F466749

General Info

Members Datasets Scaffolds Average Seq Length
588 245 1176 223

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100038250|Ga0070707_1000382505
Length 276
Sequence MFPLFDENEPGQGIAWVTLALITVNVAVFLLLQQAGGDNQFTYGFSTIPAEITTGRDIINSQPVTIDGVRYLIPEAPGPSPIYLTLLTSMFMHGGWLHLGGNMLFLFIFGDNVEHYIGSFLYLVFYLVAGIIASFAQILVDPNSVVPNLGASGAIAGVLGAYIVLFPRNRVVVFLLRFLVPVPAVVAIGLWAVLQFVSGIGSIAVTAQTDGVAYMAHVGGFITGVVVGSWRAASSATRRRDAAGRGDDGRLRRPQARRPLSLAPAVAPAELLGETH

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
169 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
174 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
175 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
176 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
177 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
180 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
181 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
182 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
213 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
214 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
215 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
229 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
240 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
242 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
245 2687453341 Pirellula sp. SH-Sr6A Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.74
Nodule 0
Rhizoplane 4.08
Rhizosphere 91.84
Stem 0
Stem Tuber 0
Unclassified 6.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100038250 3300005468 Bacteria 4582
2 JGI24751J29686_10048531 3300002459 Bacteria 876
3 JGI25406J46586_10020270 3300003203 Unclassified 2692
4 Ga0065704_10005518 3300005289 Bacteria 3016
5 Ga0065712_10006274 3300005290 Bacteria 3337
6 Ga0065712_10070460 3300005290 Bacteria 5993
7 Ga0065712_10078459 3300005290 Unclassified 3345
8 Ga0065712_10210809 3300005290 Bacteria 1066
9 Ga0065715_10091261 3300005293 Bacteria 5947
10 Ga0065715_10097008 3300005293 Bacteria 3704
11 Ga0065715_10097855 3300005293 Bacteria 3640
12 Ga0065715_10115023 3300005293 Unclassified 2429
13 Ga0065715_10167051 3300005293 Bacteria 1578
14 Ga0065715_10221182 3300005293 Bacteria 1270
15 Ga0065707_10096077 3300005295 Bacteria 3306
16 Ga0065707_10141425 3300005295 Unclassified 1762
17 Ga0070658_10292425 3300005327 Bacteria 1388
18 Ga0070676_10440172 3300005328 Bacteria 914
19 Ga0070683_100022048 3300005329 Bacteria 5687
20 Ga0070690_100131605 3300005330 Bacteria 1690
21 Ga0070690_100539890 3300005330 Bacteria 878
22 Ga0070670_100495376 3300005331 Bacteria 1086
23 Ga0068869_100501285 3300005334 Bacteria 1014
24 Ga0068869_100796399 3300005334 Bacteria 812
25 Ga0070666_10105973 3300005335 Bacteria 1942
26 Ga0070666_10385504 3300005335 Bacteria 1006
27 Ga0070680_100286071 3300005336 Bacteria 1397
28 Ga0070680_100540199 3300005336 Bacteria 999
29 Ga0070682_100057392 3300005337 Unclassified 2452
30 Ga0070660_100280219 3300005339 Bacteria 1364
31 Ga0070689_100000378 3300005340 Bacteria 26197
32 Ga0070689_100193211 3300005340 Bacteria 1658
33 Ga0070689_100849902 3300005340 Bacteria 805
34 Ga0070661_100584876 3300005344 Bacteria 901
35 Ga0070692_10018510 3300005345 Bacteria 3352
36 Ga0070692_10123111 3300005345 Bacteria 1449
37 Ga0070669_100001680 3300005353 Bacteria 16012
38 Ga0070669_100065454 3300005353 Bacteria 2678
39 Ga0070669_100422627 3300005353 Bacteria 1094
40 Ga0070675_100000046 3300005354 Bacteria 76244
41 Ga0070675_100304589 3300005354 Bacteria 1404
42 Ga0070675_100411530 3300005354 Bacteria 1208
43 Ga0070675_100571096 3300005354 Bacteria 1024
44 Ga0070671_100715815 3300005355 Bacteria 869
45 Ga0070674_100052864 3300005356 Bacteria 2803
46 Ga0070674_100436633 3300005356 Bacteria 1078
47 Ga0070674_100509133 3300005356 Bacteria 1004
48 Ga0070673_100053135 3300005364 Bacteria 3181
49 Ga0070673_100602650 3300005364 Unclassified 1002
50 Ga0070659_100127209 3300005366 Bacteria 2068
51 Ga0070667_100024918 3300005367 Unclassified 4970
52 Ga0070667_100375343 3300005367 Bacteria 1291
53 Ga0070703_10187310 3300005406 Bacteria 803
54 Ga0070709_10162659 3300005434 Bacteria 1553
55 Ga0070701_10425302 3300005438 Bacteria 847
56 Ga0070711_100182361 3300005439 Bacteria 1608
57 Ga0070705_100037838 3300005440 Bacteria 2725
58 Ga0070705_100046113 3300005440 Bacteria 2511
59 Ga0070700_100021594 3300005441 Bacteria 3744
60 Ga0070700_100605394 3300005441 Bacteria 859
61 Ga0070694_100478023 3300005444 Unclassified 988
62 Ga0070708_100000153 3300005445 Bacteria 48042
63 Ga0070708_100008250 3300005445 Bacteria 8364
64 Ga0070708_100088138 3300005445 Bacteria 2821
65 Ga0070708_100173158 3300005445 Bacteria 2016
66 Ga0070663_100005355 3300005455 Bacteria 7617
67 Ga0070663_100037042 3300005455 Bacteria 3393
68 Ga0070663_100703532 3300005455 Unclassified 859
69 Ga0070678_100047766 3300005456 Bacteria 3078
70 Ga0070678_100492207 3300005456 Bacteria 1081
71 Ga0070662_100178579 3300005457 Bacteria 1672
72 Ga0070662_100216793 3300005457 Bacteria 1525
73 Ga0070662_100546708 3300005457 Bacteria 970
74 Ga0070681_10071657 3300005458 Bacteria 3430
75 Ga0068867_100056684 3300005459 Bacteria 2900
76 Ga0068867_100202335 3300005459 Bacteria 1590
77 Ga0070706_100202434 3300005467 Bacteria 1854
78 Ga0070706_100210443 3300005467 Bacteria 1816
79 Ga0070707_100000212 3300005468 Bacteria 58073
80 Ga0070707_100020965 3300005468 Bacteria 6171
81 Ga0070707_100111665 3300005468 Bacteria 2651
82 Ga0070707_100125502 3300005468 Bacteria 2493
83 Ga0070707_100390496 3300005468 Bacteria 1351
84 Ga0070707_100644921 3300005468 Unclassified 1021
85 Ga0070707_100682586 3300005468 Bacteria 990
86 Ga0070698_100003146 3300005471 Bacteria 18189
87 Ga0070698_100071754 3300005471 Bacteria 3472
