F466787

General Info

Members Datasets Scaffolds Average Seq Length
588 306 1176 120

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100515764|Ga0307416_1005157642
Length 140
Sequence MTPIYVSIAGSIASILLILVVFELIRSRRLRERYALLWLATGVVLLVLSAWRGGLNTIAGWVGVTGYPPAVLFAVATLFILVVLLHYSTVISRLSDQNVVLAQRLALLEQRSAEVDRDAVEAPAVREPGAELVGEPRRDA

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
80 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
81 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
82 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
83 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
141 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
146 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
147 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
154 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
155 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
156 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
157 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
160 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
161 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
167 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
178 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
179 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
180 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
181 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
182 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
183 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
184 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
192 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
193 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
194 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
244 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
284 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
285 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
286 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
289 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
296 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
297 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
298 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
299 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.66
Metatranscriptomes 0.34
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 7.65
Rhizosphere 90.65
Stem 0
Stem Tuber 0
Unclassified 16.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100515764 3300032002 Bacteria 1263
2 Ga0070676_10335395 3300005328 Unclassified 1035
3 Ga0070683_100109852 3300005329 Bacteria 2601
4 Ga0070690_100490262 3300005330 Bacteria 918
5 Ga0070680_100623105 3300005336 Bacteria 926
6 Ga0070680_102011691 3300005336 Bacteria 501
7 Ga0070682_100698011 3300005337 Bacteria 813
8 Ga0070682_100872603 3300005337 Bacteria 737
9 Ga0068868_100691234 3300005338 Unclassified 912
10 Ga0070660_100586917 3300005339 Bacteria 931
11 Ga0070668_100023038 3300005347 Bacteria 4707
12 Ga0070668_101200486 3300005347 Unclassified 687
13 Ga0070675_102162963 3300005354 Bacteria 513
14 Ga0070671_101355268 3300005355 Bacteria 628
15 Ga0070671_101416573 3300005355 Bacteria 614
16 Ga0070674_101957420 3300005356 Bacteria 533
17 Ga0070673_100654122 3300005364 Bacteria 962
18 Ga0070673_101503274 3300005364 Bacteria 635
19 Ga0070709_10013139 3300005434 Bacteria 4648
20 Ga0070709_10043001 3300005434 Bacteria 2792
21 Ga0070709_11694075 3300005434 Unclassified 516
22 Ga0070714_100058301 3300005435 Bacteria 3307
23 Ga0070714_100224406 3300005435 Bacteria 1728
24 Ga0070714_100488809 3300005435 Bacteria 1173
25 Ga0070714_100562626 3300005435 Bacteria 1092
26 Ga0070714_100717357 3300005435 Bacteria 965
27 Ga0070714_101159057 3300005435 Unclassified 754
28 Ga0070713_100005402 3300005436 Bacteria 8729
29 Ga0070713_100119902 3300005436 Bacteria 2305
30 Ga0070713_100225502 3300005436 Unclassified 1701
31 Ga0070713_100407889 3300005436 Bacteria 1270
32 Ga0070710_10054669 3300005437 Bacteria 2253
33 Ga0070710_10516665 3300005437 Bacteria 820
34 Ga0070701_10651336 3300005438 Bacteria 703
35 Ga0070711_100215227 3300005439 Unclassified 1490
36 Ga0070711_100528358 3300005439 Unclassified 976
37 Ga0070711_100529503 3300005439 Bacteria 975
38 Ga0070705_100012683 3300005440 Bacteria 4291
39 Ga0070705_100141525 3300005440 Unclassified 1584
40 Ga0070705_100449879 3300005440 Unclassified 966
41 Ga0070700_100140201 3300005441 Bacteria 1642
42 Ga0070700_101729395 3300005441 Bacteria 537
43 Ga0070694_100127866 3300005444 Bacteria 1832
44 Ga0070694_100403783 3300005444 Bacteria 1070
45 Ga0070663_100747135 3300005455 Bacteria 835
46 Ga0070678_100541785 3300005456 Bacteria 1032
47 Ga0070662_100015767 3300005457 Bacteria 5066
48 Ga0070662_101148283 3300005457 Bacteria 667
49 Ga0070662_101646919 3300005457 Bacteria 554
50 Ga0070681_10115225 3300005458 Bacteria 2626
51 Ga0070681_10833131 3300005458 Bacteria 840
52 Ga0070681_11190590 3300005458 Bacteria 684
53 Ga0070707_100554213 3300005468 Bacteria 1112
54 Ga0070698_100039088 3300005471 Bacteria 4886
55 Ga0070698_101027432 3300005471 Unclassified 772
56 Ga0070698_101335502 3300005471 Unclassified 667
57 Ga0070699_100055122 3300005518 Bacteria 3443
58 Ga0070699_100233560 3300005518 Unclassified 1640
59 Ga0070699_100318330 3300005518 Viruses 1398
60 Ga0070699_100571315 3300005518 Bacteria 1030
61 Ga0070679_100213071 3300005530 Bacteria 1895
62 Ga0070679_100240545 3300005530 Bacteria 1768
63 Ga0070679_100572438 3300005530 Unclassified 1073
64 Ga0070679_101553878 3300005530 Unclassified 609
