 Ga0495686_0015532 3300047472 Bacteria 5193
296 Ga0495593_0000032 3300047673 Bacteria 58862
297 Ga0495614_0006398 3300048089 Bacteria 5287
298 Ga0495614_0061418 3300048089 Bacteria 1615
299 Ga0496100_0005476 3300048903 Bacteria 6842
300 Ga0496100_0134169 3300048903 Bacteria 1747
301 Ga0496100_0205404 3300048903 Bacteria 1438
302 Ga0496101_0095652 3300048904 Bacteria 2216
303 Ga0496101_0145036 3300048904 Bacteria 1812
304 Ga0496101_0157840 3300048904 Bacteria 1738
305 Ga0496102_0000516 3300048905 Bacteria 42168
306 Ga0496102_0031358 3300048905 Bacteria 4768
307 Ga0496102_0045623 3300048905 Bacteria 3979
308 Ga0496102_0106181 3300048905 Bacteria 2613
309 Ga0496102_0129892 3300048905 Bacteria 2357
310 Ga0496104_0034166 3300048907 Bacteria 4739
311 Ga0496104_0036610 3300048907 Bacteria 4588
312 Ga0496105_0016393 3300048908 Bacteria 5915
313 Ga0496105_0033849 3300048908 Bacteria 4199
314 Ga0496105_0068202 3300048908 Bacteria 2938
315 Ga0496105_0079714 3300048908 Bacteria 2704
316 Ga0496106_0011725 3300048909 Bacteria 6471
317 Ga0496106_0014239 3300048909 Bacteria 5874
318 Ga0496106_0112160 3300048909 Bacteria 2124
319 Ga0496107_0034927 3300048910 Bacteria 3603
320 Ga0496107_0042205 3300048910 Bacteria 3276
321 Ga0496107_0191424 3300048910 Bacteria 1520
322 Ga0496108_0000299 3300048911 Bacteria 42536
323 Ga0496108_0085546 3300048911 Bacteria 2677
324 Ga0496108_0193677 3300048911 Bacteria 1762
325 Ga0496109_0000928 3300048912 Bacteria 24278
326 Ga0496109_0070417 3300048912 Bacteria 3209
327 Ga0496110_0047359 3300048913 Bacteria 3764
328 Ga0496111_0053401 3300048914 Bacteria 2920
329 Ga0496111_0059374 3300048914 Bacteria 2771
330 Ga0496112_0055718 3300048915 Bacteria 3888
331 Ga0496112_0079130 3300048915 Bacteria 3251
332 Ga0496112_0204609 3300048915 Bacteria 1932
333 Ga0496113_0010200 3300048916 Bacteria 6202
334 Ga0496113_0012830 3300048916 Bacteria 5648
335 Ga0496113_0241323 3300048916 Bacteria 1442
336 Ga0496114_0047735 3300048917 Bacteria 3561
337 Ga0496115_0002544 3300048918 Bacteria 13113
338 Ga0496115_0070095 3300048918 Bacteria 2841
339 Ga0496115_0244438 3300048918 Bacteria 1479
340 Ga0496116_0019027 3300048919 Bacteria 5274
341 Ga0496119_0021269 3300048922 Bacteria 4695
342 Ga0496120_0010635 3300048923 Bacteria 6397
343 Ga0496120_0078825 3300048923 Bacteria 1789
344 Ga0496121_0000265 3300048924 Bacteria 109251
345 Ga0496121_0019149 3300048924 Bacteria 6861
346 Ga0496121_0032003 3300048924 Bacteria 4791
347 Ga0496121_0035327 3300048924 Bacteria 4482
348 Ga0496121_0053675 3300048924 Bacteria 3375
349 Ga0496122_0095484 3300048925 Bacteria 2009
350 Ga0496124_0020611 3300048927 Bacteria 6086
351 Ga0496124_0086200 3300048927 Bacteria 2571
352 Ga0496125_0002750 3300048928 Bacteria 22248
353 Ga0496125_0029563 3300048928 Bacteria 4922
354 Ga0496126_0015682 3300048929 Bacteria 7613
355 Ga0496126_0021389 3300048929 Bacteria 6317
356 Ga0496126_0062256 3300048929 Bacteria 3349
357 Ga0496126_0113059 3300048929 Bacteria 2364
358 Ga0495682_0099253 3300049460 Bacteria 1044
359 Ga0501067_0074014 3300049583 Bacteria 1887
360 Ga0501070_0029514 3300049586 Bacteria 4597
361 Ga0501080_0029684 3300049742 Bacteria 5089
362 Ga0501044_0069735 3300049823 Bacteria 3578
363 nmdc:mga00v17_238453_c1 3300050491 Bacteria 1179
364 nmdc:mga00v17_60046_c1 3300050491 Bacteria 2334
365 nmdc:mga00v17_80275_c1 3300050491 Bacteria 2036
366 nmdc:mga0yw44_223818_c1 3300050492 Bacteria 1248
367 nmdc:mga0yw44_41896_c1 3300050492 Bacteria 2728
368 nmdc:mga0yw44_60960_c1 3300050492 Bacteria 2313
369 nmdc:mga0k408_13505_c1 3300050493 Bacteria 4481
370 nmdc:mga06z11_6922_c1 3300050494 Bacteria 4644
