F466711
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 587 | 367 | 472 | 381 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0003654|Ga0501033_0003654_9444_10664 |
| Length | 406 |
| Sequence | MYVFQDPSRIPSPDPFFLWGDRVVNLELSEEQAAVRKLARDFVQREIAPHVVTWDRAEEVDRGIVKKLGEVGFLGLTVDEEYGGSGGDHLAYCLVTEELGRGDSSVRGIVSVSLGLVAKTIAAWGSEEHKRRWLPGLTSGEYVGCFGLTEPGTGSDAGNLATRAVRDGDDYVVNGTKMFITNGTWADVVLLFARSTDAPGHKGVSAFLVPTDTPGLTRRTIHGKLGLRGQATAELVLEDVRVPASAMLGEEGKGFSVAMSALAKGRMSVAAGCVGIAQAALDAAVRYAGEREQFGKPIARHQLVQELISDIAVDVDAARLLTWRVADLIDRGRPFAVEASKAKLFASEAAVRAANNALQVFGGYGYIDEYPAGKLLRDARVMTLYEGTSQIQKLLIGRALTGVSAF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 2 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 3 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 4 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 5 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 6 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 7 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 8 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 9 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 10 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 11 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 12 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 13 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 14 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 15 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 16 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 17 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 18 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 19 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 20 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 21 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 22 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 23 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 24 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 25 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 26 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 27 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 28 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 29 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 30 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 31 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 32 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 33 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 34 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 35 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 36 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 37 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 38 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 39 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 40 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 41 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 42 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 43 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 44 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 45 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 46 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 47 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 48 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 49 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 50 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 51 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 52 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 53 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 54 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 55 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 56 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 57 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 58 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 59 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 60 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 61 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 62 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 63 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 64 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 65 | 2902582711 | Micromonospora sp. AP08 | Isolate | Unclassified |
| 66 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 67 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 68 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 69 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 70 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 71 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 72 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 73 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 74 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 75 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 76 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 77 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 78 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 79 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 80 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 