65 Ga0070684_100004966 3300005535 Bacteria 10153
66 Ga0070684_100305688 3300005535 Bacteria 1460
67 Ga0070684_101350689 3300005535 Bacteria 671
68 Ga0070697_100752309 3300005536 Bacteria 861
69 Ga0070672_101301644 3300005543 Bacteria 649
70 Ga0070686_100157430 3300005544 Bacteria 1597
71 Ga0070686_100446923 3300005544 Bacteria 993
72 Ga0070695_100216916 3300005545 Unclassified 1376
73 Ga0070695_100537902 3300005545 Bacteria 909
74 Ga0070696_100110341 3300005546 Unclassified 1980
75 Ga0070693_100003966 3300005547 Bacteria 6947
76 Ga0070693_100487472 3300005547 Bacteria 872
77 Ga0070704_100244319 3300005549 Bacteria 1471
78 Ga0070704_100277121 3300005549 Bacteria 1388
79 Ga0070704_100604788 3300005549 Bacteria 964
80 Ga0068855_100118916 3300005563 Bacteria 3026
81 Ga0068855_101701734 3300005563 Unclassified 643
82 Ga0068855_102283781 3300005563 Bacteria 542
83 Ga0068854_101961814 3300005578 Unclassified 539
84 Ga0068856_100374275 3300005614 Bacteria 1443
85 Ga0068856_100795917 3300005614 Bacteria 965
86 Ga0070702_100421503 3300005615 Bacteria 961
87 Ga0068866_10160028 3300005718 Bacteria 1312
88 Ga0068866_10475313 3300005718 Bacteria 822
89 Ga0068866_10601824 3300005718 Unclassified 742
90 Ga0068861_100004346 3300005719 Bacteria 9508
91 Ga0068861_100207101 3300005719 Unclassified 1650
92 Ga0068870_10947964 3300005840 Bacteria 611
93 Ga0068863_100721928 3300005841 Bacteria 991
94 Ga0081455_10692735 3300005937 Bacteria 650
95 Ga0081538_10102023 3300005981 Unclassified 1441
96 Ga0081540_1203357 3300005983 Unclassified 718
97 Ga0081539_10450854 3300005985 Bacteria 533
98 Ga0070717_10198713 3300006028 Bacteria 1755
99 Ga0075365_10127560 3300006038 Bacteria 1759
100 Ga0075364_10668459 3300006051 Unclassified 709
101 Ga0075432_10008476 3300006058 Bacteria 3508
102 Ga0070715_10001209 3300006163 Bacteria 7424
103 Ga0070715_10413179 3300006163 Bacteria 753
104 Ga0070716_100008039 3300006173 Bacteria 5223
105 Ga0070716_100553207 3300006173 Unclassified 858
106 Ga0070712_100089301 3300006175 Bacteria 2254
107 Ga0070712_100091176 3300006175 Bacteria 2233
108 Ga0070712_100139030 3300006175 Bacteria 1851
109 Ga0070712_100507349 3300006175 Bacteria 1012
110 Ga0075362_10631910 3300006177 Bacteria 555
111 Ga0097621_100049298 3300006237 Bacteria 3420
112 Ga0068871_100046862 3300006358 Bacteria 3483
113 Ga0075428_100040500 3300006844 Bacteria 5125
114 Ga0075430_100000333 3300006846 Bacteria 33874
115 Ga0075431_100086010 3300006847 Bacteria 3245
116 Ga0075433_10181279 3300006852 Bacteria 1874
117 Ga0075433_10494562 3300006852 Bacteria 1077
118 Ga0075433_10609648 3300006852 Bacteria 958
119 Ga0075434_100451988 3300006871 Bacteria 1306
120 Ga0075434_100467868 3300006871 Bacteria 1282
121 Ga0075434_100754353 3300006871 Unclassified 990
122 Ga0075434_100850138 3300006871 Bacteria 928
123 Ga0075434_101058754 3300006871 Bacteria 825
124 Ga0075429_100004085 3300006880 Bacteria 12514
125 Ga0068865_100848829 3300006881 Unclassified 791
126 Ga0075436_100311151 3300006914 Bacteria 1130
127 Ga0075436_100343620 3300006914 Bacteria 1075
128 Ga0075436_100440188 3300006914 Unclassified 948
129 Ga0075435_100050478 3300007076 Bacteria 3348
130 Ga0075435_100617885 3300007076 Bacteria 940
131 Ga0075435_100945372 3300007076 Bacteria 752
132 Ga0075435_101053998 3300007076 Bacteria 710
133 Ga0111539_10423432 3300009094 Bacteria 1551
134 Ga0111539_10509735 3300009094 Bacteria 1401
135 Ga0105245_10007462 3300009098 Bacteria 9576
136 Ga0114129_10317543 3300009147 Bacteria 2072
137 Ga0114129_10467643 3300009147 Unclassified 1652
138 Ga0114129_11078944 3300009147 Bacteria 1006
139 Ga0114129_12119808 3300009147 Bacteria 678
140 Ga0105243_10049410 3300009148 Bacteria 3318
141 Ga0105243_10197538 3300009148 Bacteria 1762
142 Ga0105243_10223429 3300009148 Unclassified 1666
143 Ga0105243_10450181 3300009148 Bacteria 1208
144 Ga0105243_10534355 3300009148 Unclassified 1117
145 Ga0105243_10668721 3300009148 Bacteria 1008
146 Ga0105243_12592359 3300009148 Unclassified 547
147 Ga0105241_10077596 3300009174 Unclassified 2594
148 Ga0105241_12118828 3300009174 Unclassified 556
149 Ga0105242_10595868 3300009176 Bacteria 1067
150 Ga0105242_10631887 3300009176 Bacteria 1039
151 Ga0105242_10746841 3300009176 Unclassified 963
152 Ga0105242_10769666 3300009176 Unclassified 950
153 Ga0105242_11600813 3300009176 Bacteria 685
154 Ga0105242_12282823 3300009176 Unclassified 587
155 Ga0105248_11336194 3300009177 Bacteria 811
156 Ga0105249_10018022 3300009553 Bacteria 6276
157 Ga0105249_11456146 3300009553 Unclassified 757
158 Ga0105249_11699284 3300009553 Bacteria 704
159 Ga0105249_12260751 3300009553 Unclassified 617
160 Ga0105249_13561316 3300009553 Bacteria 502
161 Ga0105239_10667528 3300010375 Bacteria 1188
162 Ga0105239_10704546 3300010375 Bacteria 1154
163 Ga0105239_12013128 3300010375 Bacteria 670
164 Ga0157343_1018994 3300012488 Bacteria 607
165 Ga0157341_1007301 3300012494 Unclassified 876
166 Ga0157345_1020777 3300012498 Bacteria 667
167 Ga0157347_1008632 3300012502 Bacteria 1040
168 Ga0157324_1041946 3300012506 Bacteria 564
169 Ga0157369_11427668 3300013105 Bacteria 704
170 Ga0157378_10603035 3300013297 Bacteria 1109
171 Ga0163162_10373385 3300013306 Unclassified 1559
172 Ga0163162_10436309 3300013306 Bacteria 1442
173 Ga0157372_10433979 3300013307 Bacteria 1531
174 Ga0157375_10533293 3300013308 Bacteria 1336
175 Ga0157375_11602307 3300013308 Bacteria 770
176 Ga0157375_12835743 3300013308 Unclassified 579
177 Ga0182008_10052985 3300014497 Bacteria 2010
178 Ga0157377_10073201 3300014745 Bacteria 1985