371 nmdc:mga0sz30_20711_c1 3300050516 Bacteria 2655
372 Ga0495612_0011195 3300053078 Bacteria 3620
373 Ga0495619_0088557 3300053085 Bacteria 2094
374 Ga0500578_0057479 3300053086 Bacteria 2487
375 Ga0500643_000246 3300053087 Bacteria 49834
376 Ga0500647_0028873 3300053091 Bacteria 2628
377 Ga0500566_0001453 3300053094 Bacteria 13885
378 Ga0500566_0004598 3300053094 Bacteria 8217
379 Ga0500641_0035920 3300053096 Bacteria 1980
380 Ga0500555_008070 3300053103 Bacteria 2998
381 Ga0500556_0009337 3300053104 Bacteria 2849
382 Ga0500557_000138 3300053105 Bacteria 17805
383 Ga0500562_005351 3300053108 Bacteria 3224
384 Ga0500572_000964 3300053111 Bacteria 8710
385 Ga0500572_003203 3300053111 Bacteria 3775
386 Ga0500592_003265 3300053116 Bacteria 2586
387 Ga0500595_000262 3300053119 Bacteria 34880
388 Ga0500595_002692 3300053119 Bacteria 8615
389 Ga0500595_010531 3300053119 Bacteria 3669
390 Ga0500614_001751 3300053123 Bacteria 5043
391 Ga0500642_0000177 3300053130 Bacteria 26602
392 Ga0500642_0011092 3300053130 Bacteria 3208
393 Ga0500559_0001966 3300053136 Bacteria 11099
394 Ga0500559_0012955 3300053136 Bacteria 3537
395 Ga0500559_0050356 3300053136 Bacteria 1837
396 Ga0500568_0004930 3300053139 Bacteria 7021
397 Ga0500577_0026711 3300053142 Bacteria 1969
398 Ga0500603_001133 3300053150 Bacteria 6232
399 Ga0500616_0014727 3300053153 Bacteria 4486
400 Ga0500620_004649 3300053155 Bacteria 3091
401 Ga0500630_012182 3300053159 Bacteria 4238
402 Ga0500638_008621 3300053162 Bacteria 4363
403 Ga0500639_000028 3300053163 Bacteria 77951
404 Ga0500636_0000331 3300053177 Bacteria 26251
405 Ga0500637_0007147 3300053178 Bacteria 5564
406 Ga0500596_000788 3300053735 Bacteria 6245
407 Ga0500599_000298 3300053736 Bacteria 4806
408 Ga0500601_000282 3300053737 Bacteria 9678
409 2507506031 2507262055 Bacteria 8048963
410 2508540219 2508501009 Bacteria 7784016
411 2508696295 2508501042 Bacteria 8719808
412 2509148230 2508501128 Bacteria 8613869
413 2511397287 2511231028 Bacteria 8046582
414 2513624938 2513237092 Bacteria 8341956
415 2513638229 2513237094 Bacteria 8789602
416 2513649065 2513237095 Bacteria 8976980
417 2513716301 2513237104 Bacteria 10034502
418 2513877139 2513237139 Bacteria 8737671
419 2513891473 2513237141 Bacteria 8496279
420 2514014510 2513237161 Bacteria 8871253
421 2515628426 2515154112 Bacteria 8294334
422 2517103221 2517093001 Bacteria 9002274
423 2524440727 2524023205 Bacteria 8918781
424 2528853840 2528768022 Bacteria 10457665
425 2617347911 2617270735 Bacteria 9163226
426 2617374831 2617270741 Bacteria 8201522
427 2728751793 2728368998 Bacteria 8720350
428 2745075967 2744054633 Bacteria 8678936
429 2793061437 2791355196 Bacteria 7323613
430 2805916262 2802429603 Bacteria 8777136
431 2818240456 2816332527 Bacteria 8933356
432 2824608211 2824600985 Bacteria 8488197
433 2824614378 2824609381 Bacteria 8672835
434 2824625523 2824617872 Bacteria 8814715
435 2824631030 2824626560 Bacteria 8813858
436 2824641678 2824635225 Bacteria 8785348
437 2824656757 2824653114 Bacteria 8493680
438 2824668557 2824661429 Bacteria 9877870
439 2824677569 2824671348 Bacteria 8369588
440 2824683907 2824679649 Bacteria 8248951
441 2824694011 2824687955 Bacteria 8360029
442 2824701428 2824696289 Bacteria 8335049
443 2824719789 2824714736 Bacteria 8717648
444 2824739222 2824732956 Bacteria 7810675
445 2824748905 2824746037 Bacteria 7911610
446 2824761608 2824753945 Bacteria 9787441
447 2824771472 2824763712 Bacteria 9792355
448 2824776311 2824773399 Bacteria 8360218
449 2838124978 2838122688 Bacteria 8803140
450 2841947116 2841941048 Bacteria 8688029