88 Ga0070698_100072030 3300005471 Bacteria 3464
89 Ga0070698_100821081 3300005471 Bacteria 874
90 Ga0070699_100001355 3300005518 Bacteria 22589
91 Ga0070699_100001667 3300005518 Bacteria 20270
92 Ga0070699_100013191 3300005518 Bacteria 7125
93 Ga0070699_100039985 3300005518 Bacteria 4061
94 Ga0070699_100158143 3300005518 Bacteria 2005
95 Ga0070679_100050796 3300005530 Bacteria 4130
96 Ga0070684_100001564 3300005535 Bacteria 16522
97 Ga0070684_100158389 3300005535 Bacteria 2053
98 Ga0070684_100194052 3300005535 Bacteria 1849
99 Ga0070697_101022776 3300005536 Unclassified 735
100 Ga0068853_100026275 3300005539 Bacteria 4888
101 Ga0068853_100162256 3300005539 Unclassified 2018
102 Ga0070672_100127050 3300005543 Bacteria 2092
103 Ga0070672_100189773 3300005543 Bacteria 1715
104 Ga0070672_100340870 3300005543 Bacteria 1276
105 Ga0070686_100018188 3300005544 Bacteria 4120
106 Ga0070686_100770875 3300005544 Bacteria 773
107 Ga0070695_100392351 3300005545 Bacteria 1050
108 Ga0070695_100510595 3300005545 Bacteria 931
109 Ga0070696_100086985 3300005546 Bacteria 2220
110 Ga0070696_100703376 3300005546 Bacteria 824
111 Ga0070665_100028869 3300005548 Bacteria 5584
112 Ga0070665_100559599 3300005548 Bacteria 1156
113 Ga0070704_100070381 3300005549 Bacteria 2538
114 Ga0070704_100440544 3300005549 Bacteria 1120
115 Ga0070704_100533725 3300005549 Bacteria 1023
116 Ga0070704_100649806 3300005549 Bacteria 931
117 Ga0070704_100719448 3300005549 Archaea 887
118 Ga0068855_100538774 3300005563 Bacteria 1265
119 Ga0070664_100008845 3300005564 Bacteria 8160
120 Ga0070664_100305709 3300005564 Bacteria 1438
121 Ga0070664_100431588 3300005564 Bacteria 1208
122 Ga0068857_100055714 3300005577 Bacteria 3508
123 Ga0068857_100078935 3300005577 Bacteria 2938
124 Ga0068857_100081102 3300005577 Bacteria 2897
125 Ga0068857_100101897 3300005577 Unclassified 2576
126 Ga0068857_100237477 3300005577 Bacteria 1668
127 Ga0068854_100151715 3300005578 Unclassified 1788
128 Ga0068854_100172096 3300005578 Bacteria 1686
129 Ga0070702_100145045 3300005615 Bacteria 1517
130 Ga0070702_100593241 3300005615 Bacteria 829
131 Ga0068852_100083153 3300005616 Bacteria 2846
132 Ga0068859_100548799 3300005617 Bacteria 1250
133 Ga0068859_100820798 3300005617 Bacteria 1017
134 Ga0068859_100843569 3300005617 Bacteria 1002
135 Ga0068859_100871450 3300005617 Bacteria 986
136 Ga0068859_100959699 3300005617 Bacteria 938
137 Ga0068859_101307634 3300005617 Bacteria 799
138 Ga0068864_100022048 3300005618 Bacteria 5338
139 Ga0068864_100038781 3300005618 Unclassified 4069
140 Ga0068864_100054483 3300005618 Bacteria 3452
141 Ga0068864_100305914 3300005618 Bacteria 1489
142 Ga0068864_100448540 3300005618 Bacteria 1233
143 Ga0068864_100559227 3300005618 Bacteria 1106
144 Ga0068866_10038095 3300005718 Bacteria 2365
145 Ga0068866_10338956 3300005718 Bacteria 951
146 Ga0068861_100072175 3300005719 Bacteria 2678
147 Ga0068861_100081642 3300005719 Bacteria 2531
148 Ga0068861_100115817 3300005719 Bacteria 2154
149 Ga0068861_100163724 3300005719 Bacteria 1837
150 Ga0068870_10467919 3300005840 Bacteria 834
151 Ga0068870_10474171 3300005840 Bacteria 829
152 Ga0068863_100023950 3300005841 Bacteria 5827
153 Ga0068863_100100304 3300005841 Bacteria 2752
154 Ga0068858_100124744 3300005842 Bacteria 2410
155 Ga0068858_100385576 3300005842 Unclassified 1345
156 Ga0068858_100462767 3300005842 Bacteria 1223
157 Ga0068858_100466196 3300005842 Bacteria 1218
158 Ga0068858_100967113 3300005842 Bacteria 834
159 Ga0068860_100329152 3300005843 Bacteria 1500
160 Ga0068860_100573813 3300005843 Bacteria 1132
161 Ga0068860_100760563 3300005843 Bacteria 981
162 Ga0068860_100834274 3300005843 Bacteria 936
163 Ga0068862_100021487 3300005844 Bacteria 5393
164 Ga0068862_100087160 3300005844 Bacteria 2715
165 Ga0068862_100904465 3300005844 Bacteria 868
166 Ga0081455_10032790 3300005937 Bacteria 4676
167 Ga0081455_10119732 3300005937 Bacteria 2076
168 Ga0081538_10001691 3300005981 Bacteria 22485
169 Ga0081538_10002822 3300005981 Bacteria 16622
170 Ga0081538_10004684 3300005981 Bacteria 12530
171 Ga0081538_10144419 3300005981 Unclassified 1091
172 Ga0081539_10001592 3300005985 Bacteria 37483
173 Ga0075368_10008625 3300006042 Bacteria 3639
174 Ga0075364_10010656 3300006051 Bacteria 5558
175 Ga0075432_10041962 3300006058 Bacteria 1600
176 Ga0075362_10232507 3300006177 Bacteria 903
177 Ga0075367_10095872 3300006178 Bacteria 1809
178 Ga0075367_10108299 3300006178 Bacteria 1703
179 Ga0075367_10133169 3300006178 Bacteria 1537
180 Ga0075366_10037931 3300006195 Bacteria 2846
181 Ga0075366_10050674 3300006195 Bacteria 2466
182 Ga0075366_10140024 3300006195 Bacteria 1462
183 Ga0097621_100011581 3300006237 Bacteria 6501
184 Ga0097621_100018807 3300006237 Bacteria 5288
185 Ga0097621_100120666 3300006237 Bacteria 2223
186 Ga0097621_100892372 3300006237 Bacteria 828
187 Ga0075370_10032925 3300006353 Bacteria 2900
188 Ga0075370_10094381 3300006353 Bacteria 1727
189 Ga0068871_100001525 3300006358 Bacteria 15523
190 Ga0068871_100014148 3300006358 Bacteria 5937
191 Ga0068871_100540181 3300006358 Bacteria 1055
192 Ga0068871_100637863 3300006358 Bacteria 972
193 Ga0075428_100006321 3300006844 Bacteria 13174
194 Ga0075428_100662842 3300006844 Bacteria 1112
195 Ga0075430_100036235 3300006846 Bacteria 4183
196 Ga0075431_100014678 3300006847 Bacteria 7928
197 Ga0075431_100256328 3300006847 Unclassified 1776
198 Ga0075431_100334239 3300006847 Bacteria 1525
199 Ga0075433_10031501 3300006852 Bacteria 4534
200 Ga0075433_10126625 3300006852 Bacteria 2268
201 Ga0075433_10163109 3300006852 Bacteria 1984
202 Ga0075433_10174213 3300006852 Bacteria 1914
203 Ga0075433_10408414 3300006852 Bacteria 1198
204 Ga0075434_100025920 3300006871 Bacteria 5738
