F466754

General Info

Members Datasets Scaffolds Average Seq Length
588 211 1176 123

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10345878|Ga0081455_103458782
Length 128
Sequence MSIPADLKYTESHEWVRTEADGTLTVGITDHAQEALGDIVFAEVPEAGRRVSKGQEAAVVESVKAASDVYAPVSGEVIEGNQAVADDPALINKDPEGEGWFFKLKLDNPGEVEGLMDETAYREWVKTL

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
128 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
137 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
138 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
157 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
158 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
159 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
186 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
187 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
188 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
189 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
190 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
191 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
192 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
193 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
194 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
195 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
196 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
197 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
198 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
199 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
200 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
201 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
202 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
203 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
204 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
205 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
206 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
207 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
208 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 5.27
Rhizosphere 94.56
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10345878 3300005937 Bacteria 1051
2 JGI24737J22298_10008531 3300001990 Bacteria 3427
3 JGI24737J22298_10016480 3300001990 Bacteria 2385
4 JGI24735J21928_10060182 3300002067 Bacteria 1091
5 JGI24735J21928_10073418 3300002067 Bacteria 980
6 JGI24735J21928_10184186 3300002067 Unclassified 605
7 Ga0065712_10173904 3300005290 Bacteria 1228
8 Ga0065715_10396107 3300005293 Bacteria 888
9 Ga0070658_10033070 3300005327 Bacteria 4159
10 Ga0070658_10264094 3300005327 Bacteria 1462
11 Ga0070658_10267376 3300005327 Bacteria 1453
12 Ga0070658_10288810 3300005327 Bacteria 1397
13 Ga0070658_10307343 3300005327 Bacteria 1353
14 Ga0070658_10365371 3300005327 Bacteria 1236
15 Ga0070658_10526966 3300005327 Bacteria 1022
16 Ga0070658_10924445 3300005327 Bacteria 758
17 Ga0070658_11787789 3300005327 Bacteria 532
18 Ga0070676_10070363 3300005328 Bacteria 2099
19 Ga0070676_10583556 3300005328 Bacteria 804
20 Ga0070683_100119033 3300005329 Bacteria 2494
21 Ga0070690_100178021 3300005330 Bacteria 1468
22 Ga0070670_100071376 3300005331 Bacteria 2981
23 Ga0070670_100089790 3300005331 Bacteria 2641
24 Ga0070670_100142662 3300005331 Bacteria 2071
25 Ga0070670_100169084 3300005331 Bacteria 1896
26 Ga0070670_100195211 3300005331 Bacteria 1758
27 Ga0070670_100413356 3300005331 Bacteria 1192
28 Ga0070666_10572498 3300005335 Bacteria 823
29 Ga0070682_100217894 3300005337 Bacteria 1357
30 Ga0070660_100030444 3300005339 Bacteria 4050
31 Ga0070660_100274447 3300005339 Bacteria 1379
32 Ga0070660_100300404 3300005339 Bacteria 1316
33 Ga0070660_100366893 3300005339 Bacteria 1187
34 Ga0070660_100430784 3300005339 Bacteria 1093
35 Ga0070660_100566267 3300005339 Bacteria 948
36 Ga0070660_100703097 3300005339 Bacteria 847
37 Ga0070660_100938643 3300005339 Bacteria 730
38 Ga0070660_101209787 3300005339 Bacteria 641
39 Ga0070689_100579255 3300005340 Bacteria 970
40 Ga0070661_100056625 3300005344 Bacteria 2873
41 Ga0070661_100119530 3300005344 Bacteria 1973
42 Ga0070661_100162180 3300005344 Bacteria 1693
43 Ga0070661_100265861 3300005344 Bacteria 1327
44 Ga0070661_100422572 3300005344 Bacteria 1057
45 Ga0070661_100511603 3300005344 Bacteria 962
46 Ga0070661_100581799 3300005344 Bacteria 903
47 Ga0070668_101802627 3300005347 Bacteria 563
48 Ga0070675_100006226 3300005354 Bacteria 9154
49 Ga0070675_100224270 3300005354 Bacteria 1638
50 Ga0070675_100442137 3300005354 Bacteria 1165
51 Ga0070671_100048194 3300005355 Bacteria 3543
52 Ga0070671_100049237 3300005355 Bacteria 3506
53 Ga0070671_100050435 3300005355 Bacteria 3461
54 Ga0070671_100058750 3300005355 Bacteria 3201
55 Ga0070674_100994785 3300005356 Bacteria 736
56 Ga0070673_100088921 3300005364 Bacteria 2520
57 Ga0070673_100665693 3300005364 Bacteria 954
58 Ga0070673_100889713 3300005364 Bacteria 825
59 Ga0070673_101384988 3300005364 Bacteria 662
60 Ga0070659_100007531 3300005366 Bacteria 7911
61 Ga0070659_100033337 3300005366 Bacteria 3999
62 Ga0070659_100054832 3300005366 Bacteria 3141
63 Ga0070659_100081497 3300005366 Bacteria 2584
64 Ga0070659_100253923 3300005366 Bacteria 1458
65 Ga0070659_100690998 3300005366 Bacteria 882
66 Ga0070659_101145698 3300005366 Bacteria 686
67 Ga0070714_100013505 3300005435 Bacteria 6546
68 Ga0070714_100198475 3300005435 Bacteria 1834
69 Ga0070714_100305108 3300005435 Bacteria 1485
70 Ga0070714_100354429 3300005435 Bacteria 1378
71 Ga0070714_101292940 3300005435 Bacteria 712
72 Ga0070713_100004550 3300005436 Bacteria 9345
73 Ga0070713_100079137 3300005436 Bacteria 2800