451 2841954955 2841949485 Bacteria 8680857
452 2841965816 2841957949 Bacteria 8652217
453 2841973624 2841966195 Bacteria 8673214
454 2841981896 2841974524 Bacteria 8931498
455 2841989512 2841983080 Bacteria 8395090
456 2842044498 2842038055 Bacteria 8002051
457 2842051513 2842045827 Bacteria 8006841
458 2844316370 2844315083 Bacteria 8138177
459 2847939327 2847930680 Bacteria 9342022
460 2847941083 2847939898 Bacteria 8606328
461 2849082070 2849076700 Bacteria 7039503
462 2857513447 2857509624 Bacteria 7472071
463 2874596231 2874590934 Bacteria 8299676
464 2874615873 2874612657 Bacteria 8252029
465 2874622586 2874620515 Bacteria 8290088
466 2874633508 2874628541 Bacteria 8630250
467 2874650218 2874645413 Bacteria 8214782
468 2876765333 2876761206 Bacteria 10111113
469 2876776696 2876771140 Bacteria 8287509
470 2876824486 2876818435 Bacteria 8274608
471 2879080833 2879074833 Bacteria 8279565
472 2879087000 2879083081 Bacteria 8587928
473 2879104238 2879099564 Bacteria 10442239
474 2879133678 2879127579 Bacteria 8294491
475 2879148180 2879142872 Bacteria 8267021
476 2881369492 2881364244 Bacteria 7710352
477 2881668337 2881665667 Bacteria 8175609
478 2885371518 2885366525 Bacteria 8326213
479 2885411995 2885409591 Bacteria 9235467
480 2888387129 2888378607 Bacteria 9652610
481 2888389810 2888388044 Bacteria 7304136
482 2888421288 2888419890 Bacteria 7857137
483 2903728296 2903727486 Bacteria 8281579
484 2904671407 2904666416 Bacteria 8226587
485 2904719699 2904711408 Bacteria 9771557
486 2906606436 2906602504 Bacteria 8295279
487 2906630616 2906626472 Bacteria 8826946
488 2906648412 2906643746 Bacteria 8722424
489 2908757611 2908756301 Bacteria 8864324
490 2908777314 2908775508 Bacteria 8092255
491 2922377281
492 2922398400 2922393267 Bacteria 8285685
493 2929622098 2929615660 Bacteria 9193770
494 2929630257 2929624759 Bacteria 9339455
495 2932787819 2932784394 Bacteria 9704911
496 2932795935 2932794094 Bacteria 7915132
497 2932807513 2932801729 Bacteria 7987968
498 2932814617 2932809354 Bacteria 9135765
499 2932823385 2932818245 Bacteria 9955613
500 2932835153 2932828146 Bacteria 9745859
501 2933584286 2933577622 Bacteria 9116884
502 2935614456 2935608549 Bacteria 8203142
503 2935620530 2935616580 Bacteria 9032984
504 2935640853 2935638405 Bacteria 10015038
505 2935649487 2935648319 Bacteria 8801166
506 2935657741 2935656913 Bacteria 8965014
507 2935670355 2935665750 Bacteria 9571747
508 2935679785 2935675223 Bacteria 9928132
509 2935687356 2935684952 Bacteria 9590419
510 2935696674 2935694250 Bacteria 9291695
511 2935709235 2935703347 Bacteria 10242284
512 2935718815 2935713505 Bacteria 9608509
513 2935728467 2935722832 Bacteria 9608746
514 2935736936 2935732158 Bacteria 9706831
515 2935746061 2935741537 Bacteria 9707219
516 2935753322 2935750917 Bacteria 9590372
517 2935766284 2935760218 Bacteria 9817913
518 2935770323 2935769743 Bacteria 7878163
519 2935777651 2935777560 Bacteria 8077691
520 2935786624 2935785616 Bacteria 7962367
521 2935794678 2935793552 Bacteria 8012592
522 2935808968 2935801545 Bacteria 9301974
523 2935813853 2935810662 Bacteria 9401221
524 2935826674 2935819856 Bacteria 8261050
525 2935832360 2935827899 Bacteria 10038562
526 2935844065 2935837841 Bacteria 9454360
527 2935851032 2935847175 Bacteria 8228321
528 2935862856 2935855204 Bacteria 9035059
529 2935864600 2935864058 Bacteria 9784707
530 2935875048 2935873716 Bacteria 9632195
531 2935890273 2935883170 Bacteria 7964738
532 2935913084 2935908558 Bacteria 8568796
533 2935922505 2935916978 Bacteria 9113783
534 2935930991 2935926038 Bacteria 8601059
535 2935939675 2935934488 Bacteria 8602579