205 Ga0075434_100065119 3300006871 Bacteria 3629
206 Ga0075434_100074739 3300006871 Bacteria 3382
207 Ga0075434_100112866 3300006871 Bacteria 2729
208 Ga0075434_100136570 3300006871 Bacteria 2471
209 Ga0075434_100374130 3300006871 Bacteria 1445
210 Ga0075434_100654539 3300006871 Bacteria 1069
211 Ga0075434_100723866 3300006871 Bacteria 1012
212 Ga0075429_100075832 3300006880 Bacteria 2929
213 Ga0075429_100158481 3300006880 Bacteria 1982
214 Ga0068865_100006100 3300006881 Bacteria 7351
215 Ga0068865_100028362 3300006881 Bacteria 3705
216 Ga0068865_100085123 3300006881 Bacteria 2280
217 Ga0075436_100170992 3300006914 Bacteria 1534
218 Ga0075436_100239512 3300006914 Bacteria 1290
219 Ga0097620_100548799 3300006931 Bacteria 1250
220 Ga0097620_100820827 3300006931 Bacteria 1017
221 Ga0097620_100843560 3300006931 Bacteria 1002
222 Ga0097620_100871237 3300006931 Bacteria 986
223 Ga0097620_100959722 3300006931 Bacteria 938
224 Ga0097620_101307837 3300006931 Bacteria 799
225 Ga0075435_100092856 3300007076 Bacteria 2493
226 Ga0075435_100264028 3300007076 Bacteria 1467
227 Ga0075435_100436153 3300007076 Bacteria 1129
228 Ga0105251_10158738 3300009011 Bacteria 1020
229 Ga0111539_10002299 3300009094 Bacteria 25405
230 Ga0111539_10002948 3300009094 Bacteria 22579
231 Ga0111539_10005839 3300009094 Bacteria 15915
232 Ga0111539_10051293 3300009094 Bacteria 4914
233 Ga0111539_10067583 3300009094 Bacteria 4220
234 Ga0111539_10093050 3300009094 Bacteria 3541
235 Ga0105245_10210892 3300009098 Bacteria 1869
236 Ga0105245_10668910 3300009098 Bacteria 1070
237 Ga0105245_10718205 3300009098 Bacteria 1033
238 Ga0105245_11323646 3300009098 Bacteria 770
239 Ga0105247_10095478 3300009101 Bacteria 1893
240 Ga0114129_10013275 3300009147 Bacteria 11735
241 Ga0114129_10119072 3300009147 Unclassified 3637
242 Ga0114129_10142751 3300009147 Bacteria 3281
243 Ga0114129_10275538 3300009147 Bacteria 2249
244 Ga0105243_10001323 3300009148 Bacteria 22095
245 Ga0105243_10171692 3300009148 Bacteria 1878
246 Ga0105243_10309604 3300009148 Bacteria 1435
247 Ga0105241_10067315 3300009174 Bacteria 2772
248 Ga0105241_10357870 3300009174 Bacteria 1269
249 Ga0105242_10052619 3300009176 Bacteria 3323
250 Ga0105242_10222074 3300009176 Bacteria 1689
251 Ga0105242_10283801 3300009176 Bacteria 1505
252 Ga0105242_10435772 3300009176 Bacteria 1232
253 Ga0105248_10014952 3300009177 Bacteria 8544
254 Ga0105248_10047751 3300009177 Bacteria 4801
255 Ga0105248_10101062 3300009177 Bacteria 3250
256 Ga0105248_10103209 3300009177 Unclassified 3214
257 Ga0105248_10148812 3300009177 Bacteria 2642
258 Ga0105248_10149636 3300009177 Bacteria 2634
259 Ga0105248_10220949 3300009177 Bacteria 2133
260 Ga0105248_10298955 3300009177 Bacteria 1813
261 Ga0105248_10346226 3300009177 Bacteria 1673
262 Ga0105248_10374132 3300009177 Bacteria 1604
263 Ga0105248_10439022 3300009177 Unclassified 1470
264 Ga0105248_10557457 3300009177 Bacteria 1293
265 Ga0105248_10890729 3300009177 Bacteria 1005
266 Ga0105237_10258996 3300009545 Bacteria 1742
267 Ga0105237_10855956 3300009545 Bacteria 916
268 Ga0105249_10008600 3300009553 Bacteria 8897
269 Ga0105249_10154609 3300009553 Bacteria 2211
270 Ga0105249_10304110 3300009553 Bacteria 1601
271 Ga0105249_10604901 3300009553 Bacteria 1151
272 Ga0105239_10308754 3300010375 Bacteria 1782
273 Ga0105239_11051594 3300010375 Bacteria 937
274 Ga0105246_10179158 3300011119 Bacteria 1630
275 Ga0157374_10059791 3300013296 Unclassified 3564
276 Ga0157374_10655187 3300013296 Unclassified 1062
277 Ga0157378_10027939 3300013297 Bacteria 4974
278 Ga0157378_10031806 3300013297 Unclassified 4660
279 Ga0157378_10333247 3300013297 Bacteria 1477
280 Ga0157378_10413546 3300013297 Bacteria 1332
281 Ga0163162_10201698 3300013306 Bacteria 2118
282 Ga0163162_10618212 3300013306 Bacteria 1209
283 Ga0163162_10732346 3300013306 Bacteria 1109
284 Ga0157372_10312781 3300013307 Bacteria 1828
285 Ga0157375_10150026 3300013308 Bacteria 2466
286 Ga0157375_10169804 3300013308 Bacteria 2328
287 Ga0157375_10342206 3300013308 Unclassified 1661
288 Ga0157375_10678949 3300013308 Bacteria 1185
289 Ga0157375_10848954 3300013308 Bacteria 1060
290 Ga0157375_10861942 3300013308 Bacteria 1052
291 Ga0157375_10931874 3300013308 Bacteria 1011
292 Ga0157375_11619300 3300013308 Bacteria 766
293 Ga0163163_10021898 3300014325 Bacteria 6040
294 Ga0163163_10060671 3300014325 Bacteria 3746
295 Ga0163163_10135432 3300014325 Bacteria 2504
296 Ga0163163_10251898 3300014325 Bacteria 1816
297 Ga0163163_11321085 3300014325 Unclassified 783
298 Ga0157380_10023729 3300014326 Bacteria 4631
299 Ga0157380_10379900 3300014326 Bacteria 1333
300 Ga0157380_10478326 3300014326 Bacteria 1204
301 Ga0157376_10168100 3300014969 Bacteria 1994
302 Ga0157376_10771861 3300014969 Unclassified 972
303 Ga0207697_10020800 3300025315 Bacteria 2686
304 Ga0207697_10094438 3300025315 Bacteria 1269
305 Ga0207682_10152394 3300025893 Bacteria 1043
306 Ga0207680_10088446 3300025903 Bacteria 1964
307 Ga0207680_10313981 3300025903 Bacteria 1095
308 Ga0207647_10011351 3300025904 Bacteria 6252
309 Ga0207645_10051870 3300025907 Bacteria 2621
310 Ga0207645_10176567 3300025907 Bacteria 1401
311 Ga0207643_10000897 3300025908 Bacteria 17851
312 Ga0207684_10024154 3300025910 Archaea 5185
313 Ga0207684_10178524 3300025910 Bacteria 1831
314 Ga0207684_10238183 3300025910 Bacteria 1570
315 Ga0207684_10371583 3300025910 Bacteria 1230
316 Ga0207684_10830964 3300025910 Bacteria 780
317 Ga0207654_10072473 3300025911 Bacteria 2051
318 Ga0207654_10465301 3300025911 Bacteria 889
319 Ga0207707_10056602 3300025912 Bacteria 3412
320 Ga0207671_10098914 3300025914 Bacteria 2207
321 Ga0207660_10344263 3300025917 Bacteria 1194
322 Ga0207662_10150430 3300025918 Bacteria 1480