74 Ga0070713_101055316 3300005436 Bacteria 785
75 Ga0070711_100744643 3300005439 Bacteria 828
76 Ga0070663_100256507 3300005455 Bacteria 1386
77 Ga0070663_100373496 3300005455 Bacteria 1159
78 Ga0070662_100085191 3300005457 Bacteria 2361
79 Ga0070662_100114719 3300005457 Bacteria 2057
80 Ga0070662_100891639 3300005457 Bacteria 759
81 Ga0070662_101034509 3300005457 Bacteria 704
82 Ga0070662_101474707 3300005457 Bacteria 587
83 Ga0070662_101523729 3300005457 Bacteria 577
84 Ga0070662_101676158 3300005457 Bacteria 549
85 Ga0070662_101962424 3300005457 Bacteria 506
86 Ga0070681_10309201 3300005458 Bacteria 1490
87 Ga0070681_12005907 3300005458 Bacteria 507
88 Ga0070679_100538385 3300005530 Bacteria 1111
89 Ga0070679_100671656 3300005530 Bacteria 979
90 Ga0070679_100857226 3300005530 Bacteria 852
91 Ga0070684_100030536 3300005535 Bacteria 4578
92 Ga0068853_100192920 3300005539 Bacteria 1851
93 Ga0068853_100321512 3300005539 Bacteria 1434
94 Ga0068853_100716742 3300005539 Bacteria 955
95 Ga0068853_100826723 3300005539 Bacteria 888
96 Ga0070672_100183162 3300005543 Bacteria 1746
97 Ga0070672_100357734 3300005543 Bacteria 1245
98 Ga0070672_100945232 3300005543 Bacteria 762
99 Ga0070665_100014260 3300005548 Bacteria 7980
100 Ga0068855_100204754 3300005563 Bacteria 2220
101 Ga0068855_100711794 3300005563 Bacteria 1074
102 Ga0070664_100007808 3300005564 Bacteria 8641
103 Ga0070664_100014625 3300005564 Bacteria 6405
104 Ga0070664_100380620 3300005564 Bacteria 1288
105 Ga0070664_100427997 3300005564 Bacteria 1213
106 Ga0070664_100542853 3300005564 Bacteria 1074
107 Ga0070664_101306522 3300005564 Bacteria 685
108 Ga0068857_100099059 3300005577 Bacteria 2614
109 Ga0068857_100411307 3300005577 Bacteria 1260
110 Ga0068857_100495703 3300005577 Bacteria 1146
111 Ga0068854_100072479 3300005578 Bacteria 2522
112 Ga0068854_100072644 3300005578 Bacteria 2519
113 Ga0068854_100189662 3300005578 Bacteria 1610
114 Ga0068854_101356267 3300005578 Bacteria 642
115 Ga0068854_101599327 3300005578 Bacteria 594
116 Ga0068856_100106242 3300005614 Bacteria 2802
117 Ga0068856_100284964 3300005614 Bacteria 1669
118 Ga0068856_101414462 3300005614 Bacteria 710
119 Ga0068852_100054213 3300005616 Bacteria 3455
120 Ga0068852_100149354 3300005616 Bacteria 2171
121 Ga0068852_100191435 3300005616 Bacteria 1930
122 Ga0068852_100676264 3300005616 Bacteria 1041
123 Ga0068852_100683591 3300005616 Bacteria 1035
124 Ga0068852_100871668 3300005616 Bacteria 917
125 Ga0068852_101536935 3300005616 Bacteria 688
126 Ga0068859_100096036 3300005617 Bacteria 3017
127 Ga0068864_100041329 3300005618 Bacteria 3944
128 Ga0068864_100437461 3300005618 Bacteria 1249
129 Ga0068861_100789289 3300005719 Bacteria 890
130 Ga0068851_10659327 3300005834 Bacteria 641
131 Ga0068870_10305970 3300005840 Bacteria 1005
132 Ga0068863_100005172 3300005841 Bacteria 12867
133 Ga0068863_100963360 3300005841 Bacteria 855
134 Ga0068863_101026399 3300005841 Bacteria 828
135 Ga0068858_100028177 3300005842 Bacteria 5219
136 Ga0068860_102273653 3300005843 Bacteria 563
137 Ga0068862_100723651 3300005844 Bacteria 966
138 Ga0070716_100164101 3300006173 Bacteria 1443
139 Ga0075366_10310133 3300006195 Bacteria 966
140 Ga0097621_100072431 3300006237 Bacteria 2850
141 Ga0097621_100446836 3300006237 Bacteria 1164
142 Ga0068871_100314818 3300006358 Bacteria 1377
143 Ga0097620_100096039 3300006931 Bacteria 3017
144 Ga0105240_10243201 3300009093 Bacteria 2085
145 Ga0105240_10281264 3300009093 Bacteria 1911
146 Ga0105247_10615209 3300009101 Bacteria 807
147 Ga0105241_10331965 3300009174 Bacteria 1315
148 Ga0105241_12180101 3300009174 Bacteria 549
149 Ga0105242_11518271 3300009176 Bacteria 701
150 Ga0105248_10016854 3300009177 Bacteria 8041
151 Ga0105248_10062708 3300009177 Bacteria 4173
152 Ga0105248_10413203 3300009177 Bacteria 1519
153 Ga0105248_10533333 3300009177 Bacteria 1324
154 Ga0105248_10622417 3300009177 Bacteria 1218
155 Ga0105237_10139852 3300009545 Bacteria 2415
156 Ga0105238_10888726 3300009551 Bacteria 909
157 Ga0105238_10992032 3300009551 Bacteria 860
158 Ga0105238_11374706 3300009551 Bacteria 733
159 Ga0105246_10446382 3300011119 Bacteria 1086
160 Ga0157373_10008053 3300013100 Bacteria 7832
161 Ga0157373_10071021 3300013100 Bacteria 2460
162 Ga0157373_10078062 3300013100 Bacteria 2335
163 Ga0157373_10242384 3300013100 Bacteria 1274
164 Ga0157371_10515629 3300013102 Bacteria 884
165 Ga0157371_11451294 3300013102 Bacteria 534
166 Ga0157370_10000244 3300013104 Bacteria 69583
167 Ga0157370_10270796 3300013104 Bacteria 1569
168 Ga0157369_10341427 3300013105 Bacteria 1556
169 Ga0157374_10206139 3300013296 Bacteria 1927
170 Ga0163162_10266958 3300013306 Bacteria 1843
171 Ga0157372_12778705 3300013307 Bacteria 561
172 Ga0157375_10258963 3300013308 Bacteria 1901
173 Ga0157375_10286339 3300013308 Bacteria 1811
174 Ga0163163_10512722 3300014325 Bacteria 1261
175 Ga0157379_10788684 3300014968 Bacteria 896
176 Ga0157376_10344594 3300014969 Bacteria 1424
177 Ga0207697_10176640 3300025315 Bacteria 935
178 Ga0207682_10065427 3300025893 Bacteria 1530
179 Ga0207688_10466478 3300025901 Bacteria 788
180 Ga0207680_10247206 3300025903 Bacteria 1231
181 Ga0207680_11186331 3300025903 Bacteria 545
182 Ga0207647_10048740 3300025904 Bacteria 2630
183 Ga0207647_10124199 3300025904 Bacteria 1520
184 Ga0207647_10137869 3300025904 Bacteria 1431
185 Ga0207645_10050098 3300025907 Bacteria 2666
186 Ga0207645_10483312 3300025907 Bacteria 838
187 Ga0207645_10597444 3300025907 Bacteria 749
188 Ga0207643_10402225 3300025908 Bacteria 866
189 Ga0207705_10019747 3300025909 Bacteria 4818
190 Ga0207705_10129032 3300025909 Bacteria 1880