536 2935946624 2935942939 Bacteria 8599779
537 2935956175 2935951376 Bacteria 8602333
538 2935965083 2935959822 Bacteria 7869783
539 2935972968 2935967501 Bacteria 8603075
540 2935978113 2935975950 Bacteria 8347125
541 2935989325 2935984226 Bacteria 8302647
542 2935999332 2935992306 Bacteria 9802711
543 2936005888 2936002035 Bacteria 9362176
544 2936011960 2936011229 Bacteria 8801034
545 2936020959 2936019824 Bacteria 8804134
546 2936029253 2936028420 Bacteria 8965941
547 2936039408 2936037263 Bacteria 9446081
548 2936048423 2936046547 Bacteria 8903709
549 2936056467 2936055302 Bacteria 8785755
550 2940559235 2940556831 Bacteria 9590747
551 2941534474 2941531003 Bacteria 7653939
552 2941541927 2941538514 Bacteria 9402094
553 3005476023 3005474847 Bacteria 9259049
554 3005491179 3005483717 Bacteria 7877331
555 3005511019 3005506211 Bacteria 6943378
556 3005591863 3005587118 Bacteria 7794411
557 3005595979 3005594810 Bacteria 8716512
558 3005711930 3005710791 Bacteria 7622528
559 3005719174 3005718088 Bacteria 8283608
560 8006927944 8006926726 Bacteria 6749210
561 8016517146 8016511872 Bacteria 9921665
562 8016527095 8016522445 Bacteria 8156687
563 8016532179 8016530956 Bacteria 8155261
564 8016545392 8016539877 Bacteria 8155419
565 8016556698 8016548790 Bacteria 8155074
566 8016565054 8016557553 Bacteria 8154380
567 8016570475 8016566248 Bacteria 8158151
568 8016583006 8016575299 Bacteria 8154085
569 8016585295 8016583857 Bacteria 10421953
570 8016602707 8016595262 Bacteria 8149947
571 8016617482 8016613128 Bacteria 8794220
572 8016624091 8016622563 Bacteria 7999408
573 8016634774 8016630954 Bacteria 9217207
574 8017059439 8017057580 Bacteria 10023680
575 8019531996 8019530166 Bacteria 8155624
576 8019539543 8019538911 Bacteria 7872763
577 8019576171 8019576017 Bacteria 10049540
578 8019594050 8019586578 Bacteria 10212056
579 8019607514 8019597564 Bacteria 10041141
580 8019610996 8019608314 Bacteria 10042931
581 8019631480 8019629233 Bacteria 8687553
582 8019651290 8019648815 Bacteria 10014479
583 8019677738 8019668869 Bacteria 8791617
584 8019687203 8019678201 Bacteria 8863603
585 8019693184 8019687851 Bacteria 8712826
586 8055743651 8055742211 Bacteria 9226248
587 8056692072 8056689827 Bacteria 6712655
588 8056974040 8056967851 Bacteria 9038162
589 Ga0466965_0015178
590 JGI24739J22299_10043505
591 JGI25406J46586_10000061
592 JGI25406J46586_10002926
593 JGI25153J46596_10007329
594 JGI25153J46596_10007506
595 JGI25153J46596_10009158
596 JGI25153J46596_10009708
597 rootH1_10059455
598 JGI25160J50197_1004274
599 Ga0055531_10005976
600 Ga0055543_1002065
601 Ga0065165_1006941
602 Ga0065165_1008326
603 Ga0065165_1009278
604 Ga0070683_100046439
605 Ga0070670_100060523
606 Ga0070682_100029609
607 Ga0068868_100209437
608 Ga0070659_100154129
609 Ga0070709_10018793
610 Ga0070709_10077841
611 Ga0070710_10011154
612 Ga0070711_100003965
613 Ga0070711_100193728
614 Ga0070711_100208074
615 Ga0070663_100023707
616 Ga0070663_100053468
617 Ga0070663_100240534
618 Ga0070678_100207328
619 Ga0070662_100087163
620 Ga0070681_10072265
621 Ga0070681_10109887
622 Ga0070706_100151771
623 Ga0070707_100055536
624 Ga0070679_100031394
625 Ga0070679_100076837
626 Ga0070684_100006601
627 Ga0070684_100353629
628 Ga0068853_100084286
629 Ga0068853_100193324
630 Ga0068853_100204287
631 Ga0070665_100058573
632 Ga0070665_100085548
633 Ga0068855_100096919
634 Ga0068855_100366805
635 Ga0070664_100167293
636 Ga0068857_100029286
637 Ga0068857_100118821
638 Ga0068854_100209216
639 Ga0068856_100124878
640 Ga0068856_100206869
641 Ga0068852_100013221
642 Ga0068864_100054928