179 Ga0157377_10140654 3300014745 Bacteria 1483
180 Ga0157376_10203252 3300014969 Unclassified 1824
181 Ga0182005_1214091 3300015265 Bacteria 584
182 Ga0206356_10063187 3300020070 Bacteria 754
183 Ga0206354_11276381 3300020081 Bacteria 2991
184 Ga0207692_10175366 3300025898 Bacteria 1245
185 Ga0207642_10181000 3300025899 Bacteria 1148
186 Ga0207642_10622305 3300025899 Bacteria 674
187 Ga0207685_10009836 3300025905 Bacteria 2794
188 Ga0207685_10375237 3300025905 Bacteria 723
189 Ga0207699_10014494 3300025906 Bacteria 4065
190 Ga0207699_10021163 3300025906 Bacteria 3500
191 Ga0207643_10397814 3300025908 Unclassified 871
192 Ga0207707_10103464 3300025912 Bacteria 2489
193 Ga0207707_10147072 3300025912 Bacteria 2060
194 Ga0207695_11258790 3300025913 Unclassified 620
195 Ga0207693_10094690 3300025915 Bacteria 2340
196 Ga0207693_10145479 3300025915 Bacteria 1864
197 Ga0207663_10070304 3300025916 Bacteria 2255
198 Ga0207663_10251926 3300025916 Unclassified 1300
199 Ga0207663_10849992 3300025916 Bacteria 728
200 Ga0207663_11735862 3300025916 Bacteria 502
201 Ga0207660_10315290 3300025917 Unclassified 1248
202 Ga0207662_10846506 3300025918 Unclassified 646
203 Ga0207657_10222614 3300025919 Bacteria 1511
204 Ga0207652_10228803 3300025921 Bacteria 1676
205 Ga0207652_10314030 3300025921 Unclassified 1415
206 Ga0207652_10448188 3300025921 Unclassified 1163
207 Ga0207652_10653282 3300025921 Bacteria 940
208 Ga0207646_10677048 3300025922 Bacteria 923
209 Ga0207659_10113338 3300025926 Bacteria 2065
210 Ga0207687_10231798 3300025927 Bacteria 1459
211 Ga0207687_10621554 3300025927 Unclassified 912
212 Ga0207700_10000001 3300025928 Bacteria 1122509
213 Ga0207700_10335390 3300025928 Bacteria 1313
214 Ga0207700_10531911 3300025928 Bacteria 1042
215 Ga0207700_11333524 3300025928 Unclassified 639
216 Ga0207700_11541823 3300025928 Bacteria 589
217 Ga0207664_10002761 3300025929 Bacteria 11663
218 Ga0207664_10021388 3300025929 Bacteria 4809
219 Ga0207664_10470642 3300025929 Bacteria 1123
220 Ga0207664_11230991 3300025929 Unclassified 667
221 Ga0207664_11738432 3300025929 Bacteria 546
222 Ga0207644_11332439 3300025931 Bacteria 603
223 Ga0207690_11524729 3300025932 Bacteria 559
224 Ga0207686_10412405 3300025934 Bacteria 1031
225 Ga0207686_10594504 3300025934 Bacteria 870
226 Ga0207686_11104541 3300025934 Bacteria 647
227 Ga0207686_11492493 3300025934 Unclassified 557
228 Ga0207709_10316977 3300025935 Bacteria 1165
229 Ga0207709_10629400 3300025935 Unclassified 852
230 Ga0207669_10581068 3300025937 Bacteria 908
231 Ga0207669_10969165 3300025937 Bacteria 713
232 Ga0207669_10970902 3300025937 Unclassified 713
233 Ga0207704_11080349 3300025938 Unclassified 681
234 Ga0207665_10012609 3300025939 Bacteria 5556
235 Ga0207665_10032810 3300025939 Unclassified 3438
236 Ga0207691_10217653 3300025940 Bacteria 1657
237 Ga0207691_11427483 3300025940 Bacteria 568
238 Ga0207711_10975408 3300025941 Bacteria 787
239 Ga0207689_10305818 3300025942 Bacteria 1318
240 Ga0207661_10192306 3300025944 Bacteria 1789
241 Ga0207679_10236043 3300025945 Bacteria 1547
242 Ga0207667_11937617 3300025949 Unclassified 551
243 Ga0207651_10351950 3300025960 Bacteria 1241
244 Ga0207651_10605623 3300025960 Bacteria 958
245 Ga0207712_11703360 3300025961 Unclassified 565
246 Ga0207668_11281714 3300025972 Unclassified 659
247 Ga0207640_11900264 3300025981 Unclassified 539
248 Ga0207677_10943982 3300026023 Bacteria 780
249 Ga0207639_11110311 3300026041 Bacteria 742
250 Ga0207678_10746604 3300026067 Bacteria 863
251 Ga0207708_10170441 3300026075 Bacteria 1723
252 Ga0207708_10175335 3300026075 Bacteria 1700
253 Ga0207702_10312904 3300026078 Bacteria 1493
254 Ga0207648_11977073 3300026089 Bacteria 544
255 Ga0207675_100984412 3300026118 Bacteria 861
256 Ga0207683_10010526 3300026121 Bacteria 7894
257 Ga0207683_10312752 3300026121 Bacteria 1438
258 Ga0210000_1020663 3300027462 Bacteria 1005
259 Ga0207428_10011971 3300027907 Bacteria 7636
260 Ga0265337_1112634 3300028556 Bacteria 739
261 Ga0265326_10069509 3300028558 Bacteria 996
262 Ga0265319_1041678 3300028563 Bacteria 1547
263 Ga0265334_10002725 3300028573 Bacteria 8165
264 Ga0265318_10003644 3300028577 Bacteria 7688
265 Ga0265323_10086363 3300028653 Bacteria 1054
266 Ga0265322_10152518 3300028654 Bacteria 660
267 Ga0265336_10155273 3300028666 Bacteria 680
268 Ga0265338_10069553 3300028800 Bacteria 3023
269 Ga0265324_10089528 3300029957 Bacteria 1047
270 Ga0265332_10060171 3300031238 Bacteria 1625
271 Ga0265320_10093214 3300031240 Bacteria 1393
272 Ga0265325_10029097 3300031241 Bacteria 2971
273 Ga0265325_10296443 3300031241 Bacteria 722
274 Ga0265329_10096505 3300031242 Bacteria 939
275 Ga0265340_10011010 3300031247 Bacteria 4822
276 Ga0265339_10210698 3300031249 Bacteria 954
277 Ga0265331_10012554 3300031250 Bacteria 4582
278 Ga0265327_10062722 3300031251 Bacteria 1890
279 Ga0307408_100477074 3300031548 Bacteria 1087
280 Ga0265313_10023198 3300031595 Bacteria 3347
281 Ga0265313_10042510 3300031595 Bacteria 2231
282 Ga0265313_10263293 3300031595 Bacteria 700
283 Ga0265342_10157375 3300031712 Bacteria 1257
284 Ga0307410_10210835 3300031852 Bacteria 1488
285 Ga0307406_11014578 3300031901 Bacteria 712
286 Ga0307407_10061578 3300031903 Bacteria 2194
287 Ga0307412_10407667 3300031911 Bacteria 1108
288 Ga0307409_100585478 3300031995 Bacteria 1100
289 Ga0307416_100243543 3300032002 Bacteria 1744
290 Ga0307411_10388840 3300032005 Bacteria 1149
291 Ga0307415_100856012 3300032126 Bacteria 834
292 Ga0373934_0431501 3300035086 Bacteria 552
293 Ga0373949_0037772 3300035090 Unclassified 1176