191 Ga0207705_10132864 3300025909 Bacteria 1853
192 Ga0207705_10162420 3300025909 Bacteria 1679
193 Ga0207705_10249060 3300025909 Bacteria 1355
194 Ga0207705_10514172 3300025909 Bacteria 930
195 Ga0207705_10642921 3300025909 Bacteria 825
196 Ga0207705_10654738 3300025909 Bacteria 817
197 Ga0207705_10901625 3300025909 Bacteria 685
198 Ga0207705_11177973 3300025909 Bacteria 588
199 Ga0207705_11265792 3300025909 Bacteria 564
200 Ga0207705_11484813 3300025909 Bacteria 514
201 Ga0207654_10784025 3300025911 Bacteria 688
202 Ga0207695_10513699 3300025913 Bacteria 1080
203 Ga0207695_11376108 3300025913 Bacteria 586
204 Ga0207693_10765612 3300025915 Bacteria 745
205 Ga0207660_10691392 3300025917 Bacteria 832
206 Ga0207660_10946205 3300025917 Bacteria 703
207 Ga0207657_10038463 3300025919 Bacteria 4258
208 Ga0207657_10232545 3300025919 Bacteria 1474
209 Ga0207657_10234823 3300025919 Bacteria 1466
210 Ga0207657_10361189 3300025919 Bacteria 1145
211 Ga0207657_10396676 3300025919 Bacteria 1085
212 Ga0207649_10056165 3300025920 Bacteria 2457
213 Ga0207649_10191476 3300025920 Bacteria 1439
214 Ga0207649_10582286 3300025920 Bacteria 859
215 Ga0207649_11371643 3300025920 Bacteria 559
216 Ga0207652_10149220 3300025921 Bacteria 2093
217 Ga0207652_10483508 3300025921 Bacteria 1115
218 Ga0207681_11713553 3300025923 Bacteria 525
219 Ga0207694_11260493 3300025924 Bacteria 625
220 Ga0207650_10036302 3300025925 Bacteria 3585
221 Ga0207650_10066030 3300025925 Bacteria 2712
222 Ga0207650_10066426 3300025925 Bacteria 2704
223 Ga0207650_10104922 3300025925 Bacteria 2181
224 Ga0207650_10243584 3300025925 Bacteria 1454
225 Ga0207650_11015332 3300025925 Bacteria 706
226 Ga0207659_10117920 3300025926 Bacteria 2029
227 Ga0207700_10121324 3300025928 Bacteria 2120
228 Ga0207700_10720019 3300025928 Bacteria 891
229 Ga0207700_11197406 3300025928 Bacteria 678
230 Ga0207664_10207666 3300025929 Bacteria 1693
231 Ga0207664_10256828 3300025929 Bacteria 1527
232 Ga0207664_10352873 3300025929 Bacteria 1302
233 Ga0207664_10379923 3300025929 Bacteria 1254
234 Ga0207644_10044514 3300025931 Bacteria 3153
235 Ga0207644_10085310 3300025931 Bacteria 2342
236 Ga0207644_10171825 3300025931 Bacteria 1692
237 Ga0207690_10044634 3300025932 Bacteria 2923
238 Ga0207690_10066862 3300025932 Bacteria 2463
239 Ga0207690_10147036 3300025932 Bacteria 1743
240 Ga0207690_10164999 3300025932 Bacteria 1655
241 Ga0207690_10197151 3300025932 Bacteria 1527
242 Ga0207690_10214211 3300025932 Bacteria 1470
243 Ga0207690_10238372 3300025932 Bacteria 1400
244 Ga0207690_10352657 3300025932 Bacteria 1164
245 Ga0207690_11240333 3300025932 Bacteria 623
246 Ga0207706_10132789 3300025933 Bacteria 2190
247 Ga0207706_10449274 3300025933 Bacteria 1115
248 Ga0207706_11356584 3300025933 Bacteria 585
249 Ga0207706_11398727 3300025933 Bacteria 574
250 Ga0207706_11694540 3300025933 Bacteria 509
251 Ga0207670_10466000 3300025936 Bacteria 1021
252 Ga0207670_11038595 3300025936 Bacteria 690
253 Ga0207665_10073526 3300025939 Bacteria 2338
254 Ga0207691_10043931 3300025940 Bacteria 4115
255 Ga0207691_10289575 3300025940 Bacteria 1409
256 Ga0207711_10019496 3300025941 Bacteria 5646
257 Ga0207711_10384555 3300025941 Bacteria 1302
258 Ga0207711_10417060 3300025941 Bacteria 1248
259 Ga0207711_10435119 3300025941 Bacteria 1221
260 Ga0207679_10002410 3300025945 Bacteria 11527
261 Ga0207679_10118708 3300025945 Bacteria 2101
262 Ga0207679_10526059 3300025945 Bacteria 1058
263 Ga0207679_10699357 3300025945 Bacteria 920
264 Ga0207679_10731683 3300025945 Bacteria 899
265 Ga0207679_11127674 3300025945 Bacteria 720
266 Ga0207679_11218865 3300025945 Bacteria 691
267 Ga0207679_11464328 3300025945 Bacteria 626
268 Ga0207679_11500641 3300025945 Bacteria 618
269 Ga0207667_10097780 3300025949 Bacteria 3029
270 Ga0207667_10263308 3300025949 Bacteria 1763
271 Ga0207667_10838198 3300025949 Bacteria 914
272 Ga0207651_10119363 3300025960 Bacteria 1996
273 Ga0207651_10488876 3300025960 Bacteria 1062
274 Ga0207651_10636316 3300025960 Bacteria 935
275 Ga0207651_10680957 3300025960 Bacteria 905
276 Ga0207712_10937952 3300025961 Bacteria 766
277 Ga0207668_11992189 3300025972 Bacteria 523
278 Ga0207640_10240665 3300025981 Bacteria 1398
279 Ga0207640_10486130 3300025981 Bacteria 1025
280 Ga0207640_11971474 3300025981 Bacteria 529
281 Ga0207658_10496412 3300025986 Bacteria 1087
282 Ga0207658_11657686 3300025986 Bacteria 584
283 Ga0207677_10580693 3300026023 Bacteria 981
284 Ga0207677_10923036 3300026023 Bacteria 788
285 Ga0207703_10195150 3300026035 Bacteria 1796
286 Ga0207703_10339444 3300026035 Bacteria 1380
287 Ga0207639_10258000 3300026041 Bacteria 1523
288 Ga0207639_10259684 3300026041 Bacteria 1519
289 Ga0207639_10267499 3300026041 Bacteria 1498
290 Ga0207678_10163930 3300026067 Bacteria 1898
291 Ga0207678_10190872 3300026067 Bacteria 1751
292 Ga0207678_10542987 3300026067 Bacteria 1016
293 Ga0207678_11393258 3300026067 Bacteria 620
294 Ga0207678_11569281 3300026067 Bacteria 580
295 Ga0207702_10251692 3300026078 Bacteria 1659
296 Ga0207702_10782989 3300026078 Bacteria 942
297 Ga0207702_11191226 3300026078 Bacteria 756
298 Ga0207641_10105640 3300026088 Bacteria 2487
299 Ga0207641_10462336 3300026088 Bacteria 1228
300 Ga0207641_10550899 3300026088 Bacteria 1125
301 Ga0207641_10675980 3300026088 Bacteria 1015
302 Ga0207648_10487149 3300026089 Bacteria 1127
303 Ga0207676_10028314 3300026095 Bacteria 4184
304 Ga0207674_10000057 3300026116 Bacteria 113117
305 Ga0207674_10084179 3300026116 Bacteria 3179
306 Ga0207674_10212664 3300026116 Bacteria 1882
307 Ga0207674_10226578 3300026116 Bacteria 1817
308 Ga0207674_11570916 3300026116 Bacteria 627
