F466712

General Info

Members Datasets Scaffolds Average Seq Length
587 267 586 152

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0001127|Ga0501038_0001127_1652_2107
Length 141
Sequence MRYWLMKSEPSDVSIDDLAAMPQQSVAWYGVRNYQARNFMRDQMHVGDGVFFYHSSCDQPGIVGIAEVSKLAYPDATQFDTHETPRWFNVDVRFVKKTRLVGIKELRTYPELASLRILQKGSRLSITPVDPAEWKFIMSIL

Samples

Sample ID Description Type Environment
1 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
161 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
162 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
163 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
164 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
165 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
166 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
170 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
171 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
172 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
177 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
180 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
193 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
194 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
219 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
244 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
245 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
246 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
261 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
262 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
263 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.7
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10088155 3300005295 Bacteria 4752
2 Ga0070676_10091152 3300005328 Bacteria 1867
3 Ga0070676_10593848 3300005328 Bacteria 798
4 Ga0070683_100005993 3300005329 Bacteria 10182
5 Ga0070683_101120250 3300005329 Bacteria 756
6 Ga0070690_100020616 3300005330 Bacteria 4017
7 Ga0070690_100179945 3300005330 Bacteria 1460
8 Ga0070690_101073249 3300005330 Bacteria 637
9 Ga0070670_100099301 3300005331 Bacteria 2505
10 Ga0070670_100111702 3300005331 Bacteria 2355
11 Ga0070670_100183960 3300005331 Bacteria 1814
12 Ga0070670_100590201 3300005331 Bacteria 993
13 Ga0070670_100660220 3300005331 Bacteria 938
14 Ga0070677_10030891 3300005333 Bacteria 2042
15 Ga0068869_100012871 3300005334 Bacteria 5539
16 Ga0068869_100166660 3300005334 Bacteria 1718
17 Ga0068869_100195966 3300005334 Bacteria 1591
18 Ga0068869_100219187 3300005334 Bacteria 1507
19 Ga0068869_100548137 3300005334 Bacteria 971
20 Ga0070666_10019989 3300005335 Bacteria 4327
21 Ga0070666_10196458 3300005335 Bacteria 1418
22 Ga0070680_100007666 3300005336 Bacteria 8233
23 Ga0070680_100120207 3300005336 Bacteria 2192
24 Ga0068868_100004430 3300005338 Bacteria 9850
25 Ga0068868_100031683 3300005338 Bacteria 4064
26 Ga0068868_100192093 3300005338 Bacteria 1698
27 Ga0070660_100193513 3300005339 Bacteria 1648
28 Ga0070689_100006974 3300005340 Bacteria 7868
29 Ga0070689_100127234 3300005340 Bacteria 2040
30 Ga0070691_10004016 3300005341 Bacteria 6662
31 Ga0070691_10246869 3300005341 Bacteria 956
32 Ga0070687_100005624 3300005343 Bacteria 5083
33 Ga0070687_100095053 3300005343 Bacteria 1656
34 Ga0070692_10175929 3300005345 Bacteria 1237
35 Ga0070692_10540180 3300005345 Bacteria 762
36 Ga0070692_10924643 3300005345 Bacteria 605
37 Ga0070669_100235615 3300005353 Bacteria 1452
38 Ga0070669_100235797 3300005353 Bacteria 1452
39 Ga0070669_100242264 3300005353 Bacteria 1433
40 Ga0070675_100003469 3300005354 Bacteria 11951
41 Ga0070675_100009160 3300005354 Bacteria 7689
42 Ga0070675_100969070 3300005354 Bacteria 780
43 Ga0070671_100114826 3300005355 Bacteria 2263
44 Ga0070671_100245985 3300005355 Bacteria 1519
45 Ga0070671_100246367 3300005355 Bacteria 1517
46 Ga0070671_100271307 3300005355 Bacteria 1442
47 Ga0070674_100048269 3300005356 Bacteria 2921
48 Ga0070674_100084208 3300005356 Bacteria 2280
49 Ga0070674_100432878 3300005356 Bacteria 1082
50 Ga0070674_101281494 3300005356 Bacteria 653
51 Ga0070673_100222411 3300005364 Bacteria 1634
52 Ga0070673_100288659 3300005364 Bacteria 1441
53 Ga0070688_100599768 3300005365 Bacteria 843
54 Ga0070659_100707743 3300005366 Bacteria 871
55 Ga0070667_100160427 3300005367 Bacteria 1980
56 Ga0070667_100478044 3300005367 Bacteria 1140
57 Ga0070703_10032430 3300005406 Bacteria 1587
58 Ga0070714_100165478 3300005435 Bacteria 2004
59 Ga0070701_10013209 3300005438 Bacteria 3750
60 Ga0070705_100005216 3300005440 Bacteria 6312
61 Ga0070705_100037148 3300005440 Bacteria 2745
62 Ga0070705_100301890 3300005440 Bacteria 1148
63 Ga0070700_100122995 3300005441 Bacteria 1741
64 Ga0070700_100454302 3300005441 Bacteria 975
65 Ga0070694_100001975 3300005444 Bacteria 12172
66 Ga0070694_100062730 3300005444 Bacteria 2540
67 Ga0070694_100104129 3300005444 Bacteria 2012
68 Ga0070694_100367656 3300005444 Bacteria 1118
69 Ga0070663_100091084 3300005455 Bacteria 2259
70 Ga0070678_100012489 3300005456 Bacteria 5283
71 Ga0070678_100075432 3300005456 Bacteria 2537
72 Ga0070678_100270258 3300005456 Bacteria 1433
73 Ga0070678_100862877 3300005456 Bacteria 825
74 Ga0070662_100094174 3300005457 Bacteria 2255
75 Ga0070662_100144522 3300005457 Bacteria 1847
76 Ga0070681_10036165 3300005458 Bacteria 4960
77 Ga0070681_10082987 3300005458 Bacteria 3159
78 Ga0068867_100043738 3300005459 Bacteria 3279
79 Ga0068867_100056291 3300005459 Bacteria 2909
80 Ga0068867_100103690 3300005459 Bacteria 2176
81 Ga0068867_100130500 3300005459 Bacteria 1952
82 Ga0068867_101047182 3300005459 Bacteria 742
83 Ga0068867_101049219 3300005459 Bacteria 741
84 Ga0068867_101171796 3300005459 Bacteria 704
85 Ga0070685_10489973 3300005466 Bacteria 868
86 Ga0070706_100090429 3300005467 Bacteria 2839
87 Ga0070706_100386438 3300005467 Bacteria 1303
88 Ga0070706_100935433 3300005467 Bacteria 800
89 Ga0070698_100060911 3300005471 Bacteria 3807
90 Ga0070698_100476368 3300005471 Bacteria 1185
91 Ga0070699_100188465 3300005518 Bacteria 1832
92 Ga0070699_100346360 3300005518 Bacteria 1338
93 Ga0070679_100375018 3300005530 Bacteria 1369
94 Ga0070684_100040031 3300005535 Bacteria 4033
95 Ga0070697_100019510 3300005536 Bacteria 5357
96 Ga0068853_100142454 3300005539 Bacteria 2153
97 Ga0068853_100168239 3300005539 Bacteria 1982
98 Ga0068853_100351781 3300005539 Bacteria 1371
99 Ga0068853_100579463 3300005539 Bacteria 1065
100 Ga0070672_100005239 3300005543 Bacteria 8580
101 Ga0070672_100132721 3300005543 Bacteria 2048
102 Ga0070672_100145966 3300005543 Bacteria 1955
103 Ga0070686_100070448 3300005544 Bacteria 2286
104 Ga0070686_100162584 3300005544 Bacteria 1573
105 Ga0070686_100832087 3300005544 Bacteria 746
106 Ga0070695_100070313 3300005545 Bacteria 2289
107 Ga0070695_100229835 3300005545 Bacteria 1340
108 Ga0070695_100857307 3300005545 Bacteria 731
109 Ga0070696_100009954 3300005546 Bacteria 6361
110 Ga0070696_100030997 3300005546 Bacteria 3663
111 Ga0070696_100277180 3300005546 Bacteria 1277
112 Ga0070693_100000922 3300005547 Bacteria 13058
113 Ga0070693_100034155 3300005547 Bacteria 2813
114 Ga0070665_100009467 3300005548 Bacteria 9856
115 Ga0070665_100023321 3300005548 Bacteria 6230
116 Ga0070665_100114382 3300005548 Bacteria 2701
117 Ga0070665_100412217 3300005548 Bacteria 1359
118 Ga0070704_100016814 3300005549 Bacteria 4633
119 Ga0070704_100021795 3300005549 Bacteria 4159
120 Ga0070704_100088688 3300005549 Bacteria 2299
121 Ga0070704_100136386 3300005549 Bacteria 1909
122 Ga0070704_100770700 3300005549 Bacteria 858
123 Ga0068855_100811920 3300005563 Bacteria 993
124 Ga0068855_101092698 3300005563 Bacteria 834
125 Ga0068854_100101333 3300005578 Bacteria 2159
126 Ga0068854_100104293 3300005578 Bacteria 2130
127 Ga0068854_100234398 3300005578 Bacteria 1458
128 Ga0070702_100092229 3300005615 Bacteria 1839
129 Ga0070702_100180426 3300005615 Bacteria 1381
130 Ga0070702_100198511 3300005615 Bacteria 1326
131 Ga0068852_100004616 3300005616 Bacteria 9758
132 Ga0068859_100000927 3300005617 Bacteria 30061
133 Ga0068859_100056127 3300005617 Bacteria 3963
134 Ga0068859_100830717 3300005617 Bacteria 1010
135 Ga0068859_101253184 3300005617 Bacteria 817
136 Ga0068859_101566120 3300005617 Bacteria 728
137 Ga0068864_100019356 3300005618 Bacteria 5691
138 Ga0068864_100019550 3300005618 Bacteria 5665
139 Ga0068864_100019908 3300005618 Bacteria 5610
140 Ga0068864_100053771 3300005618 Bacteria 3475