294 Ga0373931_0228186 3300035691 Bacteria 1124
295 Ga0373933_1166764 3300035724 Bacteria 508
296 Ga0395899_0066272 3300037312 Bacteria 2652
297 Ga0395899_0172440 3300037312 Bacteria 1523
298 Ga0395899_0272381 3300037312 Unclassified 1154
299 Ga0395899_0317216 3300037312 Bacteria 1051
300 Ga0395900_0032512 3300037418 Bacteria 5365
301 Ga0395900_0109780 3300037418 Bacteria 2834
302 Ga0395900_0136411 3300037418 Bacteria 2514
303 Ga0395900_0154549 3300037418 Bacteria 2343
304 Ga0395900_0190906 3300037418 Bacteria 2078
305 Ga0395900_1591717 3300037418 Bacteria 565
306 Ga0395898_0002023 3300037466 Bacteria 25431
307 Ga0395898_0171783 3300037466 Bacteria 2072
308 Ga0395898_0351037 3300037466 Bacteria 1407
309 Ga0395898_0400380 3300037466 Bacteria 1309
310 Ga0395898_0431477 3300037466 Bacteria 1256
311 Ga0395898_1653180 3300037466 Bacteria 564
312 Ga0395905_1011185 3300037471 Unclassified 734
313 Ga0395905_1043898 3300037471 Bacteria 720
314 Ga0395905_1191513 3300037471 Bacteria 665
315 Ga0395901_0001027 3300038443 Bacteria 30206
316 Ga0395901_0013763 3300038443 Bacteria 8223
317 Ga0395901_0021184 3300038443 Bacteria 6658
318 Ga0395901_0292755 3300038443 Bacteria 1689
319 Ga0395901_0558942 3300038443 Bacteria 1159
320 Ga0395901_0630859 3300038443 Bacteria 1077
321 Ga0395901_0665968 3300038443 Bacteria 1042
322 Ga0395901_0888578 3300038443 Bacteria 874
323 Ga0395901_1237943 3300038443 Bacteria 711
324 Ga0395901_1919301 3300038443 Bacteria 539
325 Ga0451802_1089945 3300041460 Bacteria 632
326 Ga0451804_0841498 3300041463 Bacteria 538
327 Ga0451853_2444498 3300041512 Bacteria 2811
328 Ga0451853_2690126 3300041512 Bacteria 712
329 Ga0451853_3231199 3300041512 Unclassified 585
330 Ga0450915_006130 3300042119 Bacteria 759
331 Ga0450920_007741 3300042122 Bacteria 1950
332 Ga0450906_069106 3300042145 Bacteria 632
333 Ga0439446_0045724 3300042156 Bacteria 1298
334 Ga0439434_0071822 3300042435 Bacteria 1090
335 Ga0439464_0214811 3300042439 Bacteria 616
336 Ga0450916_059800 3300042530 Bacteria 617
337 Ga0466963_0009585 3300044694 Bacteria 5836
338 Ga0466963_0388396 3300044694 Bacteria 984
339 Ga0466964_0025199 3300044706 Bacteria 2321
340 Ga0466957_0872578 3300044842 Unclassified 642
341 Ga0451576_0373651 3300045051 Unclassified 1494
342 Ga0466967_0026977 3300045976 Bacteria 4769
343 Ga0466967_0030306 3300045976 Bacteria 4539
344 Ga0466967_0048093 3300045976 Bacteria 3723
345 Ga0466967_0075359 3300045976 Unclassified 3032
346 Ga0466967_0214631 3300045976 Bacteria 1826
347 Ga0466967_1100242 3300045976 Bacteria 792
348 Ga0495617_267485 3300046452 Bacteria 525
349 Ga0495603_0539215 3300046455 Bacteria 668
350 Ga0495591_040109 3300046458 Bacteria 1337
351 Ga0495629_0035709 3300046459 Bacteria 3512
352 Ga0495629_0230067 3300046459 Bacteria 1278
353 Ga0495651_0590490 3300046462 Bacteria 702
354 Ga0495651_0795622 3300046462 Unclassified 584
355 Ga0495653_0121770 3300046463 Bacteria 1858
356 Ga0495653_0373737 3300046463 Bacteria 912
357 Ga0495582_0267329 3300046473 Bacteria 981
358 Ga0495582_0932281 3300046473 Bacteria 502
359 Ga0495605_0110514 3300046474 Bacteria 1255
360 Ga0495639_0506003 3300046475 Unclassified 617
361 Ga0495584_0289634 3300046491 Bacteria 832
362 Ga0495584_0305423 3300046491 Bacteria 808
363 Ga0495585_0310613 3300046492 Bacteria 773
364 Ga0495596_0108978 3300046500 Bacteria 1075
365 Ga0495607_0466239 3300046501 Unclassified 565
366 Ga0495618_0158698 3300046514 Bacteria 1443
367 Ga0495620_0127964 3300046515 Bacteria 998
368 Ga0495628_0910945 3300046516 Bacteria 610
369 Ga0495630_0022597 3300046517 Bacteria 4646
370 Ga0495643_0405995 3300046522 Unclassified 600
371 Ga0495644_0199612 3300046523 Bacteria 771
372 Ga0495663_0083070 3300046525 Bacteria 1034
373 Ga0495666_0410228 3300046526 Unclassified 608
374 Ga0495652_0820617 3300046529 Unclassified 618
375 Ga0495652_0861252 3300046529 Bacteria 600
376 Ga0495665_0606133 3300046531 Bacteria 547
377 Ga0495598_0079984 3300046537 Bacteria 1047
378 Ga0495609_0356570 3300046538 Unclassified 589
379 Ga0495621_0251014 3300046539 Bacteria 723
380 Ga0495656_0025639 3300046615 Bacteria 2340
381 Ga0495634_0603287 3300046642 Unclassified 637
382 Ga0495635_0026709 3300046663 Bacteria 4015
383 Ga0495635_0062328 3300046663 Bacteria 2561
384 Ga0495635_0127383 3300046663 Bacteria 1736
385 Ga0495661_0203774 3300046665 Unclassified 1034
386 Ga0495588_0074120 3300046674 Bacteria 1773
387 Ga0495657_0498572 3300046675 Bacteria 710
388 Ga0495599_0169215 3300046678 Bacteria 1349
389 Ga0495647_0025414 3300046681 Bacteria 2164
390 Ga0495658_0133550 3300046683 Bacteria 1513
391 Ga0495658_0173608 3300046683 Bacteria 1335
392 Ga0495624_0865407 3300046690 Bacteria 533
393 Ga0495670_0316602 3300046691 Bacteria 837
394 Ga0495671_0480911 3300046692 Bacteria 593
395 Ga0495589_0112144 3300046794 Bacteria 1316
396 Ga0495600_0511114 3300046809 Unclassified 737
397 Ga0495660_0353606 3300046810 Bacteria 653
398 Ga0495660_0485341 3300046810 Unclassified 530
399 Ga0495581_0071228 3300047315 Bacteria 2011
400 Ga0495604_0172428 3300047317 Bacteria 1520
401 Ga0495604_0407204 3300047317 Bacteria 895
402 Ga0495674_0265636 3300047319 Bacteria 1409
403 Ga0495680_0030146 3300047322 Bacteria 4433
404 Ga0495680_0049848 3300047322 Bacteria 3277
405 Ga0495677_0151163 3300047445 Bacteria 894
406 Ga0495677_0402303 3300047445 Unclassified 542
407 Ga0495685_169704 3300047447 Bacteria 705
408 Ga0495684_0162337 3300047471 Bacteria 1666
409 Ga0495602_0435012 3300048088 Bacteria 929
410 Ga0496101_0119223 3300048904 Unclassified 1993
411 Ga0496102_0490996 3300048905 Bacteria 1149