323 Ga0207662_10314743 3300025918 Unclassified 1044
324 Ga0207657_10229789 3300025919 Bacteria 1484
325 Ga0207649_10080977 3300025920 Unclassified 2102
326 Ga0207652_10298971 3300025921 Bacteria 1453
327 Ga0207646_10000400 3300025922 Bacteria 58084
328 Ga0207646_10012631 3300025922 Bacteria 8107
329 Ga0207646_10028843 3300025922 Bacteria 5049
330 Ga0207646_10040775 3300025922 Bacteria 4175
331 Ga0207646_10049711 3300025922 Bacteria 3755
332 Ga0207646_10062534 3300025922 Bacteria 3323
333 Ga0207646_10127598 3300025922 Bacteria 2288
334 Ga0207646_10527655 3300025922 Bacteria 1063
335 Ga0207681_10003106 3300025923 Bacteria 10438
336 Ga0207681_10003989 3300025923 Bacteria 9157
337 Ga0207650_10396763 3300025925 Unclassified 1141
338 Ga0207650_10652644 3300025925 Bacteria 887
339 Ga0207659_10000183 3300025926 Bacteria 37254
340 Ga0207687_10006598 3300025927 Bacteria 7655
341 Ga0207644_10018454 3300025931 Bacteria 4720
342 Ga0207644_10114307 3300025931 Bacteria 2045
343 Ga0207690_10197584 3300025932 Bacteria 1525
344 Ga0207706_10155533 3300025933 Bacteria 2011
345 Ga0207686_10080798 3300025934 Bacteria 2120
346 Ga0207686_10217706 3300025934 Bacteria 1377
347 Ga0207709_10004644 3300025935 Bacteria 7903
348 Ga0207709_10662984 3300025935 Bacteria 832
349 Ga0207670_10000718 3300025936 Bacteria 17473
350 Ga0207670_10759766 3300025936 Bacteria 806
351 Ga0207669_10203980 3300025937 Bacteria 1438
352 Ga0207669_10593681 3300025937 Bacteria 899
353 Ga0207704_10013583 3300025938 Bacteria 4081
354 Ga0207704_10570570 3300025938 Bacteria 922
355 Ga0207691_10026547 3300025940 Bacteria 5434
356 Ga0207691_10057759 3300025940 Bacteria 3530
357 Ga0207691_10118979 3300025940 Bacteria 2343
358 Ga0207691_10209365 3300025940 Bacteria 1695
359 Ga0207691_10253318 3300025940 Bacteria 1519
360 Ga0207711_10023815 3300025941 Bacteria 5125
361 Ga0207711_10030945 3300025941 Bacteria 4515
362 Ga0207711_10032277 3300025941 Unclassified 4427
363 Ga0207711_10052946 3300025941 Bacteria 3480
364 Ga0207711_10075064 3300025941 Bacteria 2942
365 Ga0207711_10305596 3300025941 Bacteria 1468
366 Ga0207711_10482328 3300025941 Bacteria 1155
367 Ga0207711_10519267 3300025941 Bacteria 1110
368 Ga0207689_10222167 3300025942 Bacteria 1561
369 Ga0207689_10222804 3300025942 Bacteria 1558
370 Ga0207689_10408257 3300025942 Bacteria 1132
371 Ga0207661_10022824 3300025944 Bacteria 4718
372 Ga0207679_10018903 3300025945 Bacteria 4623
373 Ga0207679_10033316 3300025945 Bacteria 3623
374 Ga0207679_10589713 3300025945 Bacteria 1000
375 Ga0207651_10046664 3300025960 Bacteria 2915
376 Ga0207712_10092802 3300025961 Bacteria 2226
377 Ga0207712_10497378 3300025961 Bacteria 1042
378 Ga0207712_10503958 3300025961 Bacteria 1035
379 Ga0207712_10601143 3300025961 Bacteria 951
380 Ga0207640_10321101 3300025981 Bacteria 1233
381 Ga0207658_10341741 3300025986 Bacteria 1301
382 Ga0207677_10101427 3300026023 Bacteria 2119
383 Ga0207703_10408888 3300026035 Unclassified 1260
384 Ga0207703_10454716 3300026035 Bacteria 1197
385 Ga0207703_10598319 3300026035 Bacteria 1043
386 Ga0207703_10615469 3300026035 Bacteria 1028
387 Ga0207703_10677825 3300026035 Bacteria 979
388 Ga0207639_10643533 3300026041 Unclassified 980
389 Ga0207678_10030576 3300026067 Bacteria 4700
390 Ga0207708_10027890 3300026075 Bacteria 4275
391 Ga0207708_10391026 3300026075 Bacteria 1148
392 Ga0207641_10011359 3300026088 Bacteria 7308
393 Ga0207641_10057823 3300026088 Bacteria 3299
394 Ga0207641_10089754 3300026088 Bacteria 2686
395 Ga0207641_10121011 3300026088 Bacteria 2336
396 Ga0207641_10677795 3300026088 Bacteria 1014
397 Ga0207648_10046182 3300026089 Bacteria 3819
398 Ga0207648_10228384 3300026089 Bacteria 1655
399 Ga0207648_10426360 3300026089 Bacteria 1205
400 Ga0207676_10023873 3300026095 Bacteria 4518
401 Ga0207676_10042703 3300026095 Bacteria 3487
402 Ga0207676_10174311 3300026095 Bacteria 1877
403 Ga0207676_10327349 3300026095 Unclassified 1409
404 Ga0207676_10515954 3300026095 Bacteria 1137
405 Ga0207674_10069303 3300026116 Bacteria 3547
406 Ga0207674_10095220 3300026116 Bacteria 2964
407 Ga0207674_10100561 3300026116 Unclassified 2873
408 Ga0207674_10125362 3300026116 Bacteria 2534
409 Ga0207674_10163412 3300026116 Bacteria 2181
410 Ga0207674_10335765 3300026116 Bacteria 1461
411 Ga0207674_11105019 3300026116 Unclassified 762
412 Ga0207675_100060472 3300026118 Bacteria 3537
413 Ga0207675_100187618 3300026118 Bacteria 1982
414 Ga0207675_100193911 3300026118 Bacteria 1949
415 Ga0207675_100353542 3300026118 Bacteria 1440
416 Ga0207675_100485949 3300026118 Bacteria 1228
417 Ga0207675_100763292 3300026118 Bacteria 979
418 Ga0207675_100827625 3300026118 Bacteria 940
419 Ga0207683_10056957 3300026121 Bacteria 3430
420 Ga0207683_10114466 3300026121 Bacteria 2417
421 Ga0207698_10954818 3300026142 Bacteria 866
422 Ga0209813_10001257 3300027866 Bacteria 5652
423 Ga0209813_10080401 3300027866 Unclassified 1077
424 Ga0207428_10003668 3300027907 Bacteria 14788
425 Ga0207428_10014307 3300027907 Bacteria 6904
426 Ga0207428_10019341 3300027907 Bacteria 5807
427 Ga0207428_10240444 3300027907 Bacteria 1353
428 Ga0207428_10311532 3300027907 Bacteria 1164
429 Ga0268266_10123780 3300028379 Bacteria 2304
430 Ga0268266_10292728 3300028379 Bacteria 1517
431 Ga0268265_10122110 3300028380 Bacteria 2148
432 Ga0268265_10376974 3300028380 Bacteria 1304
433 Ga0268265_10478675 3300028380 Bacteria 1169
434 Ga0268265_10494261 3300028380 Bacteria 1151
435 Ga0268264_10069206 3300028381 Bacteria 2985
436 Ga0268264_10078644 3300028381 Bacteria 2812
437 Ga0268264_10968202 3300028381 Bacteria 856
438 Ga0265323_10012271 3300028653 Unclassified 3438
439 Ga0307410_10077904 3300031852 Bacteria 2319
440 Ga0373951_0011712 3300035091 Bacteria 1971