81 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 82 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 83 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 84 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 85 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 86 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 87 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 88 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 89 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 90 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 91 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 92 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 93 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 94 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 95 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 96 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 97 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 98 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 99 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 100 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 101 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 102 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 103 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 106 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 107 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 109 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 113 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 116 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 118 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 119 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 120 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 122 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 123 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 126 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 127 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 128 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 129 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 130 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 131 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 132 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 133 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 134 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 135 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 136 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 145 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 146 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 148 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 149 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 150 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 152 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 180 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 181 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 182 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 183 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 184 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 187 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 188 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 189 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 190 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 192 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 196 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 198 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 199 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 202 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 203 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 204 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 205 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 206 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 207 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 208 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 209 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 210 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 211 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 212 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 213 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 214 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 215 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 216 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 217 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 218 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 219 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 220 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 221 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 222 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 301 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 302 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 319 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 336 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 337 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 338 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 339 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 340 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 341 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 342 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 343 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 344 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 345 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 347 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 348 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 349 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 350 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 353 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 354 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 355 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 356 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 357 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 358 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 359 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 360 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 361 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 362 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 363 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 364 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
| 365 | 8055412473 | Micromonospora phytophila DSM 105363 | Isolate | Nodule |
| 366 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 367 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 79.73 |
| Metatranscriptomes | 0.68 |
| Isolates | 19.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.11 |
| Nodule | 1.7 |
| Rhizoplane | 0.85 |
| Rhizosphere | 75.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1004106 | 3300000549 | Bacteria | 1912 |
| 2 | rootH1_10103301 | 3300003323 | Bacteria | 1770 |
| 3 | JGI25160J50197_1001531 | 3300003354 | Bacteria | 11459 |
| 4 | JGI25160J50197_1030167 | 3300003354 | Bacteria | 1418 |
| 5 | Ga0070658_10000119 | 3300005327 | Bacteria | 71128 |
| 6 | Ga0070658_10057917 | 3300005327 | Bacteria | 3152 |
| 7 | Ga0070683_100249931 | 3300005329 | Bacteria | 1686 |
| 8 | Ga0068869_100010444 | 3300005334 | Bacteria | 6056 |
| 9 | Ga0070680_100002813 | 3300005336 | Bacteria | 12926 |
| 10 | Ga0070680_100009686 | 3300005336 | Bacteria | 7413 |
| 11 | Ga0070680_100017571 | 3300005336 | Bacteria | 5642 |
| 12 | Ga0070682_100015997 | 3300005337 | Bacteria | 4356 |
| 13 | Ga0068868_100005935 | 3300005338 | Bacteria | 8613 |
| 14 | Ga0070675_100005903 | 3300005354 | Bacteria | 9379 |
| 15 | Ga0070659_100000362 | 3300005366 | Bacteria | 34592 |
| 16 | Ga0070659_100070943 | 3300005366 | Bacteria | 2769 |
| 17 | Ga0070667_100040284 | 3300005367 | Bacteria | 3917 |
| 18 | Ga0070700_100002714 | 3300005441 | Bacteria | 9040 |
| 19 | Ga0070663_100025915 | 3300005455 | Bacteria | 3964 |
| 20 | Ga0070681_10000019 | 3300005458 | Bacteria | 124774 |
| 21 | Ga0070681_10006281 | 3300005458 | Bacteria | 11550 |
| 22 | Ga0070681_10065801 | 3300005458 | Bacteria | 3593 |
| 23 | Ga0070679_100000124 | 3300005530 | Bacteria | 61752 |
| 24 | Ga0070679_100000682 | 3300005530 | Bacteria | 29067 |
| 25 | Ga0070679_100005641 | 3300005530 | Bacteria | 11598 |
| 26 | Ga0070679_100103121 | 3300005530 | Bacteria | 2839 |
| 27 | Ga0070679_100252217 | 3300005530 | Bacteria | 1721 |
| 28 | Ga0070684_100003816 | 3300005535 | Bacteria | 11392 |
| 29 | Ga0070684_100037123 | 3300005535 | Bacteria | 4177 |
| 30 | Ga0070684_100046732 | 3300005535 | Bacteria | 3751 |
| 31 | Ga0070684_100053783 | 3300005535 | Bacteria | 3506 |
| 32 | Ga0068853_100094369 | 3300005539 | Bacteria | 2636 |
| 33 | Ga0070686_100161823 | 3300005544 | Bacteria | 1577 |
| 34 | Ga0070665_100013343 | 3300005548 | Bacteria | 8269 |
| 35 | Ga0070664_100000100 | 3300005564 | Bacteria | 55301 |
| 36 | Ga0070664_100049645 | 3300005564 | Bacteria | 3549 |
| 37 | Ga0068857_100009331 | 3300005577 | Bacteria | 8518 |
| 38 | Ga0068857_100033789 | 3300005577 | Bacteria | 4523 |
| 39 | Ga0068852_100204933 | 3300005616 | Bacteria | 1868 |
| 40 | Ga0068864_100010902 | 3300005618 | Bacteria | 7513 |
| 41 | Ga0068863_100062362 | 3300005841 | Bacteria | 3526 |
| 42 | Ga0068860_100167387 | 3300005843 | Bacteria | 2122 |
| 43 | Ga0068862_100046380 | 3300005844 | Bacteria | 3708 |
| 44 | Ga0081455_10158684 | 3300005937 | Bacteria | 1736 |
| 45 | Ga0075363_100008141 | 3300006048 | Bacteria | 4866 |
| 46 | Ga0075363_100081479 | 3300006048 | Bacteria | 1770 |
| 47 | Ga0075367_10011098 | 3300006178 | Bacteria | 4753 |
| 48 | Ga0075428_100000024 | 3300006844 | Bacteria | 126990 |
| 49 | Ga0075428_100019778 | 3300006844 | Bacteria | 7452 |
| 50 | Ga0075430_100046437 | 3300006846 | Bacteria | 3668 |
| 51 | Ga0075431_100042782 | 3300006847 | Bacteria | 4673 |
| 52 | Ga0075429_100012244 | 3300006880 | Bacteria | 7439 |
| 53 | Ga0099826_10049770 | 3300006948 | Bacteria | 2824 |
| 54 | Ga0105251_10009316 | 3300009011 | Bacteria | 5808 |
| 55 | Ga0105250_10028753 | 3300009092 | Bacteria | 2237 |
| 56 | Ga0111539_10003076 | 3300009094 | Bacteria | 22107 |