309 Ga0207698_10087966 3300026142 Bacteria 2532
310 Ga0207698_10356188 3300026142 Bacteria 1384
311 Ga0209974_10120157 3300027876 Bacteria 930
312 Ga0268266_10053406 3300028379 Bacteria 3471
313 Ga0268265_11673135 3300028380 Bacteria 642
314 Ga0268264_10474911 3300028381 Bacteria 1215
315 Ga0307408_100076242 3300031548 Bacteria 2493
316 Ga0307408_100737335 3300031548 Bacteria 889
317 Ga0307405_10088268 3300031731 Bacteria 2046
318 Ga0307405_10124802 3300031731 Bacteria 1768
319 Ga0307405_10153782 3300031731 Bacteria 1621
320 Ga0307405_10617122 3300031731 Bacteria 887
321 Ga0307405_10742851 3300031731 Bacteria 817
322 Ga0307405_10919643 3300031731 Bacteria 741
323 Ga0307405_12027593 3300031731 Bacteria 515
324 Ga0307413_10036139 3300031824 Bacteria 2841
325 Ga0307413_10059983 3300031824 Bacteria 2340
326 Ga0307413_10500975 3300031824 Bacteria 975
327 Ga0307410_10080135 3300031852 Bacteria 2290
328 Ga0307410_10149623 3300031852 Bacteria 1736
329 Ga0307410_10462117 3300031852 Bacteria 1037
330 Ga0307406_10050540 3300031901 Bacteria 2636
331 Ga0307406_10662630 3300031901 Bacteria 867
332 Ga0307406_10699881 3300031901 Bacteria 846
333 Ga0307407_10072901 3300031903 Bacteria 2049
334 Ga0307407_10798569 3300031903 Bacteria 718
335 Ga0307407_10952740 3300031903 Bacteria 661
336 Ga0307412_10008288 3300031911 Bacteria 5924
337 Ga0307412_10180654 3300031911 Bacteria 1587
338 Ga0307412_10781053 3300031911 Bacteria 827
339 Ga0307412_10781378 3300031911 Bacteria 827
340 Ga0307409_100115335 3300031995 Bacteria 2261
341 Ga0307409_100137857 3300031995 Bacteria 2097
342 Ga0307409_100170988 3300031995 Bacteria 1912
343 Ga0307409_100177796 3300031995 Bacteria 1880
344 Ga0307409_100546980 3300031995 Bacteria 1136
345 Ga0307409_100606704 3300031995 Bacteria 1082
346 Ga0307416_100055492 3300032002 Bacteria 3191
347 Ga0307416_100097875 3300032002 Bacteria 2542
348 Ga0307416_100109074 3300032002 Bacteria 2434
349 Ga0307416_100265713 3300032002 Bacteria 1680
350 Ga0307416_100407153 3300032002 Bacteria 1400
351 Ga0307416_101172479 3300032002 Bacteria 873
352 Ga0307416_101249818 3300032002 Bacteria 848
353 Ga0307416_101533877 3300032002 Bacteria 772
354 Ga0307414_10054722 3300032004 Bacteria 2790
355 Ga0307414_10573860 3300032004 Bacteria 1008
356 Ga0307411_10006842 3300032005 Bacteria 5743
357 Ga0307411_10080528 3300032005 Bacteria 2239
358 Ga0307411_10258737 3300032005 Bacteria 1373
359 Ga0307411_10468035 3300032005 Bacteria 1058
360 Ga0307411_10750791 3300032005 Bacteria 855
361 Ga0307415_100016301 3300032126 Bacteria 4426
362 Ga0307415_100045410 3300032126 Bacteria 2945
363 Ga0307415_100046234 3300032126 Bacteria 2923
364 Ga0307415_100355103 3300032126 Bacteria 1235
365 Ga0307415_100862918 3300032126 Bacteria 831
366 Ga0373959_0081568 3300034820 Bacteria 746
367 Ga0373944_0032198 3300035089 Bacteria 1582
368 Ga0373957_0113688 3300035120 Bacteria 1092
369 Ga0373943_0004664 3300035170 Bacteria 6200
370 Ga0373943_0115875 3300035170 Bacteria 1419
371 Ga0373943_0221047 3300035170 Bacteria 1055
372 Ga0373946_0108102 3300035171 Bacteria 1255
373 Ga0373942_0148419 3300035207 Bacteria 752
374 Ga0373935_0159399 3300035692 Bacteria 1537
375 Ga0373927_0605913 3300035695 Bacteria 724
376 Ga0373925_0008528 3300037068 Bacteria 7469
377 Ga0395899_0016561 3300037312 Bacteria 5623
378 Ga0395899_0041538 3300037312 Bacteria 3436
379 Ga0395899_0056572 3300037312 Bacteria 2898
380 Ga0395899_0060818 3300037312 Bacteria 2782
381 Ga0395899_0064313 3300037312 Bacteria 2697
382 Ga0395899_0081287 3300037312 Bacteria 2358
383 Ga0395899_0081372 3300037312 Bacteria 2356
384 Ga0395899_0082493 3300037312 Bacteria 2339
385 Ga0395899_0103250 3300037312 Bacteria 2056
386 Ga0395899_0199651 3300037312 Bacteria 1395
387 Ga0395899_0209412 3300037312 Bacteria 1355
388 Ga0395899_0348862 3300037312 Bacteria 990
389 Ga0395899_0476262 3300037312 Bacteria 813
390 Ga0395899_0615078 3300037312 Bacteria 690
391 Ga0395899_0659973 3300037312 Bacteria 660
392 Ga0395900_0022977 3300037418 Bacteria 6382
393 Ga0395900_0073510 3300037418 Bacteria 3515
394 Ga0395900_0097935 3300037418 Bacteria 3013
395 Ga0395900_0104036 3300037418 Bacteria 2916
396 Ga0395900_0108554 3300037418 Bacteria 2851
397 Ga0395900_0139626 3300037418 Bacteria 2482
398 Ga0395900_0150843 3300037418 Bacteria 2374
399 Ga0395900_0189863 3300037418 Bacteria 2084
400 Ga0395900_0193085 3300037418 Bacteria 2064
401 Ga0395900_0199911 3300037418 Bacteria 2023
402 Ga0395900_0229912 3300037418 Bacteria 1865
403 Ga0395900_0261561 3300037418 Bacteria 1728
404 Ga0395900_0270598 3300037418 Bacteria 1693
405 Ga0395900_0325403 3300037418 Bacteria 1516
406 Ga0395900_0422783 3300037418 Bacteria 1293
407 Ga0395900_0501702 3300037418 Bacteria 1164
408 Ga0395900_0632275 3300037418 Bacteria 1008
409 Ga0395900_0750482 3300037418 Bacteria 906
410 Ga0395900_0876917 3300037418 Bacteria 822
411 Ga0395900_1769603 3300037418 Bacteria 528
412 Ga0395900_1789970 3300037418 Bacteria 525
413 Ga0395898_0000732 3300037466 Bacteria 57501
414 Ga0395898_0012439 3300037466 Bacteria 8797
415 Ga0395898_0074631 3300037466 Bacteria 3275
416 Ga0395898_0114883 3300037466 Bacteria 2579
417 Ga0395898_0138154 3300037466 Bacteria 2333
418 Ga0395898_0138805 3300037466 Bacteria 2327
419 Ga0395898_0153026 3300037466 Bacteria 2206
420 Ga0395898_0176264 3300037466 Bacteria 2043
421 Ga0395898_0240366 3300037466 Bacteria 1727
422 Ga0395898_0252293 3300037466 Bacteria 1683
423 Ga0395898_0397222 3300037466 Bacteria 1314
424 Ga0395898_0638714 3300037466 Bacteria 1007
425 Ga0395898_1563413 3300037466 Bacteria 584
426 Ga0395898_1631106 3300037466 Bacteria 569
427 Ga0395905_0000092 3300037471 Bacteria 149300