643 Ga0068858_100073291
644 Ga0068858_100374944
645 Ga0081455_10002701
646 Ga0081455_10005942
647 Ga0081455_10034626
648 Ga0081455_10036437
649 Ga0081455_10163638
650 Ga0081540_1002550
651 Ga0081540_1036707
652 Ga0081540_1040383
653 Ga0081539_10000950
654 Ga0081539_10001094
655 Ga0081539_10032112
656 Ga0075365_10032443
657 Ga0070712_100027483
658 Ga0075366_10033931
659 Ga0075370_10015462
660 Ga0075434_100006415
661 Ga0075436_100068171
662 Ga0099825_1024210
663 Ga0105240_10013649
664 Ga0105240_10032873
665 Ga0105245_10058858
666 Ga0105247_10025446
667 Ga0105241_10173850
668 Ga0105237_10336487
669 Ga0105238_10098522
670 Ga0105238_10317484
671 Ga0105239_10204927
672 Ga0105246_10012111
673 Ga0105246_10046848
674 Ga0157370_10099297
675 Ga0157369_10001922
676 Ga0157369_10017723
677 Ga0157374_10037204
678 Ga0157378_10031719
679 Ga0163162_10064953
680 Ga0163162_10161348
681 Ga0157372_10045208
682 Ga0157372_10536336
683 Ga0157375_10008290
684 Ga0163163_10026416
685 Ga0163163_10031857
686 Ga0163163_10050608
687 Ga0157377_10023326
688 Ga0157376_10006879
689 Ga0214544_1000011
690 Ga0214542_1000009
691 Ga0214545_1000007
692 Ga0214543_1000020
693 Ga0209563_102279
694 Ga0209677_102371
695 Ga0209564_1003334
696 Ga0209564_1014649
697 Ga0209758_1000206
698 Ga0209758_1002220
699 Ga0209758_1005133
700 Ga0209758_1006073
701 Ga0209758_1010714
702 Ga0209758_1032722
703 Ga0209256_1004119
704 Ga0207426_1000644
705 Ga0207426_1001144
706 Ga0207426_1015608
707 Ga0207426_1018741
708 Ga0207426_1024489
709 Ga0209257_1015135
710 Ga0207692_10005728
711 Ga0207692_10015547
712 Ga0207688_10122697
713 Ga0207699_10018595
714 Ga0207699_10037828
715 Ga0207684_10119018
716 Ga0207707_10000597
717 Ga0207707_10104419
718 Ga0207707_10125059
719 Ga0207695_10000006
720 Ga0207695_10069569
721 Ga0207695_10074723
722 Ga0207671_10003789
723 Ga0207671_10111631
724 Ga0207693_10004165
725 Ga0207663_10031936
726 Ga0207663_10038130
727 Ga0207660_10162269
728 Ga0207652_10046582
729 Ga0207694_10039255
730 Ga0207694_10186792
731 Ga0207650_10165294
732 Ga0207687_10102774
733 Ga0207664_10029582
734 Ga0207706_10115165
735 Ga0207706_10363246
736 Ga0207709_10030034
737 Ga0207691_10163435
738 Ga0207661_10010641
739 Ga0207661_10015685
740 Ga0207640_10192092
741 Ga0207703_10111631
742 Ga0207639_10088336
743 Ga0207639_10091210
744 Ga0207678_10039029
745 Ga0207678_10045255
746 Ga0207678_10109863
747 Ga0207641_10058908
748 Ga0207641_10321437
749 Ga0207674_10061330
750 Ga0207674_10104737
751 Ga0207683_10050528
752 Ga0207698_10284537
753 Ga0209389_1000034
754 Ga0209389_1000039
755 Ga0209589_1000038
756 Ga0209489_100023
757 Ga0209489_100087
758 Ga0209700_100090
759 Ga0209813_10012099
760 Ga0268266_10061980
761 Ga0268266_10101786
762 Ga0307517_10003697
763 Ga0307515_10091152
764 Ga0307513_10082990
765 Ga0265314_10007325
766 Ga0307405_10179045
767 Ga0307510_10032063
768 Ga0373926_0008027
769 Ga0373934_0033191
770 Ga0373934_0084044
771 Ga0373944_0016823
772 Ga0373943_0026320
773 Ga0373946_0001304
774 Ga0373955_0015191
775 Ga0373924_0005630
776 Ga0373935_0000150
777 Ga0373927_0000849
778 Ga0373927_0058450
779 Ga0373947_0002265
780 Ga0373925_0003962
781 Ga0373925_0018790
782 Ga0395900_0002138
783 Ga0395900_0064833
784 Ga0395898_0011071
785 Ga0395898_0070075
786 Ga0395898_0074589
787 Ga0395905_0021013
788 Ga0395905_0031619
789 Ga0395901_0054161
790 Ga0395901_0074079
791 Ga0395901_0215195
792 Ga0436365_1589836
793 Ga0466972_0000053
794 Ga0466972_0001271
795 Ga0466965_0117073
796 Ga0466966_0000488
797 Ga0466961_0000025
798 Ga0466961_0055373
799 Ga0466963_0064045
800 Ga0466964_0025967
801 Ga0466964_0049870
802 Ga0466968_0015700