141 Ga0068866_10006776 3300005718 Bacteria 4779
142 Ga0068866_10063330 3300005718 Bacteria 1927
143 Ga0068866_10092995 3300005718 Bacteria 1646
144 Ga0068861_100343265 3300005719 Bacteria 1307
145 Ga0068851_10000699 3300005834 Bacteria 14318
146 Ga0068870_10086060 3300005840 Bacteria 1748
147 Ga0068870_10133522 3300005840 Bacteria 1444
148 Ga0068863_100094346 3300005841 Bacteria 2840
149 Ga0068863_100226683 3300005841 Bacteria 1802
150 Ga0068863_100281781 3300005841 Bacteria 1610
151 Ga0068863_100696587 3300005841 Bacteria 1010
152 Ga0068858_100006124 3300005842 Bacteria 11734
153 Ga0068858_100011198 3300005842 Bacteria 8476
154 Ga0068858_100013832 3300005842 Bacteria 7616
155 Ga0068858_100081228 3300005842 Bacteria 3013
156 Ga0068858_100150231 3300005842 Bacteria 2190
157 Ga0068860_100215420 3300005843 Bacteria 1863
158 Ga0068860_100762798 3300005843 Bacteria 979
159 Ga0068860_101085034 3300005843 Bacteria 820
160 Ga0068862_100033035 3300005844 Bacteria 4370
161 Ga0068862_100055693 3300005844 Bacteria 3387
162 Ga0068862_100178539 3300005844 Bacteria 1904
163 Ga0068862_100507142 3300005844 Bacteria 1146
164 Ga0068862_101242638 3300005844 Bacteria 745
165 Ga0068862_101412425 3300005844 Bacteria 700
166 Ga0070717_10565634 3300006028 Bacteria 1030
167 Ga0070716_100225107 3300006173 Bacteria 1263
168 Ga0070716_101425590 3300006173 Bacteria 564
169 Ga0075366_10554098 3300006195 Bacteria 712
170 Ga0097621_100006243 3300006237 Bacteria 8457
171 Ga0097621_100060311 3300006237 Bacteria 3109
172 Ga0097621_100086717 3300006237 Bacteria 2613
173 Ga0075370_10634883 3300006353 Bacteria 648
174 Ga0068871_100004797 3300006358 Bacteria 9452
175 Ga0068871_100012022 3300006358 Bacteria 6370
176 Ga0068871_100058918 3300006358 Bacteria 3128
177 Ga0068871_100759986 3300006358 Bacteria 891
178 Ga0068871_100871104 3300006358 Bacteria 833
179 Ga0075428_100002475 3300006844 Bacteria 20049
180 Ga0075428_100005840 3300006844 Bacteria 13675
181 Ga0075428_100028231 3300006844 Bacteria 6206
182 Ga0075431_100004741 3300006847 Bacteria 13371
183 Ga0075431_100055864 3300006847 Bacteria 4073
184 Ga0075431_100058746 3300006847 Bacteria 3969
185 Ga0075431_100864881 3300006847 Bacteria 875
186 Ga0075433_10003464 3300006852 Bacteria 12183
187 Ga0075433_10633746 3300006852 Bacteria 938
188 Ga0075434_100001167 3300006871 Bacteria 21754
189 Ga0075434_100565380 3300006871 Bacteria 1157
190 Ga0075434_101193605 3300006871 Bacteria 773
191 Ga0075429_100000113 3300006880 Bacteria 46474
192 Ga0075429_100003595 3300006880 Bacteria 13213
193 Ga0068865_100028281 3300006881 Bacteria 3710
194 Ga0068865_100055513 3300006881 Bacteria 2756
195 Ga0075436_100003581 3300006914 Bacteria 10639
196 Ga0075436_100008611 3300006914 Bacteria 6973
197 Ga0075436_100508637 3300006914 Bacteria 882
198 Ga0097620_100000927 3300006931 Bacteria 30061
199 Ga0097620_100056128 3300006931 Bacteria 3963
200 Ga0097620_100830712 3300006931 Bacteria 1010
201 Ga0097620_101253204 3300006931 Bacteria 817
202 Ga0097620_101566001 3300006931 Bacteria 728
203 Ga0075435_100000265 3300007076 Bacteria 32624
204 Ga0075435_100133330 3300007076 Bacteria 2079
205 Ga0075435_100326099 3300007076 Bacteria 1314
206 Ga0099794_10009816 3300007265 Bacteria 4043
207 Ga0099794_10116480 3300007265 Bacteria 1342
208 Ga0111539_10004447 3300009094 Bacteria 18316
209 Ga0111539_10033374 3300009094 Bacteria 6248
210 Ga0111539_10039309 3300009094 Bacteria 5704
211 Ga0111539_10045504 3300009094 Bacteria 5253
212 Ga0111539_10083268 3300009094 Bacteria 3762
213 Ga0111539_10657219 3300009094 Bacteria 1221
214 Ga0111539_11142373 3300009094 Bacteria 905
215 Ga0105245_10012273 3300009098 Bacteria 7455
216 Ga0105245_10134822 3300009098 Bacteria 2319
217 Ga0105245_11646666 3300009098 Bacteria 694
218 Ga0105247_10085455 3300009101 Bacteria 1995
219 Ga0105247_10162106 3300009101 Bacteria 1481
220 Ga0114129_10004354 3300009147 Bacteria 19988
221 Ga0114129_10011228 3300009147 Bacteria 12769
222 Ga0114129_10095271 3300009147 Bacteria 4122
223 Ga0114129_10161722 3300009147 Bacteria 3058
224 Ga0114129_10395670 3300009147 Bacteria 1822
225 Ga0105243_10006291 3300009148 Bacteria 9175
226 Ga0105243_10011466 3300009148 Bacteria 6705
227 Ga0105243_10213380 3300009148 Bacteria 1701
228 Ga0105243_10355335 3300009148 Bacteria 1347
229 Ga0105241_10038834 3300009174 Bacteria 3589
230 Ga0105241_11687690 3300009174 Bacteria 615
231 Ga0105242_10001891 3300009176 Bacteria 16465
232 Ga0105242_10047472 3300009176 Bacteria 3486
233 Ga0105242_10066237 3300009176 Bacteria 2982
234 Ga0105242_10103935 3300009176 Bacteria 2411
235 Ga0105248_10000825 3300009177 Bacteria 34815
236 Ga0105248_10408956 3300009177 Bacteria 1528
237 Ga0105248_10658023 3300009177 Bacteria 1182
238 Ga0105248_11654618 3300009177 Bacteria 725
239 Ga0105248_12821697 3300009177 Bacteria 554
240 Ga0105237_11960624 3300009545 Bacteria 594
241 Ga0099796_10185538 3300010159 Bacteria 837
242 Ga0105246_10024461 3300011119 Bacteria 3925
243 Ga0105246_10114391 3300011119 Bacteria 1988
244 Ga0157371_10115387 3300013102 Bacteria 1907
245 Ga0157369_10384402 3300013105 Bacteria 1457
246 Ga0157374_10029619 3300013296 Bacteria 4960
247 Ga0157374_10043681 3300013296 Bacteria 4141
248 Ga0157374_10160653 3300013296 Bacteria 2188
249 Ga0157374_10515951 3300013296 Bacteria 1201
250 Ga0157374_11168273 3300013296 Bacteria 791
251 Ga0157374_11236967 3300013296 Bacteria 768
252 Ga0157378_10002926 3300013297 Bacteria 15188
253 Ga0157378_10033416 3300013297 Bacteria 4547
254 Ga0157378_10048387 3300013297 Bacteria 3781
255 Ga0157378_10211987 3300013297 Bacteria 1837
256 Ga0163162_10036043 3300013306 Bacteria 4929
257 Ga0163162_10041632 3300013306 Bacteria 4597
258 Ga0163162_10496226 3300013306 Bacteria 1351
259 Ga0163162_10989211 3300013306 Bacteria 951
260 Ga0157375_10009556 3300013308 Bacteria 8513
261 Ga0157375_10018283 3300013308 Bacteria 6354
262 Ga0157375_10028660 3300013308 Bacteria 5224
263 Ga0157375_10258132 3300013308 Bacteria 1904
264 Ga0157375_10521143 3300013308 Bacteria 1352
265 Ga0157375_11890346 3300013308 Bacteria 708
266 Ga0163163_10131435 3300014325 Bacteria 2544
267 Ga0163163_11004756 3300014325 Bacteria 897
268 Ga0157380_10067503 3300014326 Bacteria 2880
269 Ga0157380_10194439 3300014326 Bacteria 1794
270 Ga0157377_10060553 3300014745 Bacteria 2162
271 Ga0157377_10869304 3300014745 Bacteria 671
272 Ga0157379_10027238 3300014968 Bacteria 5088
273 Ga0157379_10077040 3300014968 Bacteria 2986
274 Ga0157376_10003020 3300014969 Bacteria 11545
275 Ga0157376_10009034 3300014969 Bacteria 7218
276 Ga0157376_10027802 3300014969 Bacteria 4488
277 Ga0157376_10231672 3300014969 Bacteria 1716
278 Ga0157376_10396773 3300014969 Bacteria 1333
279 Ga0157376_11549481 3300014969 Bacteria 696
280 Ga0163161_10123121 3300017792 Bacteria 1950
281 Ga0207697_10037606 3300025315 Bacteria 1983
282 Ga0207656_10003572 3300025321 Bacteria 5363
283 Ga0207653_10014977 3300025885 Bacteria 2433
284 Ga0207682_10034241 3300025893 Bacteria 2047
285 Ga0207642_10006143 3300025899 Bacteria 3975
286 Ga0207642_10025296 3300025899 Bacteria 2399
287 Ga0207710_10025756 3300025900 Bacteria 2540
288 Ga0207688_10299500 3300025901 Bacteria 983
289 Ga0207680_10029625 3300025903 Bacteria 3078
290 Ga0207645_10446176 3300025907 Bacteria 873
291 Ga0207643_10082980 3300025908 Bacteria 1859
292 Ga0207684_10131402 3300025910 Bacteria 2149
293 Ga0207684_10383689 3300025910 Bacteria 1208
294 Ga0207707_10046701 3300025912 Bacteria 3772
295 Ga0207660_10138602 3300025917 Bacteria 1858
296 Ga0207662_10000557 3300025918 Bacteria 16588
297 Ga0207652_10038352 3300025921 Bacteria 4061
298 Ga0207681_10154605 3300025923 Bacteria 1723
299 Ga0207681_10247480 3300025923 Bacteria 1390
300 Ga0207650_10015796 3300025925 Bacteria 5264
301 Ga0207650_10825141 3300025925 Bacteria 786
302 Ga0207650_11006422 3300025925 Bacteria 709
303 Ga0207659_10000872 3300025926 Bacteria 17941
304 Ga0207659_10004176 3300025926 Bacteria 8723
305 Ga0207687_10067709 3300025927 Bacteria 2541
306 Ga0207687_10128941 3300025927 Bacteria 1903
307 Ga0207687_10907903 3300025927 Bacteria 754
308 Ga0207664_10179236 3300025929 Bacteria 1818
309 Ga0207644_10048710 3300025931 Bacteria 3031
310 Ga0207644_10121404 3300025931 Bacteria 1989
311 Ga0207644_10584630 3300025931 Bacteria 926
312 Ga0207690_10611149 3300025932 Bacteria 891
313 Ga0207706_10286607 3300025933 Bacteria 1436
314 Ga0207686_10109804 3300025934 Bacteria 1858