412 Ga0496102_0615822 3300048905 Bacteria 1009
413 Ga0496102_1655968 3300048905 Bacteria 558
414 Ga0496103_0006266 3300048906 Bacteria 7112
415 Ga0496104_0106050 3300048907 Bacteria 2693
416 Ga0496104_0923588 3300048907 Bacteria 777
417 Ga0496104_0973076 3300048907 Bacteria 753
418 Ga0496104_0977873 3300048907 Bacteria 751
419 Ga0496105_0183437 3300048908 Bacteria 1713
420 Ga0496105_0219502 3300048908 Bacteria 1548
421 Ga0496105_0383452 3300048908 Bacteria 1118
422 Ga0496105_0643749 3300048908 Bacteria 818
423 Ga0496105_1096182 3300048908 Bacteria 591
424 Ga0496106_0032921 3300048909 Bacteria 3865
425 Ga0496106_1061003 3300048909 Bacteria 636
426 Ga0496107_0188367 3300048910 Bacteria 1532
427 Ga0496108_0268150 3300048911 Bacteria 1486
428 Ga0496108_0356372 3300048911 Bacteria 1277
429 Ga0496108_0737254 3300048911 Bacteria 853
430 Ga0496109_0420739 3300048912 Bacteria 1262
431 Ga0496110_0059478 3300048913 Bacteria 3368
432 Ga0496110_0389086 3300048913 Unclassified 1271
433 Ga0496110_0401185 3300048913 Bacteria 1250
434 Ga0496110_0431689 3300048913 Bacteria 1201
435 Ga0496111_0064132 3300048914 Bacteria 2665
436 Ga0496111_0076495 3300048914 Bacteria 2440
437 Ga0496111_0255140 3300048914 Bacteria 1301
438 Ga0496111_0307664 3300048914 Bacteria 1174
439 Ga0496111_0910459 3300048914 Bacteria 633
440 Ga0496111_1037814 3300048914 Bacteria 586
441 Ga0496111_1240056 3300048914 Bacteria 527
442 Ga0496112_0009671 3300048915 Bacteria 8700
443 Ga0496112_0141948 3300048915 Bacteria 2371
444 Ga0496112_1171683 3300048915 Bacteria 686
445 Ga0496113_0075668 3300048916 Bacteria 2570
446 Ga0496113_0147261 3300048916 Bacteria 1856
447 Ga0496113_0373212 3300048916 Bacteria 1145
448 Ga0496114_0110440 3300048917 Bacteria 2355
449 Ga0496114_0483428 3300048917 Bacteria 1095
450 Ga0496114_0746578 3300048917 Bacteria 856
451 Ga0496114_1639695 3300048917 Bacteria 531
452 Ga0496115_1046875 3300048918 Bacteria 621
453 Ga0501031_0017899 3300049568 Bacteria 4609
454 Ga0501031_0256959 3300049568 Bacteria 1135
455 Ga0501032_0115837 3300049569 Bacteria 1772
456 Ga0501032_0184215 3300049569 Bacteria 1366
457 Ga0501032_0923152 3300049569 Bacteria 549
458 Ga0501033_0016496 3300049570 Bacteria 5593
459 Ga0501033_0084250 3300049570 Bacteria 2330
460 Ga0501033_0569191 3300049570 Bacteria 779
461 Ga0501034_0040919 3300049571 Bacteria 4689
462 Ga0501036_0004163 3300049572 Bacteria 11645
463 Ga0501036_0042410 3300049572 Bacteria 3852
464 Ga0501036_0329481 3300049572 Bacteria 1276
465 Ga0501037_0057658 3300049573 Unclassified 2835
466 Ga0501037_1143227 3300049573 Unclassified 503
467 Ga0501038_0154462 3300049574 Bacteria 1869
468 Ga0501038_0214524 3300049574 Bacteria 1538
469 Ga0501038_0523011 3300049574 Unclassified 905
470 Ga0501039_0016406 3300049575 Bacteria 5673
471 Ga0501039_0067665 3300049575 Bacteria 2773
472 Ga0501039_0494395 3300049575 Bacteria 960
473 Ga0501039_0624019 3300049575 Bacteria 844
474 Ga0501040_0010016 3300049576 Bacteria 6192
475 Ga0501040_0010968 3300049576 Bacteria 5925
476 Ga0501040_0114302 3300049576 Bacteria 1889
477 Ga0501041_0004287 3300049577 Bacteria 8255
478 Ga0501041_0009614 3300049577 Bacteria 5699
479 Ga0501041_0369228 3300049577 Bacteria 907
480 Ga0501042_0008955 3300049578 Bacteria 6643
481 Ga0501042_0009593 3300049578 Bacteria 6458
482 Ga0501042_0239699 3300049578 Bacteria 1308
483 Ga0501043_0202487 3300049579 Bacteria 1540
484 Ga0501043_0446544 3300049579 Bacteria 972
485 Ga0501046_0164614 3300049580 Bacteria 1666
486 Ga0501046_0426493 3300049580 Bacteria 956
487 Ga0501047_0168510 3300049581 Bacteria 2060
488 Ga0501048_0007159 3300049582 Bacteria 8475
489 Ga0501048_0015958 3300049582 Bacteria 5541
490 Ga0501048_0408766 3300049582 Bacteria 970
491 Ga0501067_0190469 3300049583 Unclassified 1142
492 Ga0501068_0150090 3300049584 Bacteria 1464
493 Ga0501069_0005443 3300049585 Bacteria 6623
494 Ga0501069_0080161 3300049585 Bacteria 1838
495 Ga0501069_0552935 3300049585 Bacteria 689
496 Ga0501070_0002493 3300049586 Bacteria 16126
497 Ga0501070_0069661 3300049586 Bacteria 2912
498 Ga0501070_0371820 3300049586 Unclassified 1159
499 Ga0501070_0414355 3300049586 Bacteria 1088
500 Ga0501071_0008916 3300049587 Bacteria 6653
501 Ga0501071_0075639 3300049587 Bacteria 2458
502 Ga0501071_0284901 3300049587 Bacteria 1251
503 Ga0501072_0009251 3300049588 Bacteria 7489
504 Ga0501072_0012995 3300049588 Bacteria 6371
505 Ga0501072_0017924 3300049588 Bacteria 5444
506 Ga0501072_0062673 3300049588 Bacteria 2932
507 Ga0501073_0017314 3300049589 Bacteria 5220
508 Ga0501073_0059627 3300049589 Bacteria 2665
509 Ga0501073_0202616 3300049589 Unclassified 1372
510 Ga0501074_0005547 3300049590 Bacteria 9075
511 Ga0501074_0009638 3300049590 Bacteria 7009
512 Ga0501074_0015032 3300049590 Bacteria 5631
513 Ga0501074_0018997 3300049590 Bacteria 4993
514 Ga0501074_0089228 3300049590 Bacteria 2208
515 Ga0501074_0154674 3300049590 Bacteria 1639
516 Ga0501075_0007472 3300049591 Bacteria 7578
517 Ga0501075_0020333 3300049591 Bacteria 4827
518 Ga0501075_0037656 3300049591 Bacteria 3614
519 Ga0501075_1164641 3300049591 Unclassified 585
520 Ga0501076_0002105 3300049592 Bacteria 13648
521 Ga0501076_0038944 3300049592 Bacteria 3731
522 Ga0501076_0344722 3300049592 Bacteria 1223
523 Ga0501076_0732718 3300049592 Bacteria 816
524 Ga0501077_0012834 3300049593 Bacteria 5252
525 Ga0501077_0046402 3300049593 Bacteria 2760
526 Ga0501077_0103473 3300049593 Bacteria 1804
527 Ga0501077_0668919 3300049593 Bacteria 667
528 Ga0501079_0009702 3300049741 Bacteria 7298
529 Ga0501079_0059551 3300049741 Bacteria 2945