428 Ga0395905_0011073 3300037471 Bacteria 8730
429 Ga0395905_0014833 3300037471 Bacteria 7431
430 Ga0395905_0028903 3300037471 Bacteria 5225
431 Ga0395905_0041471 3300037471 Bacteria 4319
432 Ga0395905_0058595 3300037471 Bacteria 3601
433 Ga0395905_0062158 3300037471 Bacteria 3493
434 Ga0395905_0067402 3300037471 Bacteria 3352
435 Ga0395905_0083659 3300037471 Bacteria 2989
436 Ga0395905_0104548 3300037471 Bacteria 2658
437 Ga0395905_0123101 3300037471 Bacteria 2438
438 Ga0395905_0166679 3300037471 Bacteria 2070
439 Ga0395905_0169343 3300037471 Bacteria 2052
440 Ga0395905_0261257 3300037471 Bacteria 1616
441 Ga0395905_0280427 3300037471 Bacteria 1552
442 Ga0395905_0372824 3300037471 Bacteria 1321
443 Ga0395905_0450775 3300037471 Bacteria 1184
444 Ga0395905_0487311 3300037471 Bacteria 1132
445 Ga0395905_0726305 3300037471 Bacteria 895
446 Ga0395905_1343044 3300037471 Bacteria 619
447 Ga0395901_0028073 3300038443 Bacteria 5788
448 Ga0395901_0053143 3300038443 Bacteria 4210
449 Ga0395901_0062328 3300038443 Bacteria 3880
450 Ga0395901_0108531 3300038443 Bacteria 2913
451 Ga0395901_0122320 3300038443 Bacteria 2735
452 Ga0395901_0177942 3300038443 Bacteria 2231
453 Ga0395901_0228490 3300038443 Bacteria 1943
454 Ga0395901_0307783 3300038443 Bacteria 1641
455 Ga0395901_0325186 3300038443 Bacteria 1590
456 Ga0395901_0430049 3300038443 Bacteria 1352
457 Ga0395901_0487432 3300038443 Bacteria 1256
458 Ga0395901_0533091 3300038443 Bacteria 1191
459 Ga0395901_0775729 3300038443 Bacteria 949
460 Ga0395901_1113493 3300038443 Bacteria 759
461 Ga0395901_1262314 3300038443 Bacteria 702
462 Ga0395901_1377292 3300038443 Bacteria 665
463 Ga0395901_1495292 3300038443 Bacteria 631
464 Ga0395901_1912385 3300038443 Bacteria 541
465 Ga0395901_1930253 3300038443 Bacteria 537
466 Ga0395901_2078734 3300038443 Bacteria 513
467 Ga0439439_0099916 3300041406 Bacteria 798
468 Ga0439448_0012995 3300042005 Bacteria 2498
469 Ga0439432_012088 3300042006 Bacteria 2962
470 Ga0439432_196459 3300042006 Bacteria 585
471 Ga0439449_0044378 3300042007 Bacteria 1649
472 Ga0450889_015521 3300042144 Bacteria 818
473 Ga0439458_0002822 3300042157 Bacteria 4182
474 Ga0439458_0004947 3300042157 Bacteria 3021
475 Ga0451577_0265306 3300042876 Bacteria 1555
476 Ga0466969_0027047 3300044656 Bacteria 2939
477 Ga0466969_0135592 3300044656 Bacteria 1140
478 Ga0466972_0136900 3300044658 Bacteria 1153
479 Ga0466972_0184344 3300044658 Bacteria 978
480 Ga0466965_0273730 3300044683 Bacteria 910
481 Ga0466965_0327301 3300044683 Bacteria 836
482 Ga0466966_0016600 3300044684 Bacteria 4863
483 Ga0466966_0060507 3300044684 Bacteria 2390
484 Ga0466966_0207188 3300044684 Bacteria 1186
485 Ga0466966_0401464 3300044684 Bacteria 824
486 Ga0466966_0549857 3300044684 Bacteria 695
487 Ga0466961_0021643 3300044693 Bacteria 4137
488 Ga0466961_0064799 3300044693 Bacteria 2322
489 Ga0466961_0363698 3300044693 Bacteria 880
490 Ga0466961_0500896 3300044693 Bacteria 733
491 Ga0466963_0091010 3300044694 Bacteria 2077
492 Ga0466963_0192181 3300044694 Bacteria 1426
493 Ga0466963_0446032 3300044694 Bacteria 913
494 Ga0466963_0666226 3300044694 Bacteria 734
495 Ga0466963_0885419 3300044694 Bacteria 629
496 Ga0466971_0029751 3300044719 Bacteria 2443
497 Ga0466971_0033879 3300044719 Bacteria 2288
498 Ga0466971_0387337 3300044719 Bacteria 680
499 Ga0466970_0050616 3300044765 Bacteria 2216
500 Ga0466970_0307738 3300044765 Bacteria 894
501 Ga0466957_0068253 3300044842 Bacteria 2195
502 Ga0466957_0404385 3300044842 Bacteria 934
503 Ga0466957_0623676 3300044842 Bacteria 756
504 Ga0466960_0185229 3300044901 Bacteria 1130
505 Ga0466959_0083517 3300045049 Bacteria 2300
506 Ga0466959_0084232 3300045049 Bacteria 2288
507 Ga0466959_0089835 3300045049 Bacteria 2207
508 Ga0466959_0458576 3300045049 Bacteria 864
509 Ga0466959_0710617 3300045049 Bacteria 673
510 Ga0466959_0903773 3300045049 Bacteria 589
511 Ga0466958_0069245 3300045836 Bacteria 2157
512 Ga0466958_0200708 3300045836 Bacteria 1269
513 Ga0466967_0108675 3300045976 Bacteria 2545
514 Ga0466967_0132640 3300045976 Bacteria 2314
515 Ga0466967_0355194 3300045976 Bacteria 1419
516 Ga0466967_1124937 3300045976 Bacteria 782
517 Ga0466967_1284563 3300045976 Bacteria 729
518 Ga0495643_0524537 3300046522 Bacteria 507
519 Ga0495669_0007257 3300046684 Bacteria 4644
520 Ga0495669_0088249 3300046684 Bacteria 1429
521 Ga0495669_0179137 3300046684 Bacteria 1010
522 Ga0495669_0253872 3300046684 Bacteria 844
523 Ga0495670_0039441 3300046691 Bacteria 2356
524 Ga0495677_0011348 3300047445 Bacteria 3261
525 Ga0496100_0020622 3300048903 Bacteria 3955
526 Ga0496100_0505175 3300048903 Bacteria 932
527 Ga0496100_0524473 3300048903 Bacteria 914
528 Ga0496101_0090173 3300048904 Bacteria 2280
529 Ga0496101_0452857 3300048904 Bacteria 1012
530 Ga0496102_0099246 3300048905 Bacteria 2703
531 Ga0496105_0282513 3300048908 Bacteria 1338
532 Ga0496106_0701661 3300048909 Bacteria 806
533 Ga0496107_0331108 3300048910 Bacteria 1133
534 Ga0496107_0380886 3300048910 Bacteria 1049
535 Ga0496108_0023926 3300048911 Bacteria 5028
536 Ga0496108_0050944 3300048911 Bacteria 3468
537 Ga0496108_0349543 3300048911 Bacteria 1290
538 Ga0496109_0035102 3300048912 Bacteria 4521
539 Ga0496109_0266486 3300048912 Bacteria 1614
540 Ga0496109_0374320 3300048912 Bacteria 1345
541 Ga0496109_1021804 3300048912 Bacteria 764
542 Ga0496110_0048504 3300048913 Bacteria 3723
543 Ga0496110_0701537 3300048913 Bacteria 913
544 Ga0496111_0022359 3300048914 Bacteria 4426
545 Ga0496111_0096990 3300048914 Bacteria 2164
546 Ga0496111_0163542 3300048914 Bacteria 1653
547 Ga0496112_0084181 3300048915 Bacteria 3145