315 Ga0207686_10118177 3300025934 Bacteria 1800
316 Ga0207709_10089462 3300025935 Bacteria 2007
317 Ga0207709_10162412 3300025935 Bacteria 1559
318 Ga0207670_10039530 3300025936 Bacteria 3090
319 Ga0207670_10650326 3300025936 Bacteria 869
320 Ga0207669_10491435 3300025937 Bacteria 980
321 Ga0207669_11544253 3300025937 Bacteria 566
322 Ga0207704_10179273 3300025938 Bacteria 1529
323 Ga0207665_10074496 3300025939 Bacteria 2323
324 Ga0207665_10575039 3300025939 Bacteria 878
325 Ga0207691_10000801 3300025940 Bacteria 31237
326 Ga0207691_10159192 3300025940 Bacteria 1982
327 Ga0207691_10266242 3300025940 Bacteria 1477
328 Ga0207711_10026875 3300025941 Bacteria 4831
329 Ga0207689_10001628 3300025942 Bacteria 21266
330 Ga0207689_10002484 3300025942 Bacteria 17129
331 Ga0207689_10322665 3300025942 Bacteria 1282
332 Ga0207689_11439238 3300025942 Bacteria 577
333 Ga0207679_10007133 3300025945 Bacteria 7080
334 Ga0207667_10257353 3300025949 Bacteria 1785
335 Ga0207651_10011475 3300025960 Bacteria 4963
336 Ga0207651_10067737 3300025960 Bacteria 2513
337 Ga0207651_10109006 3300025960 Bacteria 2074
338 Ga0207651_10803138 3300025960 Bacteria 834
339 Ga0207640_10004583 3300025981 Bacteria 7497
340 Ga0207640_10256011 3300025981 Bacteria 1361
341 Ga0207658_10353511 3300025986 Bacteria 1280
342 Ga0207677_10059979 3300026023 Bacteria 2627
343 Ga0207677_10187111 3300026023 Bacteria 1634
344 Ga0207677_10262831 3300026023 Bacteria 1408
345 Ga0207703_10091326 3300026035 Bacteria 2561
346 Ga0207703_10259173 3300026035 Bacteria 1571
347 Ga0207703_11502235 3300026035 Bacteria 648
348 Ga0207639_10050031 3300026041 Bacteria 3172
349 Ga0207639_10162361 3300026041 Bacteria 1884
350 Ga0207639_10344484 3300026041 Bacteria 1329
351 Ga0207639_10463932 3300026041 Bacteria 1152
352 Ga0207678_10158489 3300026067 Bacteria 1933
353 Ga0207708_10002534 3300026075 Bacteria 13444
354 Ga0207708_10785697 3300026075 Bacteria 819
355 Ga0207702_10124541 3300026078 Bacteria 2312
356 Ga0207702_10452023 3300026078 Bacteria 1246
357 Ga0207641_10079921 3300026088 Bacteria 2836
358 Ga0207641_10093834 3300026088 Bacteria 2631
359 Ga0207641_10127117 3300026088 Bacteria 2283
360 Ga0207641_10683044 3300026088 Bacteria 1010
361 Ga0207648_10009082 3300026089 Bacteria 9556
362 Ga0207648_10030021 3300026089 Bacteria 4820
363 Ga0207648_10076879 3300026089 Bacteria 2910
364 Ga0207648_10988995 3300026089 Bacteria 788
365 Ga0207676_10011083 3300026095 Bacteria 6433
366 Ga0207676_10024246 3300026095 Bacteria 4487
367 Ga0207676_10059165 3300026095 Bacteria 3025
368 Ga0207676_10157888 3300026095 Bacteria 1961
369 Ga0207675_100002969 3300026118 Bacteria 16692
370 Ga0207675_100062045 3300026118 Bacteria 3490
371 Ga0207683_10013042 3300026121 Bacteria 7092
372 Ga0207683_10052298 3300026121 Bacteria 3579
373 Ga0207683_10091013 3300026121 Bacteria 2717
374 Ga0207683_10091285 3300026121 Bacteria 2713
375 Ga0207698_10019799 3300026142 Bacteria 4617
376 Ga0207698_10505970 3300026142 Bacteria 1176
377 Ga0207428_10023744 3300027907 Bacteria 5151
378 Ga0207428_10074091 3300027907 Bacteria 2670
379 Ga0268266_10047422 3300028379 Bacteria 3680
380 Ga0268266_10167420 3300028379 Bacteria 1992
381 Ga0268266_10296579 3300028379 Bacteria 1507
382 Ga0268265_10048847 3300028380 Bacteria 3179
383 Ga0268265_10066352 3300028380 Bacteria 2790
384 Ga0268265_10106406 3300028380 Bacteria 2278
385 Ga0268265_10570309 3300028380 Bacteria 1077
386 Ga0268264_10029044 3300028381 Bacteria 4528
387 Ga0268264_10258132 3300028381 Bacteria 1622
388 Ga0268264_11567761 3300028381 Bacteria 669
389 Ga0268264_11843214 3300028381 Bacteria 615
390 Ga0265336_10000185 3300028666 Bacteria 43870
391 Ga0265324_10000011 3300029957 Bacteria 218521
392 Ga0265324_10073190 3300029957 Bacteria 1167
393 Ga0265325_10001032 3300031241 Bacteria 20084
394 Ga0265331_10012146 3300031250 Bacteria 4679
395 Ga0265327_10037425 3300031251 Bacteria 2656
396 Ga0316575_10004249 3300031665 Bacteria 5027
397 Ga0307409_102784432 3300031995 Bacteria 517
398 Ga0316583_10049970 3300032133 Bacteria 1472
399 Ga0373930_0002310 3300034816 Bacteria 2941
400 Ga0373948_0026227 3300034817 Bacteria 1147
401 Ga0373926_0023481 3300035083 Bacteria 2142
402 Ga0373928_0097582 3300035084 Bacteria 762
403 Ga0373940_0093593 3300035088 Bacteria 903
404 Ga0373940_0218863 3300035088 Bacteria 632
405 Ga0373949_0009732 3300035090 Bacteria 2105
406 Ga0373951_0033554 3300035091 Bacteria 1217
407 Ga0373952_0170921 3300035092 Bacteria 621
408 Ga0373932_0030187 3300035112 Bacteria 1500
409 Ga0373936_0059210 3300035113 Bacteria 1560
410 Ga0373939_0021420 3300035114 Bacteria 1769
411 Ga0373939_0030786 3300035114 Bacteria 1546
412 Ga0373939_0056862 3300035114 Bacteria 1232
413 Ga0373941_0014495 3300035115 Bacteria 2107
414 Ga0373945_0012631 3300035116 Bacteria 2808
415 Ga0373954_0002128 3300035118 Bacteria 8222
416 Ga0373956_0264576 3300035119 Bacteria 818
417 Ga0373960_0045107 3300035121 Bacteria 1289
418 Ga0373960_0152556 3300035121 Bacteria 790
419 Ga0373960_0160087 3300035121 Bacteria 774
420 Ga0373943_0146920 3300035170 Bacteria 1274
421 Ga0373942_0016030 3300035207 Bacteria 1834
422 Ga0373942_0097756 3300035207 Bacteria 893
423 Ga0373961_0011504 3300035241 Bacteria 2197
424 Ga0373962_0004879 3300035242 Bacteria 3243
425 Ga0373962_0246094 3300035242 Bacteria 619
426 Ga0316574_0037978 3300035398 Bacteria 2955
427 Ga0373924_0035475 3300035410 Bacteria 2023
428 Ga0373931_0008517 3300035691 Bacteria 4868
429 Ga0373931_0015016 3300035691 Bacteria 3795
430 Ga0373931_0264159 3300035691 Bacteria 1051
431 Ga0373931_0387695 3300035691 Bacteria 882
432 Ga0373931_0648806 3300035691 Bacteria 693
433 Ga0373927_0387691 3300035695 Bacteria 921
434 Ga0373947_0323550 3300035725 Bacteria 1031
435 Ga0373937_0211048 3300036401 Bacteria 1827
436 Ga0373937_0292228 3300036401 Bacteria 1540
437 Ga0373937_1180174 3300036401 Bacteria 714
438 Ga0373925_0797656 3300037068 Bacteria 778
439 Ga0451835_0013848 3300041492 Bacteria 500
440 Ga0451839_0933257 3300041496 Bacteria 691
441 Ga0439448_0034118 3300042005 Bacteria 1625
442 Ga0451577_0000085 3300042876 Bacteria 211141
443 Ga0453683_0000047 3300044673 Bacteria 207763
444 Ga0466965_0410675 3300044683 Bacteria 749
445 Ga0466966_0024617 3300044684 Bacteria 3938
446 Ga0466961_0101774 3300044693 Bacteria 1810
447 Ga0453684_0000302 3300044712 Bacteria 207763
448 Ga0453684_0348766 3300044712 Bacteria 1670
449 Ga0466957_0021062 3300044842 Bacteria 3839
450 Ga0466957_0304024 3300044842 Bacteria 1072
451 Ga0466960_0832045 3300044901 Bacteria 560
452 Ga0451576_0000116 3300045051 Bacteria 207763
453 Ga0451576_0005929 3300045051 Bacteria 15138
454 Ga0451576_0015266 3300045051 Bacteria 8514
455 Ga0451576_0203596 3300045051 Bacteria 2067
456 Ga0451576_0243290 3300045051 Bacteria 1879
457 Ga0451576_0717161 3300045051 Bacteria 1051
458 Ga0466958_0065729 3300045836 Bacteria 2213
459 Ga0466967_0169134 3300045976 Bacteria 2055
460 Ga0495592_0841389 3300046454 Bacteria 543
461 Ga0495603_0038711 3300046455 Bacteria 2859
462 Ga0495629_0822043 3300046459 Bacteria 612
463 Ga0495580_0023042 3300046472 Bacteria 4577
464 Ga0495639_0039073 3300046475 Bacteria 2133
465 Ga0495630_0609351 3300046517 Bacteria 837
466 Ga0495598_0151633 3300046537 Bacteria 809
467 Ga0495598_0251409 3300046537 Bacteria 655
468 Ga0495609_0324789 3300046538 Bacteria 624
469 Ga0495588_0014029 3300046674 Bacteria 3829
470 Ga0495647_0101002 3300046681 Bacteria 1194
471 Ga0495658_0022941 3300046683 Bacteria 3308
472 Ga0495669_0509665 3300046684 Bacteria 585
473 Ga0495669_0640383 3300046684 Bacteria 517
474 Ga0495636_0040880 3300047318 Bacteria 1923
475 Ga0495676_0029674 3300047321 Bacteria 4655
476 Ga0496104_0777356 3300048907 Bacteria 864
477 Ga0496105_0126068 3300048908 Bacteria 2111
478 Ga0496106_0116976 3300048909 Bacteria 2080
479 Ga0496108_0008145 3300048911 Bacteria 8500
480 Ga0496108_0009459 3300048911 Bacteria 7894
481 Ga0496109_0740983 3300048912 Bacteria 920
482 Ga0496114_0013030 3300048917 Bacteria 6662
483 Ga0496114_0022648 3300048917 Bacteria 5121
484 Ga0496115_0138141 3300048918 Bacteria 2010
485 Ga0496115_0434002 3300048918 Bacteria 1063
486 Ga0496121_0075030 3300048924 Bacteria 2703
487 Ga0501031_0027352 3300049568 Bacteria 3719
488 Ga0501031_0061078 3300049568 Bacteria 2456
489 Ga0501032_0015971 3300049569 Bacteria 5285
490 Ga0501032_0307942 3300049569 Bacteria 1023