530 Ga0501079_0079517 3300049741 Bacteria 2535
531 Ga0501079_0108136 3300049741 Bacteria 2159
532 Ga0501079_0123864 3300049741 Bacteria 2011
533 Ga0501080_0004694 3300049742 Bacteria 12188
534 Ga0501080_0069963 3300049742 Bacteria 3264
535 Ga0501080_0183034 3300049742 Bacteria 1927
536 Ga0501080_0190346 3300049742 Bacteria 1885
537 Ga0501080_0502514 3300049742 Bacteria 1083
538 Ga0501080_0638173 3300049742 Bacteria 943
539 Ga0501081_0013273 3300049743 Bacteria 5419
540 Ga0501081_0022366 3300049743 Bacteria 4229
541 Ga0501081_0165369 3300049743 Bacteria 1595
542 Ga0501083_0001091 3300049744 Bacteria 18157
543 Ga0501035_0061309 3300049822 Bacteria 3348
544 Ga0501035_0121607 3300049822 Bacteria 2282
545 Ga0501035_0252977 3300049822 Bacteria 1495
546 Ga0501044_0186942 3300049823 Bacteria 2036
547 Ga0501045_0004900 3300049824 Bacteria 9273
548 Ga0501045_0018642 3300049824 Bacteria 4939
549 Ga0501045_0032494 3300049824 Bacteria 3781
550 Ga0501045_0903620 3300049824 Unclassified 649
551 nmdc:mga03683_196622_c1 3300050489 Bacteria 924
552 nmdc:mga0yw44_209444_c1 3300050492 Bacteria 1289
553 nmdc:mga0yw44_624016_c1 3300050492 Bacteria 732
554 nmdc:mga0yw44_65981_c1 3300050492 Bacteria 2232
555 nmdc:mga05p37_1885560_c1 3300050507 Archaea 572
556 nmdc:mga05p37_376170_c1 3300050507 Bacteria 1666
557 nmdc:mga09592_68985_c1 3300050508 Bacteria 3000
558 nmdc:mga0qj67_153432_c1 3300050509 Bacteria 1869
559 nmdc:mga06r32_133765_c1 3300050510 Bacteria 2454
560 nmdc:mga0n895_206766_c1 3300050512 Bacteria 1993
561 nmdc:mga0n895_355983_c1 3300050512 Bacteria 1482
562 nmdc:mga0n895_656412_c1 3300050512 Bacteria 1047
563 nmdc:mga0n895_683718_c1 3300050512 Bacteria 1023
564 nmdc:mga0n895_741653_c1 3300050512 Bacteria 976
565 nmdc:mga0rr50_1012988_c1 3300050513 Unclassified 707
566 nmdc:mga0rr50_85730_c1 3300050513 Bacteria 2441
567 nmdc:mga0rr50_927020_c1 3300050513 Bacteria 742
568 nmdc:mga08x19_459850_c1 3300050514 Bacteria 896
569 nmdc:mga0a205_246292_c2 3300050515 Unclassified 943
570 nmdc:mga0a205_248857_c1 3300050515 Bacteria 1657
571 Ga0495655_0077087 3300053083 Bacteria 945
572 Ga0495595_0118614 3300053084 Bacteria 1288
573 Ga0495619_0012095 3300053085 Bacteria 5437
574 Ga0495619_0286591 3300053085 Bacteria 1141
575 Ga0501084_0003578 3300054114 Bacteria 12612
576 Ga0501084_0034596 3300054114 Bacteria 4224
577 Ga0501084_0157879 3300054114 Bacteria 1913
578 Ga0501084_0851885 3300054114 Unclassified 767
579 Ga0501084_1029129 3300054114 Bacteria 692
580 Ga0590075_006749 3300059424 Bacteria 2719
581 Ga0501082_0033717 3300060353 Bacteria 4416
582 Ga0501082_0072854 3300060353 Bacteria 2958
583 Ga0501082_0157176 3300060353 Bacteria 1975
584 Ga0466962_0438044 3300061719 Unclassified 657
585 Ga0530510_0043769 3300061734 Bacteria 3234
586 Ga0530510_0095510 3300061734 Bacteria 2171
587 Ga0530510_0274939 3300061734 Bacteria 1257
588 Ga0530510_0569881 3300061734 Bacteria 860
589 Ga0307416_100515764
590 Ga0070676_10335395
591 Ga0070683_100109852
592 Ga0070690_100490262
593 Ga0070680_100623105
594 Ga0070680_102011691
595 Ga0070682_100698011
596 Ga0070682_100872603
597 Ga0068868_100691234
598 Ga0070660_100586917
599 Ga0070668_100023038
600 Ga0070668_101200486
601 Ga0070675_102162963
602 Ga0070671_101355268
603 Ga0070671_101416573
604 Ga0070674_101957420
605 Ga0070673_100654122
606 Ga0070673_101503274
607 Ga0070709_10013139
608 Ga0070709_10043001
609 Ga0070709_11694075
610 Ga0070714_100058301
611 Ga0070714_100224406
612 Ga0070714_100488809
613 Ga0070714_100562626
614 Ga0070714_100717357
615 Ga0070714_101159057
616 Ga0070713_100005402
617 Ga0070713_100119902
618 Ga0070713_100225502
619 Ga0070713_100407889
620 Ga0070710_10054669
621 Ga0070710_10516665
622 Ga0070701_10651336
623 Ga0070711_100215227
624 Ga0070711_100528358
625 Ga0070711_100529503
626 Ga0070705_100012683
627 Ga0070705_100141525
628 Ga0070705_100449879
629 Ga0070700_100140201
630 Ga0070700_101729395
631 Ga0070694_100127866
632 Ga0070694_100403783
633 Ga0070663_100747135
634 Ga0070678_100541785
635 Ga0070662_100015767
636 Ga0070662_101148283
637 Ga0070662_101646919
638 Ga0070681_10115225
639 Ga0070681_10833131
640 Ga0070681_11190590
641 Ga0070707_100554213
642 Ga0070698_100039088
643 Ga0070698_101027432
644 Ga0070698_101335502
645 Ga0070699_100055122
646 Ga0070699_100233560
647 Ga0070699_100318330
648 Ga0070699_100571315
649 Ga0070679_100213071
650 Ga0070679_100240545
651 Ga0070679_100572438
652 Ga0070679_101553878
653 Ga0070684_100004966
654 Ga0070684_100305688
655 Ga0070684_101350689
656 Ga0070697_100752309
657 Ga0070672_101301644
658 Ga0070686_100157430
659 Ga0070686_100446923
660 Ga0070695_100216916
661 Ga0070695_100537902
662 Ga0070696_100110341
663 Ga0070693_100003966
664 Ga0070693_100487472
665 Ga0070704_100244319
666 Ga0070704_100277121
667 Ga0070704_100604788
668 Ga0068855_100118916
669 Ga0068855_101701734
670 Ga0068855_102283781
671 Ga0068854_101961814
672 Ga0068856_100374275
673 Ga0068856_100795917
674 Ga0070702_100421503
675 Ga0068866_10160028
676 Ga0068866_10475313
677 Ga0068866_10601824
678 Ga0068861_100004346
679 Ga0068861_100207101
680 Ga0068870_10947964
681 Ga0068863_100721928
682 Ga0081455_10692735
683 Ga0081538_10102023
684 Ga0081540_1203357
685 Ga0081539_10450854
686 Ga0070717_10198713
687 Ga0075365_10127560
688 Ga0075364_10668459
689 Ga0075432_10008476
690 Ga0070715_10001209
691 Ga0070715_10413179
692 Ga0070716_100008039
693 Ga0070716_100553207
694 Ga0070712_100089301
695 Ga0070712_100091176
696 Ga0070712_100139030
697 Ga0070712_100507349
698 Ga0075362_10631910
699 Ga0097621_100049298