548 Ga0496112_0139742 3300048915 Bacteria 2391
549 Ga0496112_0355126 3300048915 Bacteria 1408
550 Ga0496112_0849839 3300048915 Bacteria 836
551 Ga0496113_0160248 3300048916 Bacteria 1778
552 Ga0496114_0012975 3300048917 Bacteria 6677
553 Ga0496114_0049494 3300048917 Bacteria 3497
554 Ga0496115_0002002 3300048918 Bacteria 14567
555 Ga0496115_0011451 3300048918 Bacteria 6649
556 Ga0501201_046685 3300049651 Bacteria 532
557 Ga0501202_073400 3300049652 Bacteria 792
558 Ga0501207_019712 3300049654 Bacteria 1071
559 Ga0501209_221644 3300049656 Bacteria 586
560 Ga0501217_037733 3300049661 Bacteria 1218
561 Ga0501217_131330 3300049661 Bacteria 735
562 Ga0501223_013338 3300049663 Bacteria 1637
563 Ga0501223_061482 3300049663 Bacteria 734
564 Ga0501224_018926 3300049664 Bacteria 1026
565 Ga0501230_075093 3300049667 Bacteria 701
566 Ga0501233_013340 3300049668 Bacteria 1664
567 Ga0501235_014184 3300049669 Bacteria 1757
568 Ga0501239_043878 3300049672 Bacteria 627
569 Ga0501249_039228 3300049679 Bacteria 1071
570 Ga0501253_175385 3300049683 Bacteria 554
571 Ga0501257_027561 3300049686 Bacteria 1360
572 Ga0501258_001351 3300049687 Bacteria 1984
573 Ga0501221_254564 3300049704 Bacteria 505
574 Ga0501229_055168 3300049706 Bacteria 595
575 Ga0501267_012032 3300049764 Bacteria 888
576 Ga0501268_026548 3300049765 Bacteria 1024
577 Ga0501268_037120 3300049765 Bacteria 905
578 Ga0501270_005363 3300049767 Bacteria 1488
579 Ga0501272_009646 3300049769 Bacteria 1070
580 Ga0501273_002845 3300049770 Bacteria 1795
581 Ga0501274_034158 3300049771 Bacteria 587
582 Ga0501283_062310 3300049779 Bacteria 675
583 Ga0495595_0455870 3300053084 Bacteria 650
584 Ga0466962_0069168 3300061719 Bacteria 1686
585 Ga0466962_0099961 3300061719 Bacteria 1392
586 Ga0466962_0138246 3300061719 Bacteria 1179
587 Ga0466962_0220523 3300061719 Bacteria 929
588 Ga0530510_0412779 3300061734 Bacteria 1019
589 Ga0081455_10345878
590 JGI24737J22298_10008531
591 JGI24737J22298_10016480
592 JGI24735J21928_10060182
593 JGI24735J21928_10073418
594 JGI24735J21928_10184186
595 Ga0065712_10173904
596 Ga0065715_10396107
597 Ga0070658_10033070
598 Ga0070658_10264094
599 Ga0070658_10267376
600 Ga0070658_10288810
601 Ga0070658_10307343
602 Ga0070658_10365371
603 Ga0070658_10526966
604 Ga0070658_10924445
605 Ga0070658_11787789
606 Ga0070676_10070363
607 Ga0070676_10583556
608 Ga0070683_100119033
609 Ga0070690_100178021
610 Ga0070670_100071376
611 Ga0070670_100089790
612 Ga0070670_100142662
613 Ga0070670_100169084
614 Ga0070670_100195211
615 Ga0070670_100413356
616 Ga0070666_10572498
617 Ga0070682_100217894
618 Ga0070660_100030444
619 Ga0070660_100274447
620 Ga0070660_100300404
621 Ga0070660_100366893
622 Ga0070660_100430784
623 Ga0070660_100566267
624 Ga0070660_100703097
625 Ga0070660_100938643
626 Ga0070660_101209787
627 Ga0070689_100579255
628 Ga0070661_100056625
629 Ga0070661_100119530
630 Ga0070661_100162180
631 Ga0070661_100265861
632 Ga0070661_100422572
633 Ga0070661_100511603
634 Ga0070661_100581799
635 Ga0070668_101802627
636 Ga0070675_100006226
637 Ga0070675_100224270
638 Ga0070675_100442137
639 Ga0070671_100048194
640 Ga0070671_100049237
641 Ga0070671_100050435
642 Ga0070671_100058750
643 Ga0070674_100994785
644 Ga0070673_100088921
645 Ga0070673_100665693
646 Ga0070673_100889713
647 Ga0070673_101384988
648 Ga0070659_100007531
649 Ga0070659_100033337
650 Ga0070659_100054832
651 Ga0070659_100081497
652 Ga0070659_100253923
653 Ga0070659_100690998
654 Ga0070659_101145698
655 Ga0070714_100013505
656 Ga0070714_100198475
657 Ga0070714_100305108
658 Ga0070714_100354429
659 Ga0070714_101292940
660 Ga0070713_100004550
661 Ga0070713_100079137
662 Ga0070713_101055316
663 Ga0070711_100744643
664 Ga0070663_100256507
665 Ga0070663_100373496
666 Ga0070662_100085191
667 Ga0070662_100114719
668 Ga0070662_100891639
669 Ga0070662_101034509
670 Ga0070662_101474707
671 Ga0070662_101523729
672 Ga0070662_101676158
673 Ga0070662_101962424
674 Ga0070681_10309201
675 Ga0070681_12005907
676 Ga0070679_100538385
677 Ga0070679_100671656
678 Ga0070679_100857226
679 Ga0070684_100030536
680 Ga0068853_100192920
681 Ga0068853_100321512
682 Ga0068853_100716742
683 Ga0068853_100826723
684 Ga0070672_100183162
685 Ga0070672_100357734
686 Ga0070672_100945232
687 Ga0070665_100014260
688 Ga0068855_100204754
689 Ga0068855_100711794
690 Ga0070664_100007808
691 Ga0070664_100014625
692 Ga0070664_100380620
693 Ga0070664_100427997
694 Ga0070664_100542853
695 Ga0070664_101306522
696 Ga0068857_100099059
697 Ga0068857_100411307
698 Ga0068857_100495703
699 Ga0068854_100072479
700 Ga0068854_100072644
701 Ga0068854_100189662
702 Ga0068854_101356267
703 Ga0068854_101599327
704 Ga0068856_100106242
705 Ga0068856_100284964
706 Ga0068856_101414462
707 Ga0068852_100054213
708 Ga0068852_100149354
709 Ga0068852_100191435
710 Ga0068852_100676264
711 Ga0068852_100683591
712 Ga0068852_100871668
713 Ga0068852_101536935
714 Ga0068859_100096036
715 Ga0068864_100041329
716 Ga0068864_100437461
717 Ga0068861_100789289
718 Ga0068851_10659327
719 Ga0068870_10305970
720 Ga0068863_100005172
721 Ga0068863_100963360
722 Ga0068863_101026399
723 Ga0068858_100028177
724 Ga0068860_102273653
725 Ga0068862_100723651
726 Ga0070716_100164101
727 Ga0075366_10310133
728 Ga0097621_100072431
729 Ga0097621_100446836
730 Ga0068871_100314818
731 Ga0097620_100096039
732 Ga0105240_10243201
733 Ga0105240_10281264
734 Ga0105247_10615209
735 Ga0105241_10331965
736 Ga0105241_12180101
737 Ga0105242_11518271
738 Ga0105248_10016854
739 Ga0105248_10062708
740 Ga0105248_10413203
741 Ga0105248_10533333
742 Ga0105248_10622417
743 Ga0105237_10139852
744 Ga0105238_10888726