491 Ga0501033_0000063 3300049570 Bacteria 101552
492 Ga0501033_0008323 3300049570 Bacteria 8032
493 Ga0501033_0068022 3300049570 Bacteria 2619
494 Ga0501034_0011311 3300049571 Bacteria 9257
495 Ga0501034_0243906 3300049571 Bacteria 1742
496 Ga0501034_0912906 3300049571 Bacteria 765
497 Ga0501036_0032396 3300049572 Bacteria 4415
498 Ga0501036_0103540 3300049572 Bacteria 2407
499 Ga0501036_0125942 3300049572 Bacteria 2163
500 Ga0501037_0073517 3300049573 Bacteria 2486
501 Ga0501037_0227310 3300049573 Bacteria 1311
502 Ga0501037_0591946 3300049573 Bacteria 745
503 Ga0501038_0001127 3300049574 Bacteria 24240
504 Ga0501038_0009140 3300049574 Bacteria 9092
505 Ga0501038_0011026 3300049574 Bacteria 8250
506 Ga0501038_0028462 3300049574 Bacteria 4964
507 Ga0501039_0019657 3300049575 Bacteria 5179
508 Ga0501039_0062367 3300049575 Bacteria 2888
509 Ga0501039_0071972 3300049575 Bacteria 2686
510 Ga0501039_0202280 3300049575 Bacteria 1561
511 Ga0501039_0256334 3300049575 Bacteria 1375
512 Ga0501040_0286718 3300049576 Bacteria 1176
513 Ga0501040_1291797 3300049576 Bacteria 529
514 Ga0501041_0008846 3300049577 Bacteria 5926
515 Ga0501043_0062590 3300049579 Bacteria 2921
516 Ga0501043_0068489 3300049579 Bacteria 2786
517 Ga0501043_0163894 3300049579 Bacteria 1736
518 Ga0501043_0302909 3300049579 Bacteria 1221
519 Ga0501046_0029823 3300049580 Bacteria 4432
520 Ga0501046_0031336 3300049580 Bacteria 4310
521 Ga0501046_0189864 3300049580 Bacteria 1533
522 Ga0501047_0188546 3300049581 Bacteria 1927
523 Ga0501048_0019783 3300049582 Bacteria 4937
524 Ga0501048_0440574 3300049582 Bacteria 933
525 Ga0501068_0001065 3300049584 Bacteria 14494
526 Ga0501068_0005946 3300049584 Bacteria 6696
527 Ga0501071_0225794 3300049587 Bacteria 1410
528 Ga0501072_0004194 3300049588 Bacteria 10926
529 Ga0501073_0028794 3300049589 Bacteria 3968
530 Ga0501074_0118253 3300049590 Bacteria 1896
531 Ga0501074_0874025 3300049590 Bacteria 633
532 Ga0501074_1144850 3300049590 Bacteria 546
533 Ga0501075_0044599 3300049591 Bacteria 3327
534 Ga0501076_0393831 3300049592 Bacteria 1139
535 Ga0501077_0037217 3300049593 Bacteria 3101
536 Ga0501077_0523292 3300049593 Bacteria 761
537 Ga0501079_0034835 3300049741 Bacteria 3874
538 Ga0501080_0051933 3300049742 Bacteria 3815
539 Ga0501080_0197399 3300049742 Bacteria 1848
540 Ga0501083_0022189 3300049744 Bacteria 4406
541 Ga0501035_0008116 3300049822 Bacteria 9784
542 Ga0501035_0019287 3300049822 Bacteria 6277
543 Ga0501035_0045828 3300049822 Bacteria 3933
544 Ga0501035_0208815 3300049822 Bacteria 1671
545 Ga0501044_0002351 3300049823 Bacteria 21578
546 Ga0501044_0007227 3300049823 Bacteria 12215
547 Ga0501044_0014916 3300049823 Bacteria 8378
548 Ga0501044_0070153 3300049823 Bacteria 3565
549 Ga0501044_0311345 3300049823 Bacteria 1501
550 Ga0501045_0001191 3300049824 Bacteria 17302
551 Ga0501045_0091481 3300049824 Bacteria 2249
552 Ga0501045_0492052 3300049824 Bacteria 911
553 Ga0501045_1093019 3300049824 Bacteria 583
554 nmdc:mga03683_308468_c1 3300050489 Bacteria 743
555 nmdc:mga05p37_16266_c1 3300050507 Bacteria 8957
556 nmdc:mga05p37_209129_c1 3300050507 Bacteria 2359
557 nmdc:mga05p37_445_c1 3300050507 Bacteria 45012
558 nmdc:mga05p37_528639_c1 3300050507 Bacteria 1347
559 nmdc:mga09592_118_c1 3300050508 Bacteria 50210
560 nmdc:mga09592_6497_c1 3300050508 Bacteria 9524
561 nmdc:mga06r32_102593_c1 3300050510 Bacteria 2808
562 nmdc:mga06r32_1864_c1 3300050510 Bacteria 18773
563 nmdc:mga06r32_364271_c1 3300050510 Bacteria 1429
564 nmdc:mga06r32_380587_c1 3300050510 Bacteria 1394
565 nmdc:mga08y16_1398250_c1 3300050511 Bacteria 663
566 nmdc:mga08y16_164933_c1 3300050511 Bacteria 2301
567 nmdc:mga08y16_188019_c1 3300050511 Bacteria 2143
568 nmdc:mga08y16_26423_c1 3300050511 Bacteria 6122
569 nmdc:mga08y16_33219_c1 3300050511 Bacteria 5420
570 nmdc:mga08y16_35198_c1 3300050511 Bacteria 5260
571 nmdc:mga08y16_501805_c1 3300050511 Bacteria 1233
572 nmdc:mga0n895_1204921_c1 3300050512 Bacteria 731
573 nmdc:mga0n895_245380_c1 3300050512 Bacteria 1817
574 nmdc:mga0n895_8509_c1 3300050512 Bacteria 8890
575 nmdc:mga0rr50_128329_c1 3300050513 Bacteria 2027
576 nmdc:mga0rr50_167528_c1 3300050513 Bacteria 1787
577 nmdc:mga0rr50_2168_c1 3300050513 Bacteria 10985
578 nmdc:mga0rr50_232128_c1 3300050513 Bacteria 1527
579 nmdc:mga08x19_107305_c1 3300050514 Bacteria 1859
580 nmdc:mga08x19_22687_c1 3300050514 Bacteria 3887
581 nmdc:mga08x19_639_c1 3300050514 Bacteria 15882
582 nmdc:mga0a205_1660_c1 3300050515 Bacteria 19154
583 nmdc:mga0a205_479136_c1 3300050515 Bacteria 1103
584 Ga0500622_0000029 3300053156 Bacteria 213762
585 Ga0501084_0602156 3300054114 Bacteria 928
586 Ga0466962_0119563 3300061719 Bacteria 1271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049582 Ga0501048_0019783 Ga0501048_0019783_10_405 131
2 3300005459 Ga0068867_101049219 Ga0068867_1010492192 137
3 3300009176 Ga0105242_10001891 Ga0105242_100018911 137
4 3300013297 Ga0157378_10211987 Ga0157378_102119872 137
5 3300013306 Ga0163162_10041632 Ga0163162_100416324 137
6 3300049569 Ga0501032_0307942 Ga0501032_0307942_210_665 137
7 3300049570 Ga0501033_0008323 Ga0501033_0008323_685_1140 137
8 3300049572 Ga0501036_0103540 Ga0501036_0103540_1535_1990 137
9 3300049574 Ga0501038_0011026 Ga0501038_0011026_7391_7846 137
10 3300049575 Ga0501039_0202280 Ga0501039_0202280_689_1144 137
11 3300049579 Ga0501043_0068489 Ga0501043_0068489_405_860 137
12 3300049822 Ga0501035_0045828 Ga0501035_0045828_3084_3539 137
13 3300049823 Ga0501044_0311345 Ga0501044_0311345_650_1105 137
14 3300049574 Ga0501038_0001127 Ga0501038_0001127_1652_2107 141
15 3300049580 Ga0501046_0029823 Ga0501046_0029823_2327_2782 141
16 3300049823 Ga0501044_0007227 Ga0501044_0007227_1004_1459 141
17 3300005617 Ga0068859_101253184 Ga0068859_1012531842 142
18 3300005842 Ga0068858_100011198 Ga0068858_1000111982 142
19 3300006931 Ga0097620_101253204 Ga0097620_1012532042 142
20 3300005334 Ga0068869_100548137 Ga0068869_1005481372 146
21 3300005345 Ga0070692_10924643 Ga0070692_109246431 146
22 3300005444 Ga0070694_100104129 Ga0070694_1001041292 146
23 3300005459 Ga0068867_101047182 Ga0068867_1010471822 146
24 3300005536 Ga0070697_100019510 Ga0070697_1000195104 146
25 3300005549 Ga0070704_100016814 Ga0070704_1000168145 146
26 3300005549 Ga0070704_100136386 Ga0070704_1001363863 146
27 3300005549 Ga0070704_100770700 Ga0070704_1007707001 146
28 3300006844 Ga0075428_100005840 Ga0075428_1000058406 146
29 3300006847 Ga0075431_100004741 Ga0075431_1000047416 146
30 3300006880 Ga0075429_100000113 Ga0075429_10000011324 146
31 3300007076 Ga0075435_100133330 Ga0075435_1001333302 146
32 3300009094 Ga0111539_10039309 Ga0111539_100393093 146
33 3300025935 Ga0207709_10089462 Ga0207709_100894623 146
34 3300028380 Ga0268265_10066352 Ga0268265_100663522 146
35 3300035691 Ga0373931_0387695 Ga0373931_0387695_155_598 146
36 3300045051 Ga0451576_0243290 Ga0451576_0243290_53_496 146
37 3300049569 Ga0501032_0015971 Ga0501032_0015971_4442_4882 146
38 3300049570 Ga0501033_0068022 Ga0501033_0068022_310_750 146
39 3300049571 Ga0501034_0011311 Ga0501034_0011311_699_1139 146
40 3300049572 Ga0501036_0032396 Ga0501036_0032396_3178_3618 146
41 3300049574 Ga0501038_0028462 Ga0501038_0028462_2173_2613 146
42 3300049575 Ga0501039_0071972 Ga0501039_0071972_1826_2266 146
43 3300049580 Ga0501046_0031336 Ga0501046_0031336_3010_3450 146
44 3300049584 Ga0501068_0001065 Ga0501068_0001065_12448_12888 146
45 3300049822 Ga0501035_0208815 Ga0501035_0208815_371_811 146
46 3300049823 Ga0501044_0070153 Ga0501044_0070153_953_1393 146
47 3300049824 Ga0501045_0001191 Ga0501045_0001191_2961_3401 146
48 3300050511 nmdc:mga08y16_164933_c1 nmdc:mga08y16_164933_c1_1358_1798 146
49 3300050513 nmdc:mga0rr50_128329_c1 nmdc:mga0rr50_128329_c1_272_715 146
50 3300050515 nmdc:mga0a205_479136_c1 nmdc:mga0a205_479136_c1_427_870 146
51 3300005340 Ga0070689_100127234 Ga0070689_1001272341 147
52 3300005356 Ga0070674_100432878 Ga0070674_1004328781 147
53 3300005435 Ga0070714_100165478 Ga0070714_1001654783 147
54 3300005440 Ga0070705_100301890 Ga0070705_1003018902 147
55 3300005471 Ga0070698_100476368 Ga0070698_1004763682 147
56 3300005530 Ga0070679_100375018 Ga0070679_1003750182 147
57 3300005539 Ga0068853_100579463 Ga0068853_1005794632 147
58 3300005543 Ga0070672_100145966 Ga0070672_1001459661 147
59 3300005617 Ga0068859_101566120 Ga0068859_1015661201 147
60 3300005618 Ga0068864_100053771 Ga0068864_1000537713 147