803 Ga0466968_0088505
804 Ga0466957_0111923
805 Ga0466960_0047270
806 Ga0466959_0016959
807 Ga0495592_0021938
808 Ga0495592_0073873
809 Ga0495603_0001788
810 Ga0495629_0003196
811 Ga0495629_0022212
812 Ga0495629_0039767
813 Ga0495641_0001278
814 Ga0495651_0085797
815 Ga0495653_0146781
816 Ga0495580_0000235
817 Ga0495580_0081280
818 Ga0495582_0000357
819 Ga0495605_0046548
820 Ga0495639_0037693
821 Ga0495639_0044547
822 Ga0495662_0000109
823 Ga0495662_0007117
824 Ga0495664_0037024
825 Ga0495594_0000190
826 Ga0495606_0001194
827 Ga0495606_0170293
828 Ga0495608_0066583
829 Ga0495608_0066934
830 Ga0495618_0106787
831 Ga0495628_0041344
832 Ga0495630_0115578
833 Ga0495643_0015710
834 Ga0495648_0089596
835 Ga0495666_0025805
836 Ga0495666_0036661
837 Ga0495652_0024779
838 Ga0495652_0041524
839 Ga0495652_0073221
840 Ga0495665_0000082
841 Ga0495665_0132917
842 Ga0495640_0000178
843 Ga0495587_0035144
844 Ga0495645_0064949
845 Ga0495645_0175860
846 Ga0495622_0005081
847 Ga0495667_0004636
848 Ga0495634_0000680
849 Ga0495634_0022298
850 Ga0495625_0108209
851 Ga0495635_0000908
852 Ga0495635_0005707
853 Ga0495588_0006664
854 Ga0495657_0010355
855 Ga0495657_0038369
856 Ga0495599_0075718
857 Ga0495623_0085560
858 Ga0495646_0014282
859 Ga0495646_0032806
860 Ga0495646_0091233
861 Ga0495658_0000329
862 Ga0495613_0003140
863 Ga0495624_0001433
864 Ga0495624_0018936
865 Ga0495649_0029084
866 Ga0495600_0066729
867 Ga0495581_0000006
868 Ga0495581_0020268
869 Ga0495604_0146503
870 Ga0495674_0000380
871 Ga0495674_0035652
872 Ga0495672_0025149
873 Ga0495672_0075178
874 Ga0495676_0026290
875 Ga0495676_0039229
876 Ga0495680_0008895
877 Ga0495680_0038062
878 Ga0495687_009988
879 Ga0495687_067780
880 Ga0495675_0013085
881 Ga0495684_0005148
882 Ga0495684_0007364
883 Ga0495686_0015532
884 Ga0495593_0000032
885 Ga0495614_0006398
886 Ga0495614_0061418
887 Ga0496100_0005476
888 Ga0496100_0134169
889 Ga0496100_0205404
890 Ga0496101_0095652
891 Ga0496101_0145036
892 Ga0496101_0157840
893 Ga0496102_0000516
894 Ga0496102_0031358
895 Ga0496102_0045623
896 Ga0496102_0106181
897 Ga0496102_0129892
898 Ga0496104_0034166
899 Ga0496104_0036610
900 Ga0496105_0016393
901 Ga0496105_0033849
902 Ga0496105_0068202
903 Ga0496105_0079714
904 Ga0496106_0011725
905 Ga0496106_0014239
906 Ga0496106_0112160
907 Ga0496107_0034927
908 Ga0496107_0042205
909 Ga0496107_0191424
910 Ga0496108_0000299
911 Ga0496108_0085546
912 Ga0496108_0193677
913 Ga0496109_0000928
914 Ga0496109_0070417
915 Ga0496110_0047359
916 Ga0496111_0053401
917 Ga0496111_0059374
918 Ga0496112_0055718
919 Ga0496112_0079130
920 Ga0496112_0204609
921 Ga0496113_0010200
922 Ga0496113_0012830
923 Ga0496113_0241323
924 Ga0496114_0047735
925 Ga0496115_0002544
926 Ga0496115_0070095
927 Ga0496115_0244438
928 Ga0496116_0019027
929 Ga0496119_0021269
930 Ga0496120_0010635
931 Ga0496120_0078825
932 Ga0496121_0000265
933 Ga0496121_0019149
934 Ga0496121_0032003
935 Ga0496121_0035327
936 Ga0496121_0053675
937 Ga0496122_0095484
938 Ga0496124_0020611
939 Ga0496124_0086200
940 Ga0496125_0002750
941 Ga0496125_0029563
942 Ga0496126_0015682
943 Ga0496126_0021389
944 Ga0496126_0062256
945 Ga0496126_0113059
946 Ga0495682_0099253
947 Ga0501067_0074014
948 Ga0501070_0029514
949 Ga0501080_0029684
950 Ga0501044_0069735
951 nmdc:mga00v17_238453_c1
952 nmdc:mga00v17_60046_c1
953 nmdc:mga00v17_80275_c1
954 nmdc:mga0yw44_223818_c1
955 nmdc:mga0yw44_41896_c1
956 nmdc:mga0yw44_60960_c1
957 nmdc:mga0k408_13505_c1
958 nmdc:mga06z11_6922_c1
959 nmdc:mga0sz30_20711_c1
960 Ga0495612_0011195
961 Ga0495619_0088557
962 Ga0500578_0057479
963 Ga0500643_000246
964 Ga0500647_0028873
965 Ga0500566_0001453