441 Ga0373952_0038329 3300035092 Bacteria 1098
442 Ga0373931_0153376 3300035691 Bacteria 1345
443 Ga0395900_0173675 3300037418 Bacteria 2193
444 Ga0395905_0465514 3300037471 Bacteria 1163
445 Ga0242419_000158 3300038698 Bacteria 3463
446 Ga0242422_00022 3300038699 Bacteria 6028
447 Ga0242420_000878 3300038996 Bacteria 3725
448 Ga0451847_0222433 3300041503 Bacteria 766
449 Ga0439443_018652 3300042003 Bacteria 1076
450 Ga0439448_0142573 3300042005 Bacteria 830
451 Ga0450910_020421 3300042147 Bacteria 999
452 Ga0450908_004246 3300042184 Bacteria 2768
453 Ga0439435_0007149 3300042436 Bacteria 2540
454 Ga0450918_029284 3300042531 Bacteria 970
455 Ga0451577_0029333 3300042876 Bacteria 4972
456 Ga0451577_0115256 3300042876 Bacteria 2406
457 Ga0451577_0256744 3300042876 Bacteria 1582
458 Ga0453683_0000301 3300044673 Bacteria 62521
459 Ga0453683_0059766 3300044673 Bacteria 2382
460 Ga0453684_0000435 3300044712 Bacteria 170233
461 Ga0453684_0000522 3300044712 Bacteria 146962
462 Ga0453684_0155946 3300044712 Bacteria 2707
463 Ga0453684_0206610 3300044712 Bacteria 2285
464 Ga0453684_0514410 3300044712 Bacteria 1323
465 Ga0451576_0004270 3300045051 Bacteria 18733
466 Ga0451576_0474572 3300045051 Bacteria 1314
467 Ga0451576_1593107 3300045051 Bacteria 677
468 Ga0495598_0064865 3300046537 Bacteria 1136
469 Ga0495656_0315895 3300046615 Unclassified 804
470 Ga0495670_0106532 3300046691 Bacteria 1448
471 Ga0495670_0254317 3300046691 Bacteria 937
472 Ga0495684_0225648 3300047471 Bacteria 1372
473 Ga0496100_0307544 3300048903 Bacteria 1188
474 Ga0496101_0287167 3300048904 Bacteria 1287
475 Ga0496101_0297497 3300048904 Bacteria 1264
476 Ga0496101_0455093 3300048904 Bacteria 1010
477 Ga0496104_0001298 3300048907 Bacteria 21543
478 Ga0496104_0057769 3300048907 Bacteria 3672
479 Ga0496104_0855461 3300048907 Bacteria 815
480 Ga0496105_0006271 3300048908 Bacteria 9135
481 Ga0496105_0181102 3300048908 Bacteria 1725
482 Ga0496105_0285797 3300048908 Bacteria 1329
483 Ga0496105_0547818 3300048908 Bacteria 903
484 Ga0496106_0995900 3300048909 Bacteria 659
485 Ga0496108_0325735 3300048911 Unclassified 1339
486 Ga0496109_0000358 3300048912 Bacteria 42386
487 Ga0496109_0025503 3300048912 Bacteria 5268
488 Ga0496110_0020331 3300048913 Bacteria 5605
489 Ga0496111_0006272 3300048914 Bacteria 7710
490 Ga0496111_0135092 3300048914 Bacteria 1827
491 Ga0496112_0000723 3300048915 Bacteria 22897
492 Ga0496112_0199491 3300048915 Bacteria 1961
493 Ga0496114_0051986 3300048917 Bacteria 3412
494 Ga0496114_0167405 3300048917 Unclassified 1914
495 Ga0496114_0730808 3300048917 Bacteria 866
496 Ga0496115_0182010 3300048918 Bacteria 1737
497 Ga0501032_0301823 3300049569 Bacteria 1035
498 Ga0501033_0144795 3300049570 Bacteria 1717
499 Ga0501034_0060005 3300049571 Bacteria 3821
500 Ga0501036_0065602 3300049572 Bacteria 3072
501 Ga0501036_0204740 3300049572 Bacteria 1659
502 Ga0501036_0459119 3300049572 Bacteria 1061
503 Ga0501038_0091332 3300049574 Bacteria 2551
504 Ga0501039_0014151 3300049575 Bacteria 6109
505 Ga0501039_0094090 3300049575 Bacteria 2336
506 Ga0501039_0158431 3300049575 Bacteria 1779
507 Ga0501041_0106356 3300049577 Bacteria 1739
508 Ga0501042_0007287 3300049578 Bacteria 7236
509 Ga0501046_0034698 3300049580 Bacteria 4069
510 Ga0501067_0239252 3300049583 Bacteria 1010
511 Ga0501068_0006353 3300049584 Bacteria 6513
512 Ga0501068_0056741 3300049584 Bacteria 2374
513 Ga0501071_0007840 3300049587 Bacteria 7042
514 Ga0501071_0069575 3300049587 Bacteria 2563
515 Ga0501071_0089361 3300049587 Bacteria 2260
516 Ga0501071_0184248 3300049587 Bacteria 1565
517 Ga0501072_0017077 3300049588 Bacteria 5576
518 Ga0501072_0170478 3300049588 Bacteria 1737
519 Ga0501073_0104380 3300049589 Bacteria 1967
520 Ga0501073_0265459 3300049589 Bacteria 1185
521 Ga0501074_0050623 3300049590 Bacteria 2999
522 Ga0501075_0119062 3300049591 Bacteria 2008
523 Ga0501075_0208978 3300049591 Bacteria 1489
524 Ga0501076_0006585 3300049592 Bacteria 8425
525 Ga0501076_0006825 3300049592 Bacteria 8285
526 Ga0501076_0265034 3300049592 Bacteria 1407
527 Ga0501079_0116378 3300049741 Bacteria 2078
528 Ga0501080_0485538 3300049742 Bacteria 1105
529 Ga0501081_0050108 3300049743 Bacteria 2877
530 Ga0501081_0083896 3300049743 Bacteria 2234
531 Ga0501081_0105911 3300049743 Bacteria 1993
532 Ga0501081_0265355 3300049743 Bacteria 1255
533 Ga0501081_0395150 3300049743 Bacteria 1023
534 Ga0501081_0525949 3300049743 Bacteria 882
535 Ga0501044_0453890 3300049823 Bacteria 1188
536 Ga0501045_0026700 3300049824 Bacteria 4156
537 Ga0501045_0444232 3300049824 Bacteria 964
538 nmdc:mga00v17_277135_c1 3300050491 Bacteria 1089
539 nmdc:mga0k408_104472_c1 3300050493 Bacteria 1672
540 nmdc:mga0k408_107452_c1 3300050493 Bacteria 1648
541 nmdc:mga0k408_20268_c1 3300050493 Bacteria 3723
542 nmdc:mga06z11_156194_c1 3300050494 Bacteria 1301
543 nmdc:mga04h51_1980_c1 3300050495 Bacteria 4782
544 nmdc:mga07m45_20808_c1 3300050496 Bacteria 3566
545 nmdc:mga07m45_23036_c1 3300050496 Bacteria 3402
546 nmdc:mga07m45_46564_c1 3300050496 Bacteria 2437
547 nmdc:mga05p37_106289_c1 3300050507 Bacteria 3453
548 nmdc:mga05p37_49265_c1 3300050507 Bacteria 5181
549 nmdc:mga05p37_625200_c1 3300050507 Bacteria 1211
550 nmdc:mga09592_190526_c1 3300050508 Bacteria 1775
551 nmdc:mga09592_197260_c1 3300050508 Bacteria 1743
552 nmdc:mga06r32_1119526_c1 3300050510 Bacteria 736
553 nmdc:mga06r32_284379_c1 3300050510 Bacteria 1641
554 nmdc:mga06r32_42502_c1 3300050510 Bacteria 4321
555 nmdc:mga08y16_26146_c1 3300050511 Bacteria 6156
556 nmdc:mga08y16_46855_c1 3300050511 Bacteria 4525
557 nmdc:mga08y16_478291_c1 3300050511 Bacteria 1268
558 nmdc:mga08y16_65600_c1 3300050511 Bacteria 3790
559 nmdc:mga08y16_6918_c1 3300050511 Bacteria 11892