61 3300005841 Ga0068863_100696587 Ga0068863_1006965872 147
62 3300005844 Ga0068862_101242638 Ga0068862_1012426381 147
63 3300006173 Ga0070716_100225107 Ga0070716_1002251071 147
64 3300006852 Ga0075433_10003464 Ga0075433_100034647 147
65 3300006871 Ga0075434_100001167 Ga0075434_1000011679 147
66 3300006914 Ga0075436_100003581 Ga0075436_1000035812 147
67 3300006931 Ga0097620_101566001 Ga0097620_1015660011 147
68 3300007076 Ga0075435_100000265 Ga0075435_10000026527 147
69 3300010159 Ga0099796_10185538 Ga0099796_101855382 147
70 3300013306 Ga0163162_10989211 Ga0163162_109892112 147
71 3300025893 Ga0207682_10034241 Ga0207682_100342414 147
72 3300025929 Ga0207664_10179236 Ga0207664_101792363 147
73 3300025936 Ga0207670_10039530 Ga0207670_100395303 147
74 3300025939 Ga0207665_10074496 Ga0207665_100744963 147
75 3300025940 Ga0207691_10159192 Ga0207691_101591921 147
76 3300025942 Ga0207689_10322665 Ga0207689_103226651 147
77 3300025960 Ga0207651_10109006 Ga0207651_101090063 147
78 3300025960 Ga0207651_10803138 Ga0207651_108031382 147
79 3300025986 Ga0207658_10353511 Ga0207658_103535113 147
80 3300026035 Ga0207703_11502235 Ga0207703_115022351 147
81 3300026041 Ga0207639_10463932 Ga0207639_104639322 147
82 3300026088 Ga0207641_10683044 Ga0207641_106830442 147
83 3300026095 Ga0207676_10059165 Ga0207676_100591653 147
84 3300026121 Ga0207683_10091285 Ga0207683_100912854 147
85 3300028381 Ga0268264_11567761 Ga0268264_115677611 147
86 3300035083 Ga0373926_0023481 Ga0373926_0023481_1550_1993 147
87 3300035116 Ga0373945_0012631 Ga0373945_0012631_1054_1497 147
88 3300035119 Ga0373956_0264576 Ga0373956_0264576_200_649 147
89 3300035695 Ga0373927_0387691 Ga0373927_0387691_223_666 147
90 3300036401 Ga0373937_0292228 Ga0373937_0292228_886_1335 147
91 3300036401 Ga0373937_1180174 Ga0373937_1180174_11_463 147
92 3300037068 Ga0373925_0797656 Ga0373925_0797656_55_498 147
93 3300041496 Ga0451839_0933257 Ga0451839_0933257_180_623 147
94 3300042876 Ga0451577_0000085 Ga0451577_0000085_27579_28025 147
95 3300044673 Ga0453683_0000047 Ga0453683_0000047_24201_24647 147
96 3300044684 Ga0466966_0024617 Ga0466966_0024617_85_531 147
97 3300044712 Ga0453684_0000302 Ga0453684_0000302_183117_183563 147
98 3300044842 Ga0466957_0021062 Ga0466957_0021062_152_598 147
99 3300045051 Ga0451576_0000116 Ga0451576_0000116_24201_24647 147
100 3300045836 Ga0466958_0065729 Ga0466958_0065729_1599_2045 147
101 3300046455 Ga0495603_0038711 Ga0495603_0038711_1941_2384 147
102 3300046472 Ga0495580_0023042 Ga0495580_0023042_2928_3371 147
103 3300046475 Ga0495639_0039073 Ga0495639_0039073_1451_1894 147
104 3300046517 Ga0495630_0609351 Ga0495630_0609351_167_610 147
105 3300046674 Ga0495588_0014029 Ga0495588_0014029_226_669 147
106 3300046681 Ga0495647_0101002 Ga0495647_0101002_224_667 147
107 3300047321 Ga0495676_0029674 Ga0495676_0029674_3077_3520 147
108 3300048924 Ga0496121_0075030 Ga0496121_0075030_1825_2274 147
109 3300061719 Ga0466962_0119563 Ga0466962_0119563_624_1070 147
110 3300006195 Ga0075366_10554098 Ga0075366_105540982 149
111 3300014326 Ga0157380_10194439 Ga0157380_101944393 149
112 3300005341 Ga0070691_10246869 Ga0070691_102468691 150
113 3300005345 Ga0070692_10540180 Ga0070692_105401802 150
114 3300005546 Ga0070696_100277180 Ga0070696_1002771802 150
115 3300005615 Ga0070702_100198511 Ga0070702_1001985111 150
116 3300006844 Ga0075428_100028231 Ga0075428_1000282312 150
117 3300006847 Ga0075431_100864881 Ga0075431_1008648811 150
118 3300009094 Ga0111539_10004447 Ga0111539_1000444710 150
119 3300009094 Ga0111539_10033374 Ga0111539_100333745 150
120 3300009147 Ga0114129_10095271 Ga0114129_100952714 150
121 3300026075 Ga0207708_10785697 Ga0207708_107856971 150
122 3300050510 nmdc:mga06r32_380587_c1 nmdc:mga06r32_380587_c1_185_640 150
123 3300050511 nmdc:mga08y16_1398250_c1 nmdc:mga08y16_1398250_c1_165_620 150
124 3300050511 nmdc:mga08y16_26423_c1 nmdc:mga08y16_26423_c1_161_628 150
125 3300050512 nmdc:mga0n895_1204921_c1 nmdc:mga0n895_1204921_c1_47_520 150
126 3300005328 Ga0070676_10091152 Ga0070676_100911522 151
127 3300005328 Ga0070676_10593848 Ga0070676_105938481 151
128 3300005329 Ga0070683_100005993 Ga0070683_1000059934 151
129 3300005329 Ga0070683_101120250 Ga0070683_1011202501 151
130 3300005330 Ga0070690_100179945 Ga0070690_1001799452 151
131 3300005330 Ga0070690_101073249 Ga0070690_1010732491 151
132 3300005331 Ga0070670_100099301 Ga0070670_1000993011 151
133 3300005331 Ga0070670_100111702 Ga0070670_1001117023 151
134 3300005331 Ga0070670_100183960 Ga0070670_1001839602 151
135 3300005331 Ga0070670_100590201 Ga0070670_1005902012 151
136 3300005331 Ga0070670_100660220 Ga0070670_1006602202 151
137 3300005333 Ga0070677_10030891 Ga0070677_100308912 151
138 3300005334 Ga0068869_100012871 Ga0068869_1000128714 151
139 3300005334 Ga0068869_100166660 Ga0068869_1001666601 151
140 3300005334 Ga0068869_100195966 Ga0068869_1001959661 151
141 3300005335 Ga0070666_10019989 Ga0070666_100199893 151
142 3300005335 Ga0070666_10196458 Ga0070666_101964581 151
143 3300005338 Ga0068868_100004430 Ga0068868_1000044307 151
144 3300005338 Ga0068868_100031683 Ga0068868_1000316833 151
145 3300005339 Ga0070660_100193513 Ga0070660_1001935132 151
146 3300005343 Ga0070687_100095053 Ga0070687_1000950532 151
147 3300005345 Ga0070692_10175929 Ga0070692_101759292 151
148 3300005353 Ga0070669_100235615 Ga0070669_1002356151 151
149 3300005353 Ga0070669_100235797 Ga0070669_1002357972 151
150 3300005353 Ga0070669_100242264 Ga0070669_1002422642 151
151 3300005354 Ga0070675_100003469 Ga0070675_10000346913 151
152 3300005354 Ga0070675_100009160 Ga0070675_1000091606 151
153 3300005354 Ga0070675_100969070 Ga0070675_1009690701 151
154 3300005355 Ga0070671_100114826 Ga0070671_1001148263 151
155 3300005355 Ga0070671_100245985 Ga0070671_1002459852 151
156 3300005355 Ga0070671_100246367 Ga0070671_1002463671 151
157 3300005355 Ga0070671_100271307 Ga0070671_1002713071 151
158 3300005356 Ga0070674_100048269 Ga0070674_1000482692 151
159 3300005356 Ga0070674_100084208 Ga0070674_1000842082 151
160 3300005356 Ga0070674_101281494 Ga0070674_1012814941 151
161 3300005364 Ga0070673_100222411 Ga0070673_1002224112 151
162 3300005364 Ga0070673_100288659 Ga0070673_1002886591 151
163 3300005366 Ga0070659_100707743 Ga0070659_1007077432 151
164 3300005367 Ga0070667_100160427 Ga0070667_1001604272 151
165 3300005367 Ga0070667_100478044 Ga0070667_1004780442 151
166 3300005441 Ga0070700_100454302 Ga0070700_1004543021 151
167 3300005444 Ga0070694_100367656 Ga0070694_1003676562 151
168 3300005455 Ga0070663_100091084 Ga0070663_1000910842 151
169 3300005456 Ga0070678_100012489 Ga0070678_1000124892 151
170 3300005456 Ga0070678_100075432 Ga0070678_1000754322 151
171 3300005456 Ga0070678_100270258 Ga0070678_1002702582 151
172 3300005456 Ga0070678_100862877 Ga0070678_1008628772 151
173 3300005457 Ga0070662_100094174 Ga0070662_1000941742 151
174 3300005457 Ga0070662_100144522 Ga0070662_1001445222 151
175 3300005459 Ga0068867_100056291 Ga0068867_1000562912 151
176 3300005459 Ga0068867_100103690 Ga0068867_1001036902 151
177 3300005459 Ga0068867_100130500 Ga0068867_1001305003 151
178 3300005459 Ga0068867_101171796 Ga0068867_1011717961 151
179 3300005466 Ga0070685_10489973 Ga0070685_104899731 151
180 3300005467 Ga0070706_100386438 Ga0070706_1003864382 151
181 3300005471 Ga0070698_100060911 Ga0070698_1000609112 151
182 3300005518 Ga0070699_100346360 Ga0070699_1003463602 151
183 3300005535 Ga0070684_100040031 Ga0070684_1000400312 151
184 3300005539 Ga0068853_100168239 Ga0068853_1001682392 151
185 3300005543 Ga0070672_100005239 Ga0070672_1000052396 151
186 3300005543 Ga0070672_100132721 Ga0070672_1001327213 151
187 3300005544 Ga0070686_100070448 Ga0070686_1000704482 151
188 3300005544 Ga0070686_100832087 Ga0070686_1008320871 151
189 3300005545 Ga0070695_100857307 Ga0070695_1008573071 151
190 3300005547 Ga0070693_100034155 Ga0070693_1000341553 151
191 3300005548 Ga0070665_100023321 Ga0070665_1000233212 151
192 3300005548 Ga0070665_100114382 Ga0070665_1001143822 151
193 3300005548 Ga0070665_100412217 Ga0070665_1004122172 151
194 3300005563 Ga0068855_101092698 Ga0068855_1010926981 151
195 3300005578 Ga0068854_100101333 Ga0068854_1001013332 151
196 3300005578 Ga0068854_100104293 Ga0068854_1001042932 151
197 3300005615 Ga0070702_100092229 Ga0070702_1000922292 151
198 3300005615 Ga0070702_100180426 Ga0070702_1001804262 151