966 Ga0500566_0004598
967 Ga0500641_0035920
968 Ga0500555_008070
969 Ga0500556_0009337
970 Ga0500557_000138
971 Ga0500562_005351
972 Ga0500572_000964
973 Ga0500572_003203
974 Ga0500592_003265
975 Ga0500595_000262
976 Ga0500595_002692
977 Ga0500595_010531
978 Ga0500614_001751
979 Ga0500642_0000177
980 Ga0500642_0011092
981 Ga0500559_0001966
982 Ga0500559_0012955
983 Ga0500559_0050356
984 Ga0500568_0004930
985 Ga0500577_0026711
986 Ga0500603_001133
987 Ga0500616_0014727
988 Ga0500620_004649
989 Ga0500630_012182
990 Ga0500638_008621
991 Ga0500639_000028
992 Ga0500636_0000331
993 Ga0500637_0007147
994 Ga0500596_000788
995 Ga0500599_000298
996 Ga0500601_000282
997 2507506031
998 2508540219
999 2508696295
1000 2509148230
1001 2511397287
1002 2513624938
1003 2513638229
1004 2513649065
1005 2513716301
1006 2513877139
1007 2513891473
1008 2514014510
1009 2515628426
1010 2517103221
1011 2524440727
1012 2528853840
1013 2617347911
1014 2617374831
1015 2728751793
1016 2745075967
1017 2793061437
1018 2805916262
1019 2818240456
1020 2824608211
1021 2824614378
1022 2824625523
1023 2824631030
1024 2824641678
1025 2824656757
1026 2824668557
1027 2824677569
1028 2824683907
1029 2824694011
1030 2824701428
1031 2824719789
1032 2824739222
1033 2824748905
1034 2824761608
1035 2824771472
1036 2824776311
1037 2838124978
1038 2841947116
1039 2841954955
1040 2841965816
1041 2841973624
1042 2841981896
1043 2841989512
1044 2842044498
1045 2842051513
1046 2844316370
1047 2847939327
1048 2847941083
1049 2849082070
1050 2857513447
1051 2874596231
1052 2874615873
1053 2874622586
1054 2874633508
1055 2874650218
1056 2876765333
1057 2876776696
1058 2876824486
1059 2879080833
1060 2879087000
1061 2879104238
1062 2879133678
1063 2879148180
1064 2881369492
1065 2881668337
1066 2885371518
1067 2885411995
1068 2888387129
1069 2888389810
1070 2888421288
1071 2903728296
1072 2904671407
1073 2904719699
1074 2906606436
1075 2906630616
1076 2906648412
1077 2908757611
1078 2908777314
1079 2922377281
1080 2922398400
1081 2929622098
1082 2929630257
1083 2932787819
1084 2932795935
1085 2932807513
1086 2932814617
1087 2932823385
1088 2932835153
1089 2933584286
1090 2935614456
1091 2935620530
1092 2935640853
1093 2935649487
1094 2935657741
1095 2935670355
1096 2935679785
1097 2935687356
1098 2935696674
1099 2935709235
1100 2935718815
1101 2935728467
1102 2935736936
1103 2935746061
1104 2935753322
1105 2935766284
1106 2935770323
1107 2935777651
1108 2935786624
1109 2935794678
1110 2935808968
1111 2935813853
1112 2935826674
1113 2935832360
1114 2935844065
1115 2935851032
1116 2935862856
1117 2935864600
1118 2935875048
1119 2935890273
1120 2935913084
1121 2935922505
1122 2935930991
1123 2935939675
1124 2935946624
1125 2935956175
1126 2935965083
1127 2935972968
1128 2935978113
1129 2935989325
1130 2935999332
1131 2936005888
1132 2936011960
1133 2936020959
1134 2936029253
1135 2936039408
1136 2936048423
1137 2936056467
1138 2940559235
1139 2941534474
1140 2941541927
1141 3005476023
1142 3005491179
1143 3005511019
1144 3005591863
1145 3005595979
1146 3005711930
1147 3005719174
1148 8006927944
1149 8016517146
1150 8016527095
1151 8016532179
1152 8016545392
1153 8016556698
1154 8016565054
1155 8016570475
1156 8016583006
1157 8016585295
1158 8016602707
1159 8016617482
1160 8016624091
1161 8016634774
1162 8017059439
1163 8019531996
1164 8019539543
1165 8019576171
1166 8019594050
1167 8019607514
1168 8019610996
1169 8019631480
1170 8019651290
1171 8019677738
1172 8019687203
1173 8019693184
1174 8055743651
1175 8056692072
1176 8056974040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13437