745 Ga0105238_10992032
746 Ga0105238_11374706
747 Ga0105246_10446382
748 Ga0157373_10008053
749 Ga0157373_10071021
750 Ga0157373_10078062
751 Ga0157373_10242384
752 Ga0157371_10515629
753 Ga0157371_11451294
754 Ga0157370_10000244
755 Ga0157370_10270796
756 Ga0157369_10341427
757 Ga0157374_10206139
758 Ga0163162_10266958
759 Ga0157372_12778705
760 Ga0157375_10258963
761 Ga0157375_10286339
762 Ga0163163_10512722
763 Ga0157379_10788684
764 Ga0157376_10344594
765 Ga0207697_10176640
766 Ga0207682_10065427
767 Ga0207688_10466478
768 Ga0207680_10247206
769 Ga0207680_11186331
770 Ga0207647_10048740
771 Ga0207647_10124199
772 Ga0207647_10137869
773 Ga0207645_10050098
774 Ga0207645_10483312
775 Ga0207645_10597444
776 Ga0207643_10402225
777 Ga0207705_10019747
778 Ga0207705_10129032
779 Ga0207705_10132864
780 Ga0207705_10162420
781 Ga0207705_10249060
782 Ga0207705_10514172
783 Ga0207705_10642921
784 Ga0207705_10654738
785 Ga0207705_10901625
786 Ga0207705_11177973
787 Ga0207705_11265792
788 Ga0207705_11484813
789 Ga0207654_10784025
790 Ga0207695_10513699
791 Ga0207695_11376108
792 Ga0207693_10765612
793 Ga0207660_10691392
794 Ga0207660_10946205
795 Ga0207657_10038463
796 Ga0207657_10232545
797 Ga0207657_10234823
798 Ga0207657_10361189
799 Ga0207657_10396676
800 Ga0207649_10056165
801 Ga0207649_10191476
802 Ga0207649_10582286
803 Ga0207649_11371643
804 Ga0207652_10149220
805 Ga0207652_10483508
806 Ga0207681_11713553
807 Ga0207694_11260493
808 Ga0207650_10036302
809 Ga0207650_10066030
810 Ga0207650_10066426
811 Ga0207650_10104922
812 Ga0207650_10243584
813 Ga0207650_11015332
814 Ga0207659_10117920
815 Ga0207700_10121324
816 Ga0207700_10720019
817 Ga0207700_11197406
818 Ga0207664_10207666
819 Ga0207664_10256828
820 Ga0207664_10352873
821 Ga0207664_10379923
822 Ga0207644_10044514
823 Ga0207644_10085310
824 Ga0207644_10171825
825 Ga0207690_10044634
826 Ga0207690_10066862
827 Ga0207690_10147036
828 Ga0207690_10164999
829 Ga0207690_10197151
830 Ga0207690_10214211
831 Ga0207690_10238372
832 Ga0207690_10352657
833 Ga0207690_11240333
834 Ga0207706_10132789
835 Ga0207706_10449274
836 Ga0207706_11356584
837 Ga0207706_11398727
838 Ga0207706_11694540
839 Ga0207670_10466000
840 Ga0207670_11038595
841 Ga0207665_10073526
842 Ga0207691_10043931
843 Ga0207691_10289575
844 Ga0207711_10019496
845 Ga0207711_10384555
846 Ga0207711_10417060
847 Ga0207711_10435119
848 Ga0207679_10002410
849 Ga0207679_10118708
850 Ga0207679_10526059
851 Ga0207679_10699357
852 Ga0207679_10731683
853 Ga0207679_11127674
854 Ga0207679_11218865
855 Ga0207679_11464328
856 Ga0207679_11500641
857 Ga0207667_10097780
858 Ga0207667_10263308
859 Ga0207667_10838198
860 Ga0207651_10119363
861 Ga0207651_10488876
862 Ga0207651_10636316
863 Ga0207651_10680957
864 Ga0207712_10937952
865 Ga0207668_11992189
866 Ga0207640_10240665
867 Ga0207640_10486130
868 Ga0207640_11971474
869 Ga0207658_10496412
870 Ga0207658_11657686
871 Ga0207677_10580693
872 Ga0207677_10923036
873 Ga0207703_10195150
874 Ga0207703_10339444
875 Ga0207639_10258000
876 Ga0207639_10259684
877 Ga0207639_10267499
878 Ga0207678_10163930
879 Ga0207678_10190872
880 Ga0207678_10542987
881 Ga0207678_11393258
882 Ga0207678_11569281
883 Ga0207702_10251692
884 Ga0207702_10782989
885 Ga0207702_11191226
886 Ga0207641_10105640
887 Ga0207641_10462336
888 Ga0207641_10550899
889 Ga0207641_10675980
890 Ga0207648_10487149
891 Ga0207676_10028314
892 Ga0207674_10000057
893 Ga0207674_10084179
894 Ga0207674_10212664
895 Ga0207674_10226578
896 Ga0207674_11570916
897 Ga0207698_10087966
898 Ga0207698_10356188
899 Ga0209974_10120157
900 Ga0268266_10053406
901 Ga0268265_11673135
902 Ga0268264_10474911
903 Ga0307408_100076242
904 Ga0307408_100737335
905 Ga0307405_10088268
906 Ga0307405_10124802
907 Ga0307405_10153782
908 Ga0307405_10617122
909 Ga0307405_10742851
910 Ga0307405_10919643
911 Ga0307405_12027593
912 Ga0307413_10036139
913 Ga0307413_10059983
914 Ga0307413_10500975
915 Ga0307410_10080135
916 Ga0307410_10149623
917 Ga0307410_10462117
918 Ga0307406_10050540
919 Ga0307406_10662630
920 Ga0307406_10699881
921 Ga0307407_10072901
922 Ga0307407_10798569
923 Ga0307407_10952740
924 Ga0307412_10008288
925 Ga0307412_10180654
926 Ga0307412_10781053
927 Ga0307412_10781378
928 Ga0307409_100115335
929 Ga0307409_100137857
930 Ga0307409_100170988
931 Ga0307409_100177796
932 Ga0307409_100546980
933 Ga0307409_100606704
934 Ga0307416_100055492
935 Ga0307416_100097875
936 Ga0307416_100109074
937 Ga0307416_100265713
938 Ga0307416_100407153
939 Ga0307416_101172479
940 Ga0307416_101249818
941 Ga0307416_101533877
942 Ga0307414_10054722
943 Ga0307414_10573860
944 Ga0307411_10006842
945 Ga0307411_10080528
946 Ga0307411_10258737
947 Ga0307411_10468035
948 Ga0307411_10750791
949 Ga0307415_100016301
950 Ga0307415_100045410
951 Ga0307415_100046234
952 Ga0307415_100355103
953 Ga0307415_100862918
954 Ga0373959_0081568
955 Ga0373944_0032198
956 Ga0373957_0113688
957 Ga0373943_0004664
958 Ga0373943_0115875
959 Ga0373943_0221047
960 Ga0373946_0108102
961 Ga0373942_0148419
962 Ga0373935_0159399
963 Ga0373927_0605913
964 Ga0373925_0008528
965 Ga0395899_0016561
966 Ga0395899_0041538
967 Ga0395899_0056572
968 Ga0395899_0060818
969 Ga0395899_0064313
970 Ga0395899_0081287
971 Ga0395899_0081372
972 Ga0395899_0082493
973 Ga0395899_0103250
974 Ga0395899_0199651
975 Ga0395899_0209412
976 Ga0395899_0348862
977 Ga0395899_0476262
978 Ga0395899_0615078
979 Ga0395899_0659973
980 Ga0395900_0022977
981 Ga0395900_0073510
982 Ga0395900_0097935
983 Ga0395900_0104036
984 Ga0395900_0108554
985 Ga0395900_0139626
986 Ga0395900_0150843
987 Ga0395900_0189863
988 Ga0395900_0193085
989 Ga0395900_0199911