199 3300005616 Ga0068852_100004616 Ga0068852_1000046163 151
200 3300005617 Ga0068859_100000927 Ga0068859_10000092714 151
201 3300005617 Ga0068859_100056127 Ga0068859_1000561272 151
202 3300005618 Ga0068864_100019356 Ga0068864_1000193562 151
203 3300005618 Ga0068864_100019550 Ga0068864_1000195508 151
204 3300005618 Ga0068864_100019908 Ga0068864_1000199086 151
205 3300005718 Ga0068866_10006776 Ga0068866_100067761 151
206 3300005718 Ga0068866_10092995 Ga0068866_100929953 151
207 3300005834 Ga0068851_10000699 Ga0068851_100006992 151
208 3300005840 Ga0068870_10086060 Ga0068870_100860602 151
209 3300005840 Ga0068870_10133522 Ga0068870_101335223 151
210 3300005841 Ga0068863_100094346 Ga0068863_1000943463 151
211 3300005841 Ga0068863_100226683 Ga0068863_1002266832 151
212 3300005841 Ga0068863_100281781 Ga0068863_1002817812 151
213 3300005842 Ga0068858_100013832 Ga0068858_1000138324 151
214 3300005842 Ga0068858_100081228 Ga0068858_1000812282 151
215 3300005843 Ga0068860_100215420 Ga0068860_1002154202 151
216 3300005843 Ga0068860_101085034 Ga0068860_1010850341 151
217 3300005844 Ga0068862_100033035 Ga0068862_1000330353 151
218 3300005844 Ga0068862_100178539 Ga0068862_1001785392 151
219 3300005844 Ga0068862_100507142 Ga0068862_1005071421 151
220 3300005844 Ga0068862_101412425 Ga0068862_1014124251 151
221 3300006028 Ga0070717_10565634 Ga0070717_105656342 151
222 3300006237 Ga0097621_100060311 Ga0097621_1000603113 151
223 3300006237 Ga0097621_100086717 Ga0097621_1000867171 151
224 3300006353 Ga0075370_10634883 Ga0075370_106348831 151
225 3300006358 Ga0068871_100004797 Ga0068871_1000047973 151
226 3300006358 Ga0068871_100012022 Ga0068871_1000120224 151
227 3300006358 Ga0068871_100058918 Ga0068871_1000589184 151
228 3300006358 Ga0068871_100759986 Ga0068871_1007599862 151
229 3300006847 Ga0075431_100058746 Ga0075431_1000587464 151
230 3300006871 Ga0075434_100565380 Ga0075434_1005653802 151
231 3300006881 Ga0068865_100055513 Ga0068865_1000555131 151
232 3300006931 Ga0097620_100000927 Ga0097620_10000092714 151
233 3300006931 Ga0097620_100056128 Ga0097620_1000561282 151
234 3300007265 Ga0099794_10009816 Ga0099794_100098162 151
235 3300007265 Ga0099794_10116480 Ga0099794_101164802 151
236 3300009094 Ga0111539_10657219 Ga0111539_106572191 151
237 3300009098 Ga0105245_10012273 Ga0105245_100122736 151
238 3300009101 Ga0105247_10085455 Ga0105247_100854552 151
239 3300009101 Ga0105247_10162106 Ga0105247_101621063 151
240 3300009147 Ga0114129_10004354 Ga0114129_1000435416 151
241 3300009148 Ga0105243_10011466 Ga0105243_100114665 151
242 3300009148 Ga0105243_10213380 Ga0105243_102133803 151
243 3300009148 Ga0105243_10355335 Ga0105243_103553352 151
244 3300009174 Ga0105241_11687690 Ga0105241_116876901 151
245 3300009176 Ga0105242_10066237 Ga0105242_100662373 151
246 3300009176 Ga0105242_10103935 Ga0105242_101039353 151
247 3300009177 Ga0105248_10000825 Ga0105248_1000082520 151
248 3300009177 Ga0105248_10408956 Ga0105248_104089563 151
249 3300009177 Ga0105248_10658023 Ga0105248_106580232 151
250 3300009177 Ga0105248_12821697 Ga0105248_128216971 151
251 3300009545 Ga0105237_11960624 Ga0105237_119606241 151
252 3300011119 Ga0105246_10024461 Ga0105246_100244613 151
253 3300013105 Ga0157369_10384402 Ga0157369_103844022 151
254 3300013296 Ga0157374_10029619 Ga0157374_100296193 151
255 3300013296 Ga0157374_10043681 Ga0157374_100436815 151
256 3300013296 Ga0157374_10160653 Ga0157374_101606532 151
257 3300013296 Ga0157374_10515951 Ga0157374_105159512 151
258 3300013296 Ga0157374_11168273 Ga0157374_111682732 151
259 3300013296 Ga0157374_11236967 Ga0157374_112369671 151
260 3300013297 Ga0157378_10033416 Ga0157378_100334166 151
261 3300013297 Ga0157378_10048387 Ga0157378_100483872 151
262 3300013306 Ga0163162_10036043 Ga0163162_100360435 151
263 3300013306 Ga0163162_10496226 Ga0163162_104962263 151
264 3300013308 Ga0157375_10009556 Ga0157375_100095564 151
265 3300013308 Ga0157375_10018283 Ga0157375_100182832 151
266 3300013308 Ga0157375_10028660 Ga0157375_100286605 151
267 3300013308 Ga0157375_10258132 Ga0157375_102581322 151
268 3300014325 Ga0163163_10131435 Ga0163163_101314352 151
269 3300014325 Ga0163163_11004756 Ga0163163_110047562 151
270 3300014745 Ga0157377_10869304 Ga0157377_108693041 151
271 3300014968 Ga0157379_10077040 Ga0157379_100770402 151
272 3300014969 Ga0157376_10003020 Ga0157376_100030205 151
273 3300014969 Ga0157376_10009034 Ga0157376_100090344 151
274 3300014969 Ga0157376_10231672 Ga0157376_102316722 151
275 3300014969 Ga0157376_10396773 Ga0157376_103967732 151
276 3300014969 Ga0157376_11549481 Ga0157376_115494812 151
277 3300017792 Ga0163161_10123121 Ga0163161_101231212 151
278 3300025315 Ga0207697_10037606 Ga0207697_100376061 151
279 3300025321 Ga0207656_10003572 Ga0207656_100035721 151
280 3300025899 Ga0207642_10006143 Ga0207642_100061434 151
281 3300025900 Ga0207710_10025756 Ga0207710_100257563 151
282 3300025901 Ga0207688_10299500 Ga0207688_102995002 151
283 3300025903 Ga0207680_10029625 Ga0207680_100296254 151
284 3300025907 Ga0207645_10446176 Ga0207645_104461761 151
285 3300025910 Ga0207684_10131402 Ga0207684_101314022 151
286 3300025923 Ga0207681_10154605 Ga0207681_101546053 151
287 3300025923 Ga0207681_10247480 Ga0207681_102474801 151
288 3300025925 Ga0207650_10015796 Ga0207650_100157967 151
289 3300025925 Ga0207650_10825141 Ga0207650_108251412 151
290 3300025925 Ga0207650_11006422 Ga0207650_110064221 151
291 3300025926 Ga0207659_10000872 Ga0207659_100008722 151
292 3300025926 Ga0207659_10004176 Ga0207659_100041766 151
293 3300025927 Ga0207687_10128941 Ga0207687_101289414 151
294 3300025927 Ga0207687_10907903 Ga0207687_109079031 151
295 3300025931 Ga0207644_10048710 Ga0207644_100487102 151
296 3300025931 Ga0207644_10121404 Ga0207644_101214041 151
297 3300025931 Ga0207644_10584630 Ga0207644_105846302 151
298 3300025932 Ga0207690_10611149 Ga0207690_106111492 151
299 3300025933 Ga0207706_10286607 Ga0207706_102866072 151
300 3300025934 Ga0207686_10118177 Ga0207686_101181772 151
301 3300025937 Ga0207669_10491435 Ga0207669_104914352 151
302 3300025937 Ga0207669_11544253 Ga0207669_115442531 151
303 3300025938 Ga0207704_10179273 Ga0207704_101792732 151
304 3300025940 Ga0207691_10000801 Ga0207691_1000080123 151
305 3300025940 Ga0207691_10266242 Ga0207691_102662423 151
306 3300025941 Ga0207711_10026875 Ga0207711_100268753 151
307 3300025942 Ga0207689_10001628 Ga0207689_1000162817 151
308 3300025942 Ga0207689_11439238 Ga0207689_114392381 151
309 3300025945 Ga0207679_10007133 Ga0207679_100071335 151
310 3300025960 Ga0207651_10011475 Ga0207651_100114756 151
311 3300025960 Ga0207651_10067737 Ga0207651_100677372 151
312 3300025981 Ga0207640_10004583 Ga0207640_100045837 151
313 3300026023 Ga0207677_10187111 Ga0207677_101871112 151
314 3300026023 Ga0207677_10262831 Ga0207677_102628313 151
315 3300026041 Ga0207639_10162361 Ga0207639_101623612 151
316 3300026067 Ga0207678_10158489 Ga0207678_101584892 151
317 3300026078 Ga0207702_10452023 Ga0207702_104520231 151
318 3300026088 Ga0207641_10093834 Ga0207641_100938343 151
319 3300026088 Ga0207641_10127117 Ga0207641_101271173 151
320 3300026089 Ga0207648_10030021 Ga0207648_100300215 151
321 3300026089 Ga0207648_10076879 Ga0207648_100768793 151
322 3300026089 Ga0207648_10988995 Ga0207648_109889951 151
323 3300026095 Ga0207676_10011083 Ga0207676_100110832 151
324 3300026095 Ga0207676_10024246 Ga0207676_100242466 151
325 3300026095 Ga0207676_10157888 Ga0207676_101578882 151
326 3300026118 Ga0207675_100062045 Ga0207675_1000620454 151
327 3300026121 Ga0207683_10013042 Ga0207683_100130426 151
328 3300026121 Ga0207683_10052298 Ga0207683_100522983 151
329 3300026121 Ga0207683_10091013 Ga0207683_100910133 151
330 3300026142 Ga0207698_10019799 Ga0207698_100197992 151
331 3300027907 Ga0207428_10074091 Ga0207428_100740913 151
332 3300028379 Ga0268266_10167420 Ga0268266_101674202 151
333 3300028379 Ga0268266_10296579 Ga0268266_102965791 151
334 3300028380 Ga0268265_10048847 Ga0268265_100488473 151
335 3300028380 Ga0268265_10570309 Ga0268265_105703092 151
336 3300028381 Ga0268264_10029044 Ga0268264_100290444 151
337 3300028381 Ga0268264_11843214 Ga0268264_118432141 151
338 3300031995 Ga0307409_102784432 Ga0307409_1027844321 151
339 3300035121 Ga0373960_0160087 Ga0373960_0160087_79_534 151
340 3300035207 Ga0373942_0097756 Ga0373942_0097756_258_713 151
341 3300042005 Ga0439448_0034118 Ga0439448_0034118_364_843 151