560 nmdc:mga0n895_105678_c1 3300050512 Bacteria 2828
561 nmdc:mga0n895_156666_c1 3300050512 Bacteria 2308
562 nmdc:mga0n895_267012_c1 3300050512 Bacteria 1736
563 nmdc:mga0n895_351196_c1 3300050512 Bacteria 1494
564 nmdc:mga0n895_39864_c1 3300050512 Bacteria 4561
565 nmdc:mga0rr50_63565_c1 3300050513 Bacteria 2788
566 nmdc:mga08x19_56943_c1 3300050514 Bacteria 2525
567 nmdc:mga08x19_85106_c1 3300050514 Bacteria 2080
568 nmdc:mga0a205_104451_c1 3300050515 Bacteria 2732
569 nmdc:mga0a205_276932_c1 3300050515 Bacteria 1554
570 nmdc:mga0a205_61299_c1 3300050515 Bacteria 3633
571 nmdc:mga0a205_74787_c1 3300050515 Bacteria 3273
572 nmdc:mga0a205_866492_c1 3300050515 Bacteria 750
573 nmdc:mga0a205_925737_c1 3300050515 Bacteria 718
574 nmdc:mga0a205_94192_c1 3300050515 Bacteria 2893
575 Ga0495619_0278782 3300053085 Bacteria 1158
576 Ga0501084_0004552 3300054114 Bacteria 11337
577 Ga0501084_0076019 3300054114 Bacteria 2814
578 Ga0501084_0175087 3300054114 Bacteria 1811
579 Ga0501084_0386039 3300054114 Bacteria 1183
580 Ga0501084_0512155 3300054114 Bacteria 1014
581 Ga0590071_004996 3300059421 Bacteria 3201
582 Ga0590074_007827 3300059423 Bacteria 1779
583 Ga0590075_014623 3300059424 Bacteria 1920
584 Ga0501082_0028575 3300060353 Bacteria 4804
585 Ga0501082_0423283 3300060353 Bacteria 1163
586 Ga0530510_0167704 3300061734 Bacteria 1626
587 Ga0530510_0352224 3300061734 Bacteria 1106
588 2688394408 2687453341 Bacteria 6534136
589 Ga0070707_100038250
590 JGI24751J29686_10048531
591 JGI25406J46586_10020270
592 Ga0065704_10005518
593 Ga0065712_10006274
594 Ga0065712_10070460
595 Ga0065712_10078459
596 Ga0065712_10210809
597 Ga0065715_10091261
598 Ga0065715_10097008
599 Ga0065715_10097855
600 Ga0065715_10115023
601 Ga0065715_10167051
602 Ga0065715_10221182
603 Ga0065707_10096077
604 Ga0065707_10141425
605 Ga0070658_10292425
606 Ga0070676_10440172
607 Ga0070683_100022048
608 Ga0070690_100131605
609 Ga0070690_100539890
610 Ga0070670_100495376
611 Ga0068869_100501285
612 Ga0068869_100796399
613 Ga0070666_10105973
614 Ga0070666_10385504
615 Ga0070680_100286071
616 Ga0070680_100540199
617 Ga0070682_100057392
618 Ga0070660_100280219
619 Ga0070689_100000378
620 Ga0070689_100193211
621 Ga0070689_100849902
622 Ga0070661_100584876
623 Ga0070692_10018510
624 Ga0070692_10123111
625 Ga0070669_100001680
626 Ga0070669_100065454
627 Ga0070669_100422627
628 Ga0070675_100000046
629 Ga0070675_100304589
630 Ga0070675_100411530
631 Ga0070675_100571096
632 Ga0070671_100715815
633 Ga0070674_100052864
634 Ga0070674_100436633
635 Ga0070674_100509133
636 Ga0070673_100053135
637 Ga0070673_100602650
638 Ga0070659_100127209
639 Ga0070667_100024918
640 Ga0070667_100375343
641 Ga0070703_10187310
642 Ga0070709_10162659
643 Ga0070701_10425302
644 Ga0070711_100182361
645 Ga0070705_100037838
646 Ga0070705_100046113
647 Ga0070700_100021594
648 Ga0070700_100605394
649 Ga0070694_100478023
650 Ga0070708_100000153
651 Ga0070708_100008250
652 Ga0070708_100088138
653 Ga0070708_100173158
654 Ga0070663_100005355
655 Ga0070663_100037042
656 Ga0070663_100703532
657 Ga0070678_100047766
658 Ga0070678_100492207
659 Ga0070662_100178579
660 Ga0070662_100216793
661 Ga0070662_100546708
662 Ga0070681_10071657
663 Ga0068867_100056684
664 Ga0068867_100202335
665 Ga0070706_100202434
666 Ga0070706_100210443
667 Ga0070707_100000212
668 Ga0070707_100020965
669 Ga0070707_100111665
670 Ga0070707_100125502
671 Ga0070707_100390496
672 Ga0070707_100644921
673 Ga0070707_100682586
674 Ga0070698_100003146
675 Ga0070698_100071754
676 Ga0070698_100072030
677 Ga0070698_100821081
678 Ga0070699_100001355
679 Ga0070699_100001667
680 Ga0070699_100013191
681 Ga0070699_100039985
682 Ga0070699_100158143
683 Ga0070679_100050796
684 Ga0070684_100001564
685 Ga0070684_100158389
686 Ga0070684_100194052
687 Ga0070697_101022776
688 Ga0068853_100026275
689 Ga0068853_100162256
690 Ga0070672_100127050
691 Ga0070672_100189773
692 Ga0070672_100340870
693 Ga0070686_100018188
694 Ga0070686_100770875
695 Ga0070695_100392351
696 Ga0070695_100510595
697 Ga0070696_100086985
698 Ga0070696_100703376
699 Ga0070665_100028869
700 Ga0070665_100559599
701 Ga0070704_100070381
702 Ga0070704_100440544
703 Ga0070704_100533725
704 Ga0070704_100649806
705 Ga0070704_100719448
706 Ga0068855_100538774
707 Ga0070664_100008845
708 Ga0070664_100305709
709 Ga0070664_100431588
710 Ga0068857_100055714
711 Ga0068857_100078935
712 Ga0068857_100081102
713 Ga0068857_100101897
714 Ga0068857_100237477
715 Ga0068854_100151715
716 Ga0068854_100172096
717 Ga0070702_100145045
718 Ga0070702_100593241
719 Ga0068852_100083153
720 Ga0068859_100548799
721 Ga0068859_100820798
722 Ga0068859_100843569
723 Ga0068859_100871450
724 Ga0068859_100959699
725 Ga0068859_101307634
726 Ga0068864_100022048
727 Ga0068864_100038781
728 Ga0068864_100054483
729 Ga0068864_100305914
730 Ga0068864_100448540
731 Ga0068864_100559227
732 Ga0068866_10038095
733 Ga0068866_10338956
734 Ga0068861_100072175
735 Ga0068861_100081642
736 Ga0068861_100115817
737 Ga0068861_100163724
738 Ga0068870_10467919
739 Ga0068870_10474171
740 Ga0068863_100023950
741 Ga0068863_100100304
742 Ga0068858_100124744
743 Ga0068858_100385576
744 Ga0068858_100462767
745 Ga0068858_100466196
746 Ga0068858_100967113
747 Ga0068860_100329152
748 Ga0068860_100573813
749 Ga0068860_100760563
750 Ga0068860_100834274
751 Ga0068862_100021487
752 Ga0068862_100087160
753 Ga0068862_100904465
754 Ga0081455_10032790
755 Ga0081455_10119732
756 Ga0081538_10001691
757 Ga0081538_10002822
758 Ga0081538_10004684
759 Ga0081538_10144419
760 Ga0081539_10001592
761 Ga0075368_10008625
762 Ga0075364_10010656
763 Ga0075432_10041962
764 Ga0075362_10232507
765 Ga0075367_10095872
766 Ga0075367_10108299
767 Ga0075367_10133169
768 Ga0075366_10037931