HlyD_3

HlyD family secretion protein

216

331

0.94

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

105

154

0.91

PF00529

CusB_dom_1

Cation efflux system protein CusB domain 1

48

402

0.77

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

96

334

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7aal-assembly1.cif.gz_B crystal structure of the f-bar domain of pstipip1, g258a mutant 0.9603 88 164
4bne-assembly1.cif.gz_B pacsin2 interacts with membranes and actin-filaments 0.9069 88 164
8cwy-assembly1.cif.gz_L accurate computational design of genetically encoded 3d protein crystals 0.9058 87 162
8cwy-assembly1.cif.gz_F accurate computational design of genetically encoded 3d protein crystals 0.9052 87 162
8cwy-assembly1.cif.gz_H accurate computational design of genetically encoded 3d protein crystals 0.9047 87 162
ID Description Score Start End Superfamily
af_P75830_95_182_6.10.140.1990 Special;Helix non-globular;Helix Hairpins; 0.9865 88 164 6.10.140.1990
3fppA03 Special;Helix non-globular;Helix Hairpins; 0.9684 89 164 6.10.140.1990
af_B0BNK4_2_275_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9595 88 164 1.20.1270.60
af_A0A0B4KH28_1_290_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.958 88 162 1.20.1270.60
1vf7G01 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3;Efflux pump adaptor protein, beta barrel domain 0.9574 198 288 2.40.30.170
ID Description Score Start End GO Terms
AF-A0A440F6X0-F1-model_v4 deleted 0.9866 56 163
AF-A0A3S0E9K2-F1-model_v4 Efflux RND transporter periplasmic adaptor subunit 0.9549 56 185 GO:0005886
GO:0015562
GO:1990281
AF-A0A0D0LMU2-F1-model_v4 RND transporter 0.9535 56 166 GO:0005886
GO:0015562
GO:1990281
AF-A0A3D3DQ43-F1-model_v4 Membrane fusion protein biotin-lipoyl like domain-containing protein 0.9246 56 176 GO:0015562
GO:1990281
AF-A0A432PZR3-F1-model_v4 Membrane fusion protein biotin-lipoyl like domain-containing protein 0.9187 56 173 GO:0015562
GO:1990281

Map