342 3300045051 Ga0451576_0015266 Ga0451576_0015266_123_578 151
343 3300045051 Ga0451576_0203596 Ga0451576_0203596_155_652 151
344 3300045051 Ga0451576_0717161 Ga0451576_0717161_452_907 151
345 3300046459 Ga0495629_0822043 Ga0495629_0822043_44_499 151
346 3300046537 Ga0495598_0251409 Ga0495598_0251409_14_469 151
347 3300046683 Ga0495658_0022941 Ga0495658_0022941_422_877 151
348 3300046684 Ga0495669_0509665 Ga0495669_0509665_35_490 151
349 3300048907 Ga0496104_0777356 Ga0496104_0777356_40_495 151
350 3300048908 Ga0496105_0126068 Ga0496105_0126068_931_1386 151
351 3300048909 Ga0496106_0116976 Ga0496106_0116976_1000_1455 151
352 3300048911 Ga0496108_0008145 Ga0496108_0008145_7701_8156 151
353 3300048911 Ga0496108_0009459 Ga0496108_0009459_4098_4553 151
354 3300048912 Ga0496109_0740983 Ga0496109_0740983_43_498 151
355 3300048917 Ga0496114_0013030 Ga0496114_0013030_90_545 151
356 3300048917 Ga0496114_0022648 Ga0496114_0022648_1847_2302 151
357 3300048918 Ga0496115_0138141 Ga0496115_0138141_989_1444 151
358 3300048918 Ga0496115_0434002 Ga0496115_0434002_105_560 151
359 3300049568 Ga0501031_0027352 Ga0501031_0027352_1507_1962 151
360 3300049568 Ga0501031_0061078 Ga0501031_0061078_334_789 151
361 3300049570 Ga0501033_0000063 Ga0501033_0000063_80310_80765 151
362 3300049571 Ga0501034_0243906 Ga0501034_0243906_558_1013 151
363 3300049571 Ga0501034_0912906 Ga0501034_0912906_46_501 151
364 3300049572 Ga0501036_0125942 Ga0501036_0125942_60_515 151
365 3300049573 Ga0501037_0073517 Ga0501037_0073517_922_1377 151
366 3300049573 Ga0501037_0227310 Ga0501037_0227310_47_502 151
367 3300049573 Ga0501037_0591946 Ga0501037_0591946_252_707 151
368 3300049574 Ga0501038_0009140 Ga0501038_0009140_5006_5461 151
369 3300049575 Ga0501039_0019657 Ga0501039_0019657_1676_2131 151
370 3300049575 Ga0501039_0062367 Ga0501039_0062367_825_1280 151
371 3300049576 Ga0501040_0286718 Ga0501040_0286718_486_941 151
372 3300049577 Ga0501041_0008846 Ga0501041_0008846_2276_2731 151
373 3300049579 Ga0501043_0062590 Ga0501043_0062590_1312_1767 151
374 3300049579 Ga0501043_0163894 Ga0501043_0163894_904_1359 151
375 3300049579 Ga0501043_0302909 Ga0501043_0302909_158_613 151
376 3300049580 Ga0501046_0189864 Ga0501046_0189864_56_511 151
377 3300049581 Ga0501047_0188546 Ga0501047_0188546_1177_1632 151
378 3300049584 Ga0501068_0005946 Ga0501068_0005946_3466_3921 151
379 3300049588 Ga0501072_0004194 Ga0501072_0004194_3075_3530 151
380 3300049589 Ga0501073_0028794 Ga0501073_0028794_2869_3324 151
381 3300049590 Ga0501074_0118253 Ga0501074_0118253_1008_1463 151
382 3300049590 Ga0501074_1144850 Ga0501074_1144850_29_490 151
383 3300049591 Ga0501075_0044599 Ga0501075_0044599_886_1341 151
384 3300049592 Ga0501076_0393831 Ga0501076_0393831_590_1051 151
385 3300049593 Ga0501077_0037217 Ga0501077_0037217_2538_2993 151
386 3300049741 Ga0501079_0034835 Ga0501079_0034835_2059_2514 151
387 3300049742 Ga0501080_0051933 Ga0501080_0051933_229_684 151
388 3300049742 Ga0501080_0197399 Ga0501080_0197399_131_586 151
389 3300049744 Ga0501083_0022189 Ga0501083_0022189_1317_1772 151
390 3300049822 Ga0501035_0008116 Ga0501035_0008116_8841_9296 151
391 3300049822 Ga0501035_0019287 Ga0501035_0019287_2076_2531 151
392 3300049823 Ga0501044_0002351 Ga0501044_0002351_21073_21528 151
393 3300049823 Ga0501044_0014916 Ga0501044_0014916_7885_8340 151
394 3300049824 Ga0501045_0091481 Ga0501045_0091481_1722_2177 151
395 3300049824 Ga0501045_0492052 Ga0501045_0492052_287_748 151
396 3300050507 nmdc:mga05p37_445_c1 nmdc:mga05p37_445_c1_22570_23088 151
397 3300050508 nmdc:mga09592_118_c1 nmdc:mga09592_118_c1_22318_22836 151
398 3300050510 nmdc:mga06r32_1864_c1 nmdc:mga06r32_1864_c1_3325_3843 151
399 3300050510 nmdc:mga06r32_364271_c1 nmdc:mga06r32_364271_c1_654_1151 151
400 3300050511 nmdc:mga08y16_188019_c1 nmdc:mga08y16_188019_c1_217_672 151
401 3300050511 nmdc:mga08y16_501805_c1 nmdc:mga08y16_501805_c1_284_739 151
402 3300050513 nmdc:mga0rr50_167528_c1 nmdc:mga0rr50_167528_c1_50_505 151
403 3300053156 Ga0500622_0000029 Ga0500622_0000029_156012_156467 151
404 3300054114 Ga0501084_0602156 Ga0501084_0602156_228_683 151
405 iso_pu_bacteria 2974320154 2974323460 151
406 3300005295 Ga0065707_10088155 Ga0065707_100881552 152
407 3300005330 Ga0070690_100020616 Ga0070690_1000206163 152
408 3300005334 Ga0068869_100219187 Ga0068869_1002191872 152
409 3300005336 Ga0070680_100007666 Ga0070680_1000076668 152
410 3300005336 Ga0070680_100120207 Ga0070680_1001202074 152
411 3300005338 Ga0068868_100192093 Ga0068868_1001920932 152
412 3300005340 Ga0070689_100006974 Ga0070689_1000069745 152
413 3300005341 Ga0070691_10004016 Ga0070691_100040163 152
414 3300005343 Ga0070687_100005624 Ga0070687_1000056243 152
415 3300005365 Ga0070688_100599768 Ga0070688_1005997681 152
416 3300005406 Ga0070703_10032430 Ga0070703_100324302 152
417 3300005438 Ga0070701_10013209 Ga0070701_100132095 152
418 3300005440 Ga0070705_100005216 Ga0070705_1000052161 152
419 3300005440 Ga0070705_100037148 Ga0070705_1000371482 152
420 3300005441 Ga0070700_100122995 Ga0070700_1001229953 152
421 3300005444 Ga0070694_100001975 Ga0070694_10000197511 152
422 3300005444 Ga0070694_100062730 Ga0070694_1000627302 152
423 3300005458 Ga0070681_10036165 Ga0070681_100361652 152
424 3300005458 Ga0070681_10082987 Ga0070681_100829872 152
425 3300005459 Ga0068867_100043738 Ga0068867_1000437382 152
426 3300005467 Ga0070706_100090429 Ga0070706_1000904292 152
427 3300005467 Ga0070706_100935433 Ga0070706_1009354332 152
428 3300005518 Ga0070699_100188465 Ga0070699_1001884653 152
429 3300005539 Ga0068853_100142454 Ga0068853_1001424543 152
430 3300005539 Ga0068853_100351781 Ga0068853_1003517811 152
431 3300005544 Ga0070686_100162584 Ga0070686_1001625844 152
432 3300005545 Ga0070695_100070313 Ga0070695_1000703132 152
433 3300005545 Ga0070695_100229835 Ga0070695_1002298353 152
434 3300005546 Ga0070696_100009954 Ga0070696_1000099544 152
435 3300005546 Ga0070696_100030997 Ga0070696_1000309973 152
436 3300005547 Ga0070693_100000922 Ga0070693_10000092210 152
437 3300005548 Ga0070665_100009467 Ga0070665_1000094675 152
438 3300005549 Ga0070704_100021795 Ga0070704_1000217954 152
439 3300005549 Ga0070704_100088688 Ga0070704_1000886882 152
440 3300005563 Ga0068855_100811920 Ga0068855_1008119202 152
441 3300005578 Ga0068854_100234398 Ga0068854_1002343982 152
442 3300005617 Ga0068859_100830717 Ga0068859_1008307171 152
443 3300005718 Ga0068866_10063330 Ga0068866_100633302 152
444 3300005719 Ga0068861_100343265 Ga0068861_1003432653 152
445 3300005842 Ga0068858_100006124 Ga0068858_1000061244 152
446 3300005842 Ga0068858_100150231 Ga0068858_1001502313 152
447 3300005843 Ga0068860_100762798 Ga0068860_1007627981 152
448 3300005844 Ga0068862_100055693 Ga0068862_1000556933 152
449 3300006173 Ga0070716_101425590 Ga0070716_1014255901 152
450 3300006237 Ga0097621_100006243 Ga0097621_1000062437 152
451 3300006358 Ga0068871_100871104 Ga0068871_1008711042 152
452 3300006844 Ga0075428_100002475 Ga0075428_1000024751 152
453 3300006847 Ga0075431_100055864 Ga0075431_1000558642 152
454 3300006852 Ga0075433_10633746 Ga0075433_106337462 152
455 3300006871 Ga0075434_101193605 Ga0075434_1011936052 152
456 3300006880 Ga0075429_100003595 Ga0075429_1000035954 152
457 3300006881 Ga0068865_100028281 Ga0068865_1000282813 152
458 3300006914 Ga0075436_100008611 Ga0075436_1000086115 152
459 3300006914 Ga0075436_100508637 Ga0075436_1005086372 152
460 3300006931 Ga0097620_100830712 Ga0097620_1008307121 152
461 3300007076 Ga0075435_100326099 Ga0075435_1003260992 152
462 3300009094 Ga0111539_10045504 Ga0111539_100455046 152
463 3300009094 Ga0111539_10083268 Ga0111539_100832681 152
464 3300009094 Ga0111539_11142373 Ga0111539_111423731 152
465 3300009098 Ga0105245_10134822 Ga0105245_101348224 152
466 3300009098 Ga0105245_11646666 Ga0105245_116466661 152
467 3300009147 Ga0114129_10011228 Ga0114129_100112284 152
468 3300009147 Ga0114129_10161722 Ga0114129_101617221 152
469 3300009147 Ga0114129_10395670 Ga0114129_103956701 152
470 3300009148 Ga0105243_10006291 Ga0105243_1000629110 152
471 3300009174 Ga0105241_10038834 Ga0105241_100388343 152
472 3300009176 Ga0105242_10047472 Ga0105242_100474723 152
473 3300009177 Ga0105248_11654618 Ga0105248_116546182 152
474 3300011119 Ga0105246_10114391 Ga0105246_101143914 152
475 3300013102 Ga0157371_10115387 Ga0157371_101153873 152
476 3300013297 Ga0157378_10002926 Ga0157378_1000292612 152