769 Ga0075366_10050674
770 Ga0075366_10140024
771 Ga0097621_100011581
772 Ga0097621_100018807
773 Ga0097621_100120666
774 Ga0097621_100892372
775 Ga0075370_10032925
776 Ga0075370_10094381
777 Ga0068871_100001525
778 Ga0068871_100014148
779 Ga0068871_100540181
780 Ga0068871_100637863
781 Ga0075428_100006321
782 Ga0075428_100662842
783 Ga0075430_100036235
784 Ga0075431_100014678
785 Ga0075431_100256328
786 Ga0075431_100334239
787 Ga0075433_10031501
788 Ga0075433_10126625
789 Ga0075433_10163109
790 Ga0075433_10174213
791 Ga0075433_10408414
792 Ga0075434_100025920
793 Ga0075434_100065119
794 Ga0075434_100074739
795 Ga0075434_100112866
796 Ga0075434_100136570
797 Ga0075434_100374130
798 Ga0075434_100654539
799 Ga0075434_100723866
800 Ga0075429_100075832
801 Ga0075429_100158481
802 Ga0068865_100006100
803 Ga0068865_100028362
804 Ga0068865_100085123
805 Ga0075436_100170992
806 Ga0075436_100239512
807 Ga0097620_100548799
808 Ga0097620_100820827
809 Ga0097620_100843560
810 Ga0097620_100871237
811 Ga0097620_100959722
812 Ga0097620_101307837
813 Ga0075435_100092856
814 Ga0075435_100264028
815 Ga0075435_100436153
816 Ga0105251_10158738
817 Ga0111539_10002299
818 Ga0111539_10002948
819 Ga0111539_10005839
820 Ga0111539_10051293
821 Ga0111539_10067583
822 Ga0111539_10093050
823 Ga0105245_10210892
824 Ga0105245_10668910
825 Ga0105245_10718205
826 Ga0105245_11323646
827 Ga0105247_10095478
828 Ga0114129_10013275
829 Ga0114129_10119072
830 Ga0114129_10142751
831 Ga0114129_10275538
832 Ga0105243_10001323
833 Ga0105243_10171692
834 Ga0105243_10309604
835 Ga0105241_10067315
836 Ga0105241_10357870
837 Ga0105242_10052619
838 Ga0105242_10222074
839 Ga0105242_10283801
840 Ga0105242_10435772
841 Ga0105248_10014952
842 Ga0105248_10047751
843 Ga0105248_10101062
844 Ga0105248_10103209
845 Ga0105248_10148812
846 Ga0105248_10149636
847 Ga0105248_10220949
848 Ga0105248_10298955
849 Ga0105248_10346226
850 Ga0105248_10374132
851 Ga0105248_10439022
852 Ga0105248_10557457
853 Ga0105248_10890729
854 Ga0105237_10258996
855 Ga0105237_10855956
856 Ga0105249_10008600
857 Ga0105249_10154609
858 Ga0105249_10304110
859 Ga0105249_10604901
860 Ga0105239_10308754
861 Ga0105239_11051594
862 Ga0105246_10179158
863 Ga0157374_10059791
864 Ga0157374_10655187
865 Ga0157378_10027939
866 Ga0157378_10031806
867 Ga0157378_10333247
868 Ga0157378_10413546
869 Ga0163162_10201698
870 Ga0163162_10618212
871 Ga0163162_10732346
872 Ga0157372_10312781
873 Ga0157375_10150026
874 Ga0157375_10169804
875 Ga0157375_10342206
876 Ga0157375_10678949
877 Ga0157375_10848954
878 Ga0157375_10861942
879 Ga0157375_10931874
880 Ga0157375_11619300
881 Ga0163163_10021898
882 Ga0163163_10060671
883 Ga0163163_10135432
884 Ga0163163_10251898
885 Ga0163163_11321085
886 Ga0157380_10023729
887 Ga0157380_10379900
888 Ga0157380_10478326
889 Ga0157376_10168100
890 Ga0157376_10771861
891 Ga0207697_10020800
892 Ga0207697_10094438
893 Ga0207682_10152394
894 Ga0207680_10088446
895 Ga0207680_10313981
896 Ga0207647_10011351
897 Ga0207645_10051870
898 Ga0207645_10176567
899 Ga0207643_10000897
900 Ga0207684_10024154
901 Ga0207684_10178524
902 Ga0207684_10238183
903 Ga0207684_10371583
904 Ga0207684_10830964
905 Ga0207654_10072473
906 Ga0207654_10465301
907 Ga0207707_10056602
908 Ga0207671_10098914
909 Ga0207660_10344263
910 Ga0207662_10150430
911 Ga0207662_10314743
912 Ga0207657_10229789
913 Ga0207649_10080977
914 Ga0207652_10298971
915 Ga0207646_10000400
916 Ga0207646_10012631
917 Ga0207646_10028843
918 Ga0207646_10040775
919 Ga0207646_10049711
920 Ga0207646_10062534
921 Ga0207646_10127598
922 Ga0207646_10527655
923 Ga0207681_10003106
924 Ga0207681_10003989
925 Ga0207650_10396763
926 Ga0207650_10652644
927 Ga0207659_10000183
928 Ga0207687_10006598
929 Ga0207644_10018454
930 Ga0207644_10114307
931 Ga0207690_10197584
932 Ga0207706_10155533
933 Ga0207686_10080798
934 Ga0207686_10217706
935 Ga0207709_10004644
936 Ga0207709_10662984
937 Ga0207670_10000718
938 Ga0207670_10759766
939 Ga0207669_10203980
940 Ga0207669_10593681
941 Ga0207704_10013583
942 Ga0207704_10570570
943 Ga0207691_10026547
944 Ga0207691_10057759
945 Ga0207691_10118979
946 Ga0207691_10209365
947 Ga0207691_10253318
948 Ga0207711_10023815
949 Ga0207711_10030945
950 Ga0207711_10032277
951 Ga0207711_10052946
952 Ga0207711_10075064
953 Ga0207711_10305596
954 Ga0207711_10482328
955 Ga0207711_10519267
956 Ga0207689_10222167
957 Ga0207689_10222804
958 Ga0207689_10408257
959 Ga0207661_10022824
960 Ga0207679_10018903
961 Ga0207679_10033316
962 Ga0207679_10589713
963 Ga0207651_10046664
964 Ga0207712_10092802
965 Ga0207712_10497378
966 Ga0207712_10503958
967 Ga0207712_10601143
968 Ga0207640_10321101
969 Ga0207658_10341741
970 Ga0207677_10101427
971 Ga0207703_10408888
972 Ga0207703_10454716
973 Ga0207703_10598319
974 Ga0207703_10615469
975 Ga0207703_10677825
976 Ga0207639_10643533
977 Ga0207678_10030576
978 Ga0207708_10027890
979 Ga0207708_10391026
980 Ga0207641_10011359
981 Ga0207641_10057823
982 Ga0207641_10089754
983 Ga0207641_10121011
984 Ga0207641_10677795
985 Ga0207648_10046182
986 Ga0207648_10228384
987 Ga0207648_10426360
988 Ga0207676_10023873
989 Ga0207676_10042703
990 Ga0207676_10174311
991 Ga0207676_10327349
992 Ga0207676_10515954
993 Ga0207674_10069303
994 Ga0207674_10095220
995 Ga0207674_10100561
996 Ga0207674_10125362
997 Ga0207674_10163412
998 Ga0207674_10335765
999 Ga0207674_11105019
1000 Ga0207675_100060472
1001 Ga0207675_100187618
1002 Ga0207675_100193911
1003 Ga0207675_100353542
1004 Ga0207675_100485949
1005 Ga0207675_100763292
1006 Ga0207675_100827625
1007 Ga0207683_10056957
1008 Ga0207683_10114466
1009 Ga0207698_10954818
1010 Ga0209813_10001257
1011 Ga0209813_10080401
1012 Ga0207428_10003668
1013 Ga0207428_10014307
1014 Ga0207428_10019341