700 Ga0068871_100046862
701 Ga0075428_100040500
702 Ga0075430_100000333
703 Ga0075431_100086010
704 Ga0075433_10181279
705 Ga0075433_10494562
706 Ga0075433_10609648
707 Ga0075434_100451988
708 Ga0075434_100467868
709 Ga0075434_100754353
710 Ga0075434_100850138
711 Ga0075434_101058754
712 Ga0075429_100004085
713 Ga0068865_100848829
714 Ga0075436_100311151
715 Ga0075436_100343620
716 Ga0075436_100440188
717 Ga0075435_100050478
718 Ga0075435_100617885
719 Ga0075435_100945372
720 Ga0075435_101053998
721 Ga0111539_10423432
722 Ga0111539_10509735
723 Ga0105245_10007462
724 Ga0114129_10317543
725 Ga0114129_10467643
726 Ga0114129_11078944
727 Ga0114129_12119808
728 Ga0105243_10049410
729 Ga0105243_10197538
730 Ga0105243_10223429
731 Ga0105243_10450181
732 Ga0105243_10534355
733 Ga0105243_10668721
734 Ga0105243_12592359
735 Ga0105241_10077596
736 Ga0105241_12118828
737 Ga0105242_10595868
738 Ga0105242_10631887
739 Ga0105242_10746841
740 Ga0105242_10769666
741 Ga0105242_11600813
742 Ga0105242_12282823
743 Ga0105248_11336194
744 Ga0105249_10018022
745 Ga0105249_11456146
746 Ga0105249_11699284
747 Ga0105249_12260751
748 Ga0105249_13561316
749 Ga0105239_10667528
750 Ga0105239_10704546
751 Ga0105239_12013128
752 Ga0157343_1018994
753 Ga0157341_1007301
754 Ga0157345_1020777
755 Ga0157347_1008632
756 Ga0157324_1041946
757 Ga0157369_11427668
758 Ga0157378_10603035
759 Ga0163162_10373385
760 Ga0163162_10436309
761 Ga0157372_10433979
762 Ga0157375_10533293
763 Ga0157375_11602307
764 Ga0157375_12835743
765 Ga0182008_10052985
766 Ga0157377_10073201
767 Ga0157377_10140654
768 Ga0157376_10203252
769 Ga0182005_1214091
770 Ga0206356_10063187
771 Ga0206354_11276381
772 Ga0207692_10175366
773 Ga0207642_10181000
774 Ga0207642_10622305
775 Ga0207685_10009836
776 Ga0207685_10375237
777 Ga0207699_10014494
778 Ga0207699_10021163
779 Ga0207643_10397814
780 Ga0207707_10103464
781 Ga0207707_10147072
782 Ga0207695_11258790
783 Ga0207693_10094690
784 Ga0207693_10145479
785 Ga0207663_10070304
786 Ga0207663_10251926
787 Ga0207663_10849992
788 Ga0207663_11735862
789 Ga0207660_10315290
790 Ga0207662_10846506
791 Ga0207657_10222614
792 Ga0207652_10228803
793 Ga0207652_10314030
794 Ga0207652_10448188
795 Ga0207652_10653282
796 Ga0207646_10677048
797 Ga0207659_10113338
798 Ga0207687_10231798
799 Ga0207687_10621554
800 Ga0207700_10000001
801 Ga0207700_10335390
802 Ga0207700_10531911
803 Ga0207700_11333524
804 Ga0207700_11541823
805 Ga0207664_10002761
806 Ga0207664_10021388
807 Ga0207664_10470642
808 Ga0207664_11230991
809 Ga0207664_11738432
810 Ga0207644_11332439
811 Ga0207690_11524729
812 Ga0207686_10412405
813 Ga0207686_10594504
814 Ga0207686_11104541
815 Ga0207686_11492493
816 Ga0207709_10316977
817 Ga0207709_10629400
818 Ga0207669_10581068
819 Ga0207669_10969165
820 Ga0207669_10970902
821 Ga0207704_11080349
822 Ga0207665_10012609
823 Ga0207665_10032810
824 Ga0207691_10217653
825 Ga0207691_11427483
826 Ga0207711_10975408
827 Ga0207689_10305818
828 Ga0207661_10192306
829 Ga0207679_10236043
830 Ga0207667_11937617
831 Ga0207651_10351950
832 Ga0207651_10605623
833 Ga0207712_11703360
834 Ga0207668_11281714
835 Ga0207640_11900264
836 Ga0207677_10943982
837 Ga0207639_11110311
838 Ga0207678_10746604
839 Ga0207708_10170441
840 Ga0207708_10175335
841 Ga0207702_10312904
842 Ga0207648_11977073
843 Ga0207675_100984412
844 Ga0207683_10010526
845 Ga0207683_10312752
846 Ga0210000_1020663
847 Ga0207428_10011971
848 Ga0265337_1112634
849 Ga0265326_10069509
850 Ga0265319_1041678
851 Ga0265334_10002725
852 Ga0265318_10003644
853 Ga0265323_10086363
854 Ga0265322_10152518
855 Ga0265336_10155273
856 Ga0265338_10069553
857 Ga0265324_10089528
858 Ga0265332_10060171
859 Ga0265320_10093214
860 Ga0265325_10029097
861 Ga0265325_10296443
862 Ga0265329_10096505
863 Ga0265340_10011010
864 Ga0265339_10210698
865 Ga0265331_10012554
866 Ga0265327_10062722
867 Ga0307408_100477074
868 Ga0265313_10023198
869 Ga0265313_10042510
870 Ga0265313_10263293
871 Ga0265342_10157375
872 Ga0307410_10210835
873 Ga0307406_11014578
874 Ga0307407_10061578
875 Ga0307412_10407667
876 Ga0307409_100585478
877 Ga0307416_100243543
878 Ga0307411_10388840
879 Ga0307415_100856012
880 Ga0373934_0431501
881 Ga0373949_0037772
882 Ga0373931_0228186
883 Ga0373933_1166764
884 Ga0395899_0066272
885 Ga0395899_0172440
886 Ga0395899_0272381
887 Ga0395899_0317216
888 Ga0395900_0032512
889 Ga0395900_0109780
890 Ga0395900_0136411
891 Ga0395900_0154549
892 Ga0395900_0190906
893 Ga0395900_1591717
894 Ga0395898_0002023
895 Ga0395898_0171783
896 Ga0395898_0351037
897 Ga0395898_0400380
898 Ga0395898_0431477
899 Ga0395898_1653180
900 Ga0395905_1011185
901 Ga0395905_1043898
902 Ga0395905_1191513
903 Ga0395901_0001027
904 Ga0395901_0013763
905 Ga0395901_0021184
906 Ga0395901_0292755
907 Ga0395901_0558942
908 Ga0395901_0630859
909 Ga0395901_0665968
910 Ga0395901_0888578
911 Ga0395901_1237943
912 Ga0395901_1919301
913 Ga0451802_1089945
914 Ga0451804_0841498
915 Ga0451853_2444498
916 Ga0451853_2690126
917 Ga0451853_3231199
918 Ga0450915_006130
919 Ga0450920_007741
920 Ga0450906_069106
921 Ga0439446_0045724
922 Ga0439434_0071822
923 Ga0439464_0214811
924 Ga0450916_059800
925 Ga0466963_0009585
926 Ga0466963_0388396
927 Ga0466964_0025199
928 Ga0466957_0872578
929 Ga0451576_0373651
930 Ga0466967_0026977
931 Ga0466967_0030306
932 Ga0466967_0048093
933 Ga0466967_0075359
934 Ga0466967_0214631
935 Ga0466967_1100242
936 Ga0495617_267485
937 Ga0495603_0539215
938 Ga0495591_040109
939 Ga0495629_0035709
940 Ga0495629_0230067
941 Ga0495651_0590490
942 Ga0495651_0795622
943 Ga0495653_0121770