477 3300013308 Ga0157375_10521143 Ga0157375_105211432 152
478 3300013308 Ga0157375_11890346 Ga0157375_118903461 152
479 3300014326 Ga0157380_10067503 Ga0157380_100675033 152
480 3300014745 Ga0157377_10060553 Ga0157377_100605534 152
481 3300014968 Ga0157379_10027238 Ga0157379_100272384 152
482 3300014969 Ga0157376_10027802 Ga0157376_100278025 152
483 3300025885 Ga0207653_10014977 Ga0207653_100149772 152
484 3300025899 Ga0207642_10025296 Ga0207642_100252963 152
485 3300025908 Ga0207643_10082980 Ga0207643_100829803 152
486 3300025910 Ga0207684_10383689 Ga0207684_103836892 152
487 3300025912 Ga0207707_10046701 Ga0207707_100467014 152
488 3300025917 Ga0207660_10138602 Ga0207660_101386021 152
489 3300025918 Ga0207662_10000557 Ga0207662_100005578 152
490 3300025921 Ga0207652_10038352 Ga0207652_100383522 152
491 3300025927 Ga0207687_10067709 Ga0207687_100677092 152
492 3300025934 Ga0207686_10109804 Ga0207686_101098042 152
493 3300025935 Ga0207709_10162412 Ga0207709_101624122 152
494 3300025936 Ga0207670_10650326 Ga0207670_106503262 152
495 3300025939 Ga0207665_10575039 Ga0207665_105750391 152
496 3300025942 Ga0207689_10002484 Ga0207689_100024845 152
497 3300025949 Ga0207667_10257353 Ga0207667_102573534 152
498 3300025981 Ga0207640_10256011 Ga0207640_102560112 152
499 3300026023 Ga0207677_10059979 Ga0207677_100599794 152
500 3300026035 Ga0207703_10091326 Ga0207703_100913262 152
501 3300026035 Ga0207703_10259173 Ga0207703_102591732 152
502 3300026041 Ga0207639_10050031 Ga0207639_100500313 152
503 3300026041 Ga0207639_10344484 Ga0207639_103444842 152
504 3300026075 Ga0207708_10002534 Ga0207708_100025343 152
505 3300026078 Ga0207702_10124541 Ga0207702_101245413 152
506 3300026088 Ga0207641_10079921 Ga0207641_100799213 152
507 3300026089 Ga0207648_10009082 Ga0207648_100090822 152
508 3300026118 Ga0207675_100002969 Ga0207675_10000296915 152
509 3300026142 Ga0207698_10505970 Ga0207698_105059702 152
510 3300027907 Ga0207428_10023744 Ga0207428_100237444 152
511 3300028379 Ga0268266_10047422 Ga0268266_100474222 152
512 3300028380 Ga0268265_10106406 Ga0268265_101064062 152
513 3300028381 Ga0268264_10258132 Ga0268264_102581322 152
514 3300028666 Ga0265336_10000185 Ga0265336_1000018514 152
515 3300029957 Ga0265324_10000011 Ga0265324_10000011153 152
516 3300029957 Ga0265324_10073190 Ga0265324_100731902 152
517 3300031241 Ga0265325_10001032 Ga0265325_100010326 152
518 3300031250 Ga0265331_10012146 Ga0265331_100121465 152
519 3300031251 Ga0265327_10037425 Ga0265327_100374252 152
520 3300031665 Ga0316575_10004249 Ga0316575_100042496 152
521 3300032133 Ga0316583_10049970 Ga0316583_100499702 152
522 3300034816 Ga0373930_0002310 Ga0373930_0002310_258_716 152
523 3300034817 Ga0373948_0026227 Ga0373948_0026227_162_620 152
524 3300035084 Ga0373928_0097582 Ga0373928_0097582_290_748 152
525 3300035088 Ga0373940_0093593 Ga0373940_0093593_103_561 152
526 3300035088 Ga0373940_0218863 Ga0373940_0218863_25_483 152
527 3300035090 Ga0373949_0009732 Ga0373949_0009732_1299_1757 152
528 3300035091 Ga0373951_0033554 Ga0373951_0033554_230_688 152
529 3300035092 Ga0373952_0170921 Ga0373952_0170921_31_489 152
530 3300035112 Ga0373932_0030187 Ga0373932_0030187_89_547 152
531 3300035113 Ga0373936_0059210 Ga0373936_0059210_1062_1520 152
532 3300035114 Ga0373939_0021420 Ga0373939_0021420_345_803 152
533 3300035114 Ga0373939_0030786 Ga0373939_0030786_257_715 152
534 3300035114 Ga0373939_0056862 Ga0373939_0056862_439_897 152
535 3300035115 Ga0373941_0014495 Ga0373941_0014495_366_824 152
536 3300035118 Ga0373954_0002128 Ga0373954_0002128_3554_4045 152
537 3300035121 Ga0373960_0045107 Ga0373960_0045107_633_1091 152
538 3300035121 Ga0373960_0152556 Ga0373960_0152556_63_521 152
539 3300035170 Ga0373943_0146920 Ga0373943_0146920_132_590 152
540 3300035207 Ga0373942_0016030 Ga0373942_0016030_1001_1459 152
541 3300035241 Ga0373961_0011504 Ga0373961_0011504_1561_2019 152
542 3300035242 Ga0373962_0004879 Ga0373962_0004879_2254_2712 152
543 3300035242 Ga0373962_0246094 Ga0373962_0246094_120_578 152
544 3300035398 Ga0316574_0037978 Ga0316574_0037978_775_1239 152
545 3300035410 Ga0373924_0035475 Ga0373924_0035475_316_774 152
546 3300035691 Ga0373931_0008517 Ga0373931_0008517_469_927 152
547 3300035691 Ga0373931_0015016 Ga0373931_0015016_1132_1590 152
548 3300035691 Ga0373931_0264159 Ga0373931_0264159_570_1028 152
549 3300035691 Ga0373931_0648806 Ga0373931_0648806_177_635 152
550 3300035725 Ga0373947_0323550 Ga0373947_0323550_519_977 152
551 3300036401 Ga0373937_0211048 Ga0373937_0211048_719_1183 152
552 3300041492 Ga0451835_0013848 Ga0451835_0013848_19_477 152
553 3300044683 Ga0466965_0410675 Ga0466965_0410675_116_574 152
554 3300044693 Ga0466961_0101774 Ga0466961_0101774_346_810 152
555 3300044712 Ga0453684_0348766 Ga0453684_0348766_1051_1509 152
556 3300044842 Ga0466957_0304024 Ga0466957_0304024_542_1009 152
557 3300044901 Ga0466960_0832045 Ga0466960_0832045_17_481 152
558 3300045051 Ga0451576_0005929 Ga0451576_0005929_123_581 152
559 3300045976 Ga0466967_0169134 Ga0466967_0169134_516_974 152
560 3300046454 Ga0495592_0841389 Ga0495592_0841389_58_522 152
561 3300046537 Ga0495598_0151633 Ga0495598_0151633_136_594 152
562 3300046538 Ga0495609_0324789 Ga0495609_0324789_68_526 152
563 3300046684 Ga0495669_0640383 Ga0495669_0640383_49_507 152
564 3300047318 Ga0495636_0040880 Ga0495636_0040880_1225_1689 152
565 3300049575 Ga0501039_0256334 Ga0501039_0256334_128_586 152
566 3300049576 Ga0501040_1291797 Ga0501040_1291797_51_509 152
567 3300049582 Ga0501048_0440574 Ga0501048_0440574_12_470 152
568 3300049587 Ga0501071_0225794 Ga0501071_0225794_579_1043 152
569 3300049590 Ga0501074_0874025 Ga0501074_0874025_25_489 152
570 3300049593 Ga0501077_0523292 Ga0501077_0523292_290_748 152
571 3300049824 Ga0501045_1093019 Ga0501045_1093019_45_503 152
572 3300050489 nmdc:mga03683_308468_c1 nmdc:mga03683_308468_c1_158_622 152
573 3300050507 nmdc:mga05p37_16266_c1 nmdc:mga05p37_16266_c1_4638_5096 152
574 3300050507 nmdc:mga05p37_209129_c1 nmdc:mga05p37_209129_c1_435_893 152
575 3300050507 nmdc:mga05p37_528639_c1 nmdc:mga05p37_528639_c1_427_885 152
576 3300050508 nmdc:mga09592_6497_c1 nmdc:mga09592_6497_c1_5425_5883 152
577 3300050510 nmdc:mga06r32_102593_c1 nmdc:mga06r32_102593_c1_291_749 152
578 3300050511 nmdc:mga08y16_33219_c1 nmdc:mga08y16_33219_c1_23_481 152
579 3300050511 nmdc:mga08y16_35198_c1 nmdc:mga08y16_35198_c1_4168_4626 152
580 3300050512 nmdc:mga0n895_245380_c1 nmdc:mga0n895_245380_c1_131_592 152
581 3300050512 nmdc:mga0n895_8509_c1 nmdc:mga0n895_8509_c1_7628_8086 152
582 3300050513 nmdc:mga0rr50_2168_c1 nmdc:mga0rr50_2168_c1_3837_4295 152
583 3300050513 nmdc:mga0rr50_232128_c1 nmdc:mga0rr50_232128_c1_107_565 152
584 3300050514 nmdc:mga08x19_107305_c1 nmdc:mga08x19_107305_c1_1336_1794 152
585 3300050514 nmdc:mga08x19_22687_c1 nmdc:mga08x19_22687_c1_162_620 152
586 3300050514 nmdc:mga08x19_639_c1 nmdc:mga08x19_639_c1_5745_6203 152
587 3300050515 nmdc:mga0a205_1660_c1 nmdc:mga0a205_1660_c1_5912_6370 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

2

140

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j3e-assembly2.cif.gz_B crystal structure of human thyn1 protein in complex with 5-methylcytosine containing dna 0.9074 1 147
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.9021 1 148
3eop-assembly1.cif.gz_A crystal structure of the duf55 domain of human thymocyte nuclear protein 1 0.8981 3 147
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.8954 3 152
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.888 3 152
ID Description Score Start End Superfamily
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9206 1 148 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8953 3 152 3.10.590.10
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8839 3 152 3.10.590.10
3eopB00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8825 3 147 3.10.590.10
1zceA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.8748 1 147 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A2E6UTU0-F1-model_v4 EVE domain-containing protein 0.9683 65 109
AF-A0A258F5K7-F1-model_v4 EVE domain-containing protein 0.9637 1 113
AF-A0A1Y5GP12-F1-model_v4 EVE domain-containing protein 0.9616 1 103
AF-A0A2N1X0L1-F1-model_v4 deleted 0.9599 3 117
AF-A0A6G1LVR8-F1-model_v4 EVE domain-containing protein 0.9598 3 105 GO:0005634

Feature Viewer

pLDDT pTM Quality
92.57 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map