1015 Ga0207428_10240444
1016 Ga0207428_10311532
1017 Ga0268266_10123780
1018 Ga0268266_10292728
1019 Ga0268265_10122110
1020 Ga0268265_10376974
1021 Ga0268265_10478675
1022 Ga0268265_10494261
1023 Ga0268264_10069206
1024 Ga0268264_10078644
1025 Ga0268264_10968202
1026 Ga0265323_10012271
1027 Ga0307410_10077904
1028 Ga0373951_0011712
1029 Ga0373952_0038329
1030 Ga0373931_0153376
1031 Ga0395900_0173675
1032 Ga0395905_0465514
1033 Ga0242419_000158
1034 Ga0242422_00022
1035 Ga0242420_000878
1036 Ga0451847_0222433
1037 Ga0439443_018652
1038 Ga0439448_0142573
1039 Ga0450910_020421
1040 Ga0450908_004246
1041 Ga0439435_0007149
1042 Ga0450918_029284
1043 Ga0451577_0029333
1044 Ga0451577_0115256
1045 Ga0451577_0256744
1046 Ga0453683_0000301
1047 Ga0453683_0059766
1048 Ga0453684_0000435
1049 Ga0453684_0000522
1050 Ga0453684_0155946
1051 Ga0453684_0206610
1052 Ga0453684_0514410
1053 Ga0451576_0004270
1054 Ga0451576_0474572
1055 Ga0451576_1593107
1056 Ga0495598_0064865
1057 Ga0495656_0315895
1058 Ga0495670_0106532
1059 Ga0495670_0254317
1060 Ga0495684_0225648
1061 Ga0496100_0307544
1062 Ga0496101_0287167
1063 Ga0496101_0297497
1064 Ga0496101_0455093
1065 Ga0496104_0001298
1066 Ga0496104_0057769
1067 Ga0496104_0855461
1068 Ga0496105_0006271
1069 Ga0496105_0181102
1070 Ga0496105_0285797
1071 Ga0496105_0547818
1072 Ga0496106_0995900
1073 Ga0496108_0325735
1074 Ga0496109_0000358
1075 Ga0496109_0025503
1076 Ga0496110_0020331
1077 Ga0496111_0006272
1078 Ga0496111_0135092
1079 Ga0496112_0000723
1080 Ga0496112_0199491
1081 Ga0496114_0051986
1082 Ga0496114_0167405
1083 Ga0496114_0730808
1084 Ga0496115_0182010
1085 Ga0501032_0301823
1086 Ga0501033_0144795
1087 Ga0501034_0060005
1088 Ga0501036_0065602
1089 Ga0501036_0204740
1090 Ga0501036_0459119
1091 Ga0501038_0091332
1092 Ga0501039_0014151
1093 Ga0501039_0094090
1094 Ga0501039_0158431
1095 Ga0501041_0106356
1096 Ga0501042_0007287
1097 Ga0501046_0034698
1098 Ga0501067_0239252
1099 Ga0501068_0006353
1100 Ga0501068_0056741
1101 Ga0501071_0007840
1102 Ga0501071_0069575
1103 Ga0501071_0089361
1104 Ga0501071_0184248
1105 Ga0501072_0017077
1106 Ga0501072_0170478
1107 Ga0501073_0104380
1108 Ga0501073_0265459
1109 Ga0501074_0050623
1110 Ga0501075_0119062
1111 Ga0501075_0208978
1112 Ga0501076_0006585
1113 Ga0501076_0006825
1114 Ga0501076_0265034
1115 Ga0501079_0116378
1116 Ga0501080_0485538
1117 Ga0501081_0050108
1118 Ga0501081_0083896
1119 Ga0501081_0105911
1120 Ga0501081_0265355
1121 Ga0501081_0395150
1122 Ga0501081_0525949
1123 Ga0501044_0453890
1124 Ga0501045_0026700
1125 Ga0501045_0444232
1126 nmdc:mga00v17_277135_c1
1127 nmdc:mga0k408_104472_c1
1128 nmdc:mga0k408_107452_c1
1129 nmdc:mga0k408_20268_c1
1130 nmdc:mga06z11_156194_c1
1131 nmdc:mga04h51_1980_c1
1132 nmdc:mga07m45_20808_c1
1133 nmdc:mga07m45_23036_c1
1134 nmdc:mga07m45_46564_c1
1135 nmdc:mga05p37_106289_c1
1136 nmdc:mga05p37_49265_c1
1137 nmdc:mga05p37_625200_c1
1138 nmdc:mga09592_190526_c1
1139 nmdc:mga09592_197260_c1
1140 nmdc:mga06r32_1119526_c1
1141 nmdc:mga06r32_284379_c1
1142 nmdc:mga06r32_42502_c1
1143 nmdc:mga08y16_26146_c1
1144 nmdc:mga08y16_46855_c1
1145 nmdc:mga08y16_478291_c1
1146 nmdc:mga08y16_65600_c1
1147 nmdc:mga08y16_6918_c1
1148 nmdc:mga0n895_105678_c1
1149 nmdc:mga0n895_156666_c1
1150 nmdc:mga0n895_267012_c1
1151 nmdc:mga0n895_351196_c1
1152 nmdc:mga0n895_39864_c1
1153 nmdc:mga0rr50_63565_c1
1154 nmdc:mga08x19_56943_c1
1155 nmdc:mga08x19_85106_c1
1156 nmdc:mga0a205_104451_c1
1157 nmdc:mga0a205_276932_c1
1158 nmdc:mga0a205_61299_c1
1159 nmdc:mga0a205_74787_c1
1160 nmdc:mga0a205_866492_c1
1161 nmdc:mga0a205_925737_c1
1162 nmdc:mga0a205_94192_c1
1163 Ga0495619_0278782
1164 Ga0501084_0004552
1165 Ga0501084_0076019
1166 Ga0501084_0175087
1167 Ga0501084_0386039
1168 Ga0501084_0512155
1169 Ga0590071_004996
1170 Ga0590074_007827
1171 Ga0590075_014623
1172 Ga0501082_0028575
1173 Ga0501082_0423283
1174 Ga0530510_0167704
1175 Ga0530510_0352224
1176 2688394408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01694

Rhomboid

Rhomboid family

81

233

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pj5-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7818 20 223
3odj-assembly1.cif.gz_A crystal structure of h. influenzae rhomboid glpg with disordered loop 4, helix 5 and loop 5 0.7765 23 223
5f5d-assembly1.cif.gz_A crystal structures and inhibition kinetics reveal a two-state catalytic mechanism with drug design implications for rhomboid proteolysis 0.7652 23 225
6pjq-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7578 23 223
6pju-assembly1.cif.gz_A time-resolved structural snapshot of proteolysis by glpg inside the membrane 0.7577 23 223
ID Description Score Start End Superfamily
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8618 19 225 1.20.1540.10
af_O53632_31_206_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8343 19 225 1.20.1540.10
af_A0A0P0VIC0_209_332_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8174 21 138 1.20.1540.10
af_A4HUH9_144_304_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.8117 42 159 1.20.1540.10
af_Q54D88_171_373_1.20.1540.10 Mainly Alpha;Up-down Bundle;Rhomboid-like fold;Rhomboid-like 0.7948 22 224 1.20.1540.10
ID Description Score Start End GO Terms
AF-A0A537IWD0-F1-model_v4 Rhomboid family intramembrane serine protease 0.9388 9 165 GO:0004252
GO:0006508
GO:0016020
AF-A0A7T9CWR5-F1-model_v4 deleted 0.9342 9 164
AF-A0A836QT57-F1-model_v4 Rhomboid family intramembrane serine protease 0.9274 9 164 GO:0004252
GO:0006508
GO:0016020
AF-A0A7C2ZZI3-F1-model_v4 Rhomboid family intramembrane serine protease 0.927 9 171 GO:0004252
GO:0006508
GO:0016020
AF-A0A151F5F2-F1-model_v4 Peptidase S54 rhomboid domain-containing protein 0.9258 9 228 GO:0004252
GO:0016020

Map