990 Ga0395900_0229912
991 Ga0395900_0261561
992 Ga0395900_0270598
993 Ga0395900_0325403
994 Ga0395900_0422783
995 Ga0395900_0501702
996 Ga0395900_0632275
997 Ga0395900_0750482
998 Ga0395900_0876917
999 Ga0395900_1769603
1000 Ga0395900_1789970
1001 Ga0395898_0000732
1002 Ga0395898_0012439
1003 Ga0395898_0074631
1004 Ga0395898_0114883
1005 Ga0395898_0138154
1006 Ga0395898_0138805
1007 Ga0395898_0153026
1008 Ga0395898_0176264
1009 Ga0395898_0240366
1010 Ga0395898_0252293
1011 Ga0395898_0397222
1012 Ga0395898_0638714
1013 Ga0395898_1563413
1014 Ga0395898_1631106
1015 Ga0395905_0000092
1016 Ga0395905_0011073
1017 Ga0395905_0014833
1018 Ga0395905_0028903
1019 Ga0395905_0041471
1020 Ga0395905_0058595
1021 Ga0395905_0062158
1022 Ga0395905_0067402
1023 Ga0395905_0083659
1024 Ga0395905_0104548
1025 Ga0395905_0123101
1026 Ga0395905_0166679
1027 Ga0395905_0169343
1028 Ga0395905_0261257
1029 Ga0395905_0280427
1030 Ga0395905_0372824
1031 Ga0395905_0450775
1032 Ga0395905_0487311
1033 Ga0395905_0726305
1034 Ga0395905_1343044
1035 Ga0395901_0028073
1036 Ga0395901_0053143
1037 Ga0395901_0062328
1038 Ga0395901_0108531
1039 Ga0395901_0122320
1040 Ga0395901_0177942
1041 Ga0395901_0228490
1042 Ga0395901_0307783
1043 Ga0395901_0325186
1044 Ga0395901_0430049
1045 Ga0395901_0487432
1046 Ga0395901_0533091
1047 Ga0395901_0775729
1048 Ga0395901_1113493
1049 Ga0395901_1262314
1050 Ga0395901_1377292
1051 Ga0395901_1495292
1052 Ga0395901_1912385
1053 Ga0395901_1930253
1054 Ga0395901_2078734
1055 Ga0439439_0099916
1056 Ga0439448_0012995
1057 Ga0439432_012088
1058 Ga0439432_196459
1059 Ga0439449_0044378
1060 Ga0450889_015521
1061 Ga0439458_0002822
1062 Ga0439458_0004947
1063 Ga0451577_0265306
1064 Ga0466969_0027047
1065 Ga0466969_0135592
1066 Ga0466972_0136900
1067 Ga0466972_0184344
1068 Ga0466965_0273730
1069 Ga0466965_0327301
1070 Ga0466966_0016600
1071 Ga0466966_0060507
1072 Ga0466966_0207188
1073 Ga0466966_0401464
1074 Ga0466966_0549857
1075 Ga0466961_0021643
1076 Ga0466961_0064799
1077 Ga0466961_0363698
1078 Ga0466961_0500896
1079 Ga0466963_0091010
1080 Ga0466963_0192181
1081 Ga0466963_0446032
1082 Ga0466963_0666226
1083 Ga0466963_0885419
1084 Ga0466971_0029751
1085 Ga0466971_0033879
1086 Ga0466971_0387337
1087 Ga0466970_0050616
1088 Ga0466970_0307738
1089 Ga0466957_0068253
1090 Ga0466957_0404385
1091 Ga0466957_0623676
1092 Ga0466960_0185229
1093 Ga0466959_0083517
1094 Ga0466959_0084232
1095 Ga0466959_0089835
1096 Ga0466959_0458576
1097 Ga0466959_0710617
1098 Ga0466959_0903773
1099 Ga0466958_0069245
1100 Ga0466958_0200708
1101 Ga0466967_0108675
1102 Ga0466967_0132640
1103 Ga0466967_0355194
1104 Ga0466967_1124937
1105 Ga0466967_1284563
1106 Ga0495643_0524537
1107 Ga0495669_0007257
1108 Ga0495669_0088249
1109 Ga0495669_0179137
1110 Ga0495669_0253872
1111 Ga0495670_0039441
1112 Ga0495677_0011348
1113 Ga0496100_0020622
1114 Ga0496100_0505175
1115 Ga0496100_0524473
1116 Ga0496101_0090173
1117 Ga0496101_0452857
1118 Ga0496102_0099246
1119 Ga0496105_0282513
1120 Ga0496106_0701661
1121 Ga0496107_0331108
1122 Ga0496107_0380886
1123 Ga0496108_0023926
1124 Ga0496108_0050944
1125 Ga0496108_0349543
1126 Ga0496109_0035102
1127 Ga0496109_0266486
1128 Ga0496109_0374320
1129 Ga0496109_1021804
1130 Ga0496110_0048504
1131 Ga0496110_0701537
1132 Ga0496111_0022359
1133 Ga0496111_0096990
1134 Ga0496111_0163542
1135 Ga0496112_0084181
1136 Ga0496112_0139742
1137 Ga0496112_0355126
1138 Ga0496112_0849839
1139 Ga0496113_0160248
1140 Ga0496114_0012975
1141 Ga0496114_0049494
1142 Ga0496115_0002002
1143 Ga0496115_0011451
1144 Ga0501201_046685
1145 Ga0501202_073400
1146 Ga0501207_019712
1147 Ga0501209_221644
1148 Ga0501217_037733
1149 Ga0501217_131330
1150 Ga0501223_013338
1151 Ga0501223_061482
1152 Ga0501224_018926
1153 Ga0501230_075093
1154 Ga0501233_013340
1155 Ga0501235_014184
1156 Ga0501239_043878
1157 Ga0501249_039228
1158 Ga0501253_175385
1159 Ga0501257_027561
1160 Ga0501258_001351
1161 Ga0501221_254564
1162 Ga0501229_055168
1163 Ga0501267_012032
1164 Ga0501268_026548
1165 Ga0501268_037120
1166 Ga0501270_005363
1167 Ga0501272_009646
1168 Ga0501273_002845
1169 Ga0501274_034158
1170 Ga0501283_062310
1171 Ga0495595_0455870
1172 Ga0466962_0069168
1173 Ga0466962_0099961
1174 Ga0466962_0138246
1175 Ga0466962_0220523
1176 Ga0530510_0412779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

7

128

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9891 2 121
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9769 2 122
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9767 1 122
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9697 2 122
3mxu-assembly1.cif.gz_A crystal structure of glycine cleavage system protein h from bartonella henselae 0.9612 2 108
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9868 3 119 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9769 2 120 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9765 1 122 2.40.50.100
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9735 1 123 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9723 2 120 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A853FS71-F1-model_v4 Glycine cleavage system H protein 0.9957 1 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A432VJA8-F1-model_v4 Glycine cleavage system H protein 0.995 1 123 GO:0005737
GO:0005960
GO:0019464
AF-Q9A352-F1-model_v4 Glycine cleavage system H protein 0.9947 4 123 GO:0005737
GO:0005960
GO:0019464
AF-A0A3M1JW41-F1-model_v4 Glycine cleavage system protein GcvH 0.9946 4 123 GO:0005829
GO:0005960
GO:0019464
AF-A0A6A8QNK0-F1-model_v4 Glycine cleavage system H protein 0.9941 2 122 GO:0005737
GO:0005960
GO:0019464

Map