944 Ga0495653_0373737
945 Ga0495582_0267329
946 Ga0495582_0932281
947 Ga0495605_0110514
948 Ga0495639_0506003
949 Ga0495584_0289634
950 Ga0495584_0305423
951 Ga0495585_0310613
952 Ga0495596_0108978
953 Ga0495607_0466239
954 Ga0495618_0158698
955 Ga0495620_0127964
956 Ga0495628_0910945
957 Ga0495630_0022597
958 Ga0495643_0405995
959 Ga0495644_0199612
960 Ga0495663_0083070
961 Ga0495666_0410228
962 Ga0495652_0820617
963 Ga0495652_0861252
964 Ga0495665_0606133
965 Ga0495598_0079984
966 Ga0495609_0356570
967 Ga0495621_0251014
968 Ga0495656_0025639
969 Ga0495634_0603287
970 Ga0495635_0026709
971 Ga0495635_0062328
972 Ga0495635_0127383
973 Ga0495661_0203774
974 Ga0495588_0074120
975 Ga0495657_0498572
976 Ga0495599_0169215
977 Ga0495647_0025414
978 Ga0495658_0133550
979 Ga0495658_0173608
980 Ga0495624_0865407
981 Ga0495670_0316602
982 Ga0495671_0480911
983 Ga0495589_0112144
984 Ga0495600_0511114
985 Ga0495660_0353606
986 Ga0495660_0485341
987 Ga0495581_0071228
988 Ga0495604_0172428
989 Ga0495604_0407204
990 Ga0495674_0265636
991 Ga0495680_0030146
992 Ga0495680_0049848
993 Ga0495677_0151163
994 Ga0495677_0402303
995 Ga0495685_169704
996 Ga0495684_0162337
997 Ga0495602_0435012
998 Ga0496101_0119223
999 Ga0496102_0490996
1000 Ga0496102_0615822
1001 Ga0496102_1655968
1002 Ga0496103_0006266
1003 Ga0496104_0106050
1004 Ga0496104_0923588
1005 Ga0496104_0973076
1006 Ga0496104_0977873
1007 Ga0496105_0183437
1008 Ga0496105_0219502
1009 Ga0496105_0383452
1010 Ga0496105_0643749
1011 Ga0496105_1096182
1012 Ga0496106_0032921
1013 Ga0496106_1061003
1014 Ga0496107_0188367
1015 Ga0496108_0268150
1016 Ga0496108_0356372
1017 Ga0496108_0737254
1018 Ga0496109_0420739
1019 Ga0496110_0059478
1020 Ga0496110_0389086
1021 Ga0496110_0401185
1022 Ga0496110_0431689
1023 Ga0496111_0064132
1024 Ga0496111_0076495
1025 Ga0496111_0255140
1026 Ga0496111_0307664
1027 Ga0496111_0910459
1028 Ga0496111_1037814
1029 Ga0496111_1240056
1030 Ga0496112_0009671
1031 Ga0496112_0141948
1032 Ga0496112_1171683
1033 Ga0496113_0075668
1034 Ga0496113_0147261
1035 Ga0496113_0373212
1036 Ga0496114_0110440
1037 Ga0496114_0483428
1038 Ga0496114_0746578
1039 Ga0496114_1639695
1040 Ga0496115_1046875
1041 Ga0501031_0017899
1042 Ga0501031_0256959
1043 Ga0501032_0115837
1044 Ga0501032_0184215
1045 Ga0501032_0923152
1046 Ga0501033_0016496
1047 Ga0501033_0084250
1048 Ga0501033_0569191
1049 Ga0501034_0040919
1050 Ga0501036_0004163
1051 Ga0501036_0042410
1052 Ga0501036_0329481
1053 Ga0501037_0057658
1054 Ga0501037_1143227
1055 Ga0501038_0154462
1056 Ga0501038_0214524
1057 Ga0501038_0523011
1058 Ga0501039_0016406
1059 Ga0501039_0067665
1060 Ga0501039_0494395
1061 Ga0501039_0624019
1062 Ga0501040_0010016
1063 Ga0501040_0010968
1064 Ga0501040_0114302
1065 Ga0501041_0004287
1066 Ga0501041_0009614
1067 Ga0501041_0369228
1068 Ga0501042_0008955
1069 Ga0501042_0009593
1070 Ga0501042_0239699
1071 Ga0501043_0202487
1072 Ga0501043_0446544
1073 Ga0501046_0164614
1074 Ga0501046_0426493
1075 Ga0501047_0168510
1076 Ga0501048_0007159
1077 Ga0501048_0015958
1078 Ga0501048_0408766
1079 Ga0501067_0190469
1080 Ga0501068_0150090
1081 Ga0501069_0005443
1082 Ga0501069_0080161
1083 Ga0501069_0552935
1084 Ga0501070_0002493
1085 Ga0501070_0069661
1086 Ga0501070_0371820
1087 Ga0501070_0414355
1088 Ga0501071_0008916
1089 Ga0501071_0075639
1090 Ga0501071_0284901
1091 Ga0501072_0009251
1092 Ga0501072_0012995
1093 Ga0501072_0017924
1094 Ga0501072_0062673
1095 Ga0501073_0017314
1096 Ga0501073_0059627
1097 Ga0501073_0202616
1098 Ga0501074_0005547
1099 Ga0501074_0009638
1100 Ga0501074_0015032
1101 Ga0501074_0018997
1102 Ga0501074_0089228
1103 Ga0501074_0154674
1104 Ga0501075_0007472
1105 Ga0501075_0020333
1106 Ga0501075_0037656
1107 Ga0501075_1164641
1108 Ga0501076_0002105
1109 Ga0501076_0038944
1110 Ga0501076_0344722
1111 Ga0501076_0732718
1112 Ga0501077_0012834
1113 Ga0501077_0046402
1114 Ga0501077_0103473
1115 Ga0501077_0668919
1116 Ga0501079_0009702
1117 Ga0501079_0059551
1118 Ga0501079_0079517
1119 Ga0501079_0108136
1120 Ga0501079_0123864
1121 Ga0501080_0004694
1122 Ga0501080_0069963
1123 Ga0501080_0183034
1124 Ga0501080_0190346
1125 Ga0501080_0502514
1126 Ga0501080_0638173
1127 Ga0501081_0013273
1128 Ga0501081_0022366
1129 Ga0501081_0165369
1130 Ga0501083_0001091
1131 Ga0501035_0061309
1132 Ga0501035_0121607
1133 Ga0501035_0252977
1134 Ga0501044_0186942
1135 Ga0501045_0004900
1136 Ga0501045_0018642
1137 Ga0501045_0032494
1138 Ga0501045_0903620
1139 nmdc:mga03683_196622_c1
1140 nmdc:mga0yw44_209444_c1
1141 nmdc:mga0yw44_624016_c1
1142 nmdc:mga0yw44_65981_c1
1143 nmdc:mga05p37_1885560_c1
1144 nmdc:mga05p37_376170_c1
1145 nmdc:mga09592_68985_c1
1146 nmdc:mga0qj67_153432_c1
1147 nmdc:mga06r32_133765_c1
1148 nmdc:mga0n895_206766_c1
1149 nmdc:mga0n895_355983_c1
1150 nmdc:mga0n895_656412_c1
1151 nmdc:mga0n895_683718_c1
1152 nmdc:mga0n895_741653_c1
1153 nmdc:mga0rr50_1012988_c1
1154 nmdc:mga0rr50_85730_c1
1155 nmdc:mga0rr50_927020_c1
1156 nmdc:mga08x19_459850_c1
1157 nmdc:mga0a205_246292_c2
1158 nmdc:mga0a205_248857_c1
1159 Ga0495655_0077087
1160 Ga0495595_0118614
1161 Ga0495619_0012095
1162 Ga0495619_0286591
1163 Ga0501084_0003578
1164 Ga0501084_0034596
1165 Ga0501084_0157879
1166 Ga0501084_0851885
1167 Ga0501084_1029129
1168 Ga0590075_006749
1169 Ga0501082_0033717
1170 Ga0501082_0072854
1171 Ga0501082_0157176
1172 Ga0466962_0438044
1173 Ga0530510_0043769
1174 Ga0530510_0095510
1175 Ga0530510_0274939
1176 Ga0530510_0569881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10066

DUF2304

Uncharacterized conserved protein (DUF2304)

5

111

0.96

Map