| 57 | Ga0105245_10006014 | 3300009098 | Bacteria | 10666 |
| 58 | Ga0114129_10000004 | 3300009147 | Bacteria | 160944 |
| 59 | Ga0114129_10019772 | 3300009147 | Bacteria | 9586 |
| 60 | Ga0105243_10096713 | 3300009148 | Bacteria | 2443 |
| 61 | Ga0105242_10239555 | 3300009176 | Bacteria | 1630 |
| 62 | Ga0105248_10010483 | 3300009177 | Bacteria | 10207 |
| 63 | Ga0157370_10030757 | 3300013104 | Bacteria | 5259 |
| 64 | Ga0157369_10000797 | 3300013105 | Bacteria | 40264 |
| 65 | Ga0157369_10001259 | 3300013105 | Bacteria | 31492 |
| 66 | Ga0157369_10006845 | 3300013105 | Bacteria | 13153 |
| 67 | Ga0157369_10134630 | 3300013105 | Bacteria | 2617 |
| 68 | Ga0182008_10009520 | 3300014497 | Bacteria | 5239 |
| 69 | Ga0157377_10011044 | 3300014745 | Bacteria | 4493 |
| 70 | Ga0182006_1017598 | 3300015261 | Bacteria | 3034 |
| 71 | Ga0182007_10000452 | 3300015262 | Bacteria | 24843 |
| 72 | Ga0183367_1010 | 3300015688 | Bacteria | 416164 |
| 73 | Ga0197907_11404546 | 3300020069 | Bacteria | 2956 |
| 74 | Ga0213876_10006394 | 3300021384 | Bacteria | 6425 |
| 75 | Ga0224712_10001361 | 3300022467 | Bacteria | 5592 |
| 76 | Ga0224712_10012653 | 3300022467 | Bacteria | 2661 |
| 77 | Ga0224712_10021624 | 3300022467 | Bacteria | 2204 |
| 78 | Ga0209758_1005153 | 3300025297 | Bacteria | 10293 |
| 79 | Ga0207426_1001268 | 3300025302 | Bacteria | 22033 |
| 80 | Ga0207426_1003219 | 3300025302 | Bacteria | 9171 |
| 81 | Ga0207426_1004436 | 3300025302 | Bacteria | 6848 |
| 82 | Ga0207647_10022572 | 3300025904 | Bacteria | 4177 |
| 83 | Ga0207705_10002817 | 3300025909 | Bacteria | 13293 |
| 84 | Ga0207707_10000046 | 3300025912 | Bacteria | 119404 |
| 85 | Ga0207707_10009881 | 3300025912 | Bacteria | 8272 |
| 86 | Ga0207707_10037765 | 3300025912 | Bacteria | 4220 |
| 87 | Ga0207660_10014899 | 3300025917 | Bacteria | 5125 |
| 88 | Ga0207660_10038256 | 3300025917 | Bacteria | 3348 |
| 89 | Ga0207660_10210023 | 3300025917 | Bacteria | 1524 |
| 90 | Ga0207662_10066230 | 3300025918 | Bacteria | 2176 |
| 91 | Ga0207652_10000476 | 3300025921 | Bacteria | 41111 |
| 92 | Ga0207652_10004930 | 3300025921 | Bacteria | 10801 |
| 93 | Ga0207652_10047772 | 3300025921 | Bacteria | 3657 |
| 94 | Ga0207652_10083477 | 3300025921 | Bacteria | 2797 |
| 95 | Ga0207652_10172600 | 3300025921 | Bacteria | 1941 |
| 96 | Ga0207659_10068490 | 3300025926 | Bacteria | 2581 |
| 97 | Ga0207687_10010426 | 3300025927 | Bacteria | 6072 |
| 98 | Ga0207700_10162100 | 3300025928 | Bacteria | 1858 |
| 99 | Ga0207664_10107762 | 3300025929 | Bacteria | 2312 |
| 100 | Ga0207690_10003378 | 3300025932 | Bacteria | 9539 |
| 101 | Ga0207690_10012941 | 3300025932 | Bacteria | 5000 |
| 102 | Ga0207711_10013844 | 3300025941 | Bacteria | 6698 |
| 103 | Ga0207689_10146692 | 3300025942 | Bacteria | 1944 |
| 104 | Ga0207661_10188027 | 3300025944 | Bacteria | 1809 |
| 105 | Ga0207679_10011196 | 3300025945 | Bacteria | 5796 |
| 106 | Ga0207679_10050619 | 3300025945 | Bacteria | 3036 |
| 107 | Ga0207658_10028698 | 3300025986 | Bacteria | 3922 |
| 108 | Ga0207639_10068393 | 3300026041 | Bacteria | 2768 |
| 109 | Ga0207678_10006576 | 3300026067 | Bacteria | 10305 |
| 110 | Ga0207708_10004217 | 3300026075 | Bacteria | 10578 |
| 111 | Ga0207641_10030774 | 3300026088 | Bacteria | 4447 |
| 112 | Ga0207676_10005136 | 3300026095 | Bacteria | 9265 |
| 113 | Ga0207674_10063479 | 3300026116 | Bacteria | 3728 |
| 114 | Ga0207674_10098062 | 3300026116 | Bacteria | 2915 |
| 115 | Ga0268266_10033635 | 3300028379 | Bacteria | 4358 |
| 116 | Ga0268265_10009045 | 3300028380 | Bacteria | 6735 |
| 117 | Ga0307517_10003570 | 3300028786 | Bacteria | 24142 |
| 118 | Ga0307517_10005410 | 3300028786 | Bacteria | 19253 |
| 119 | Ga0307517_10039990 | 3300028786 | Bacteria | 5127 |
| 120 | Ga0307515_10001087 | 3300028794 | Bacteria | 62233 |
| 121 | Ga0307515_10020750 | 3300028794 | Bacteria | 11696 |
| 122 | Ga0307515_10066744 | 3300028794 | Bacteria | 4977 |
| 123 | Ga0307511_10000282 | 3300030521 | Bacteria | 53455 |
| 124 | Ga0307511_10091360 | 3300030521 | Bacteria | 2061 |
| 125 | Ga0307512_10014964 | 3300030522 | Bacteria | 7211 |
| 126 | Ga0307512_10039142 | 3300030522 | Bacteria | 3976 |
| 127 | Ga0265340_10002237 | 3300031247 | Bacteria | 11064 |
| 128 | Ga0265339_10013488 | 3300031249 | Bacteria | 4949 |
| 129 | Ga0307513_10006824 | 3300031456 | Bacteria | 14878 |
| 130 | Ga0307513_10025742 | 3300031456 | Bacteria | 6805 |
| 131 | Ga0307513_10035790 | 3300031456 | Bacteria | 5550 |
| 132 | Ga0307513_10176198 | 3300031456 | Bacteria | 2008 |
| 133 | Ga0307509_10016697 | 3300031507 | Bacteria | 8483 |
| 134 | Ga0307509_10139245 | 3300031507 | Bacteria | 2366 |
| 135 | Ga0307509_10169170 | 3300031507 | Bacteria | 2068 |
| 136 | Ga0307408_100336260 | 3300031548 | Bacteria | 1277 |
| 137 | Ga0307508_10001243 | 3300031616 | Bacteria | 29109 |
| 138 | Ga0307508_10015356 | 3300031616 | Bacteria | 6976 |
| 139 | Ga0307508_10019777 | 3300031616 | Bacteria | 6118 |
| 140 | Ga0307508_10058552 | 3300031616 | Bacteria | 3408 |
| 141 | Ga0307514_10027494 | 3300031649 | Bacteria | 4595 |
| 142 | Ga0307514_10029836 | 3300031649 | Bacteria | 4381 |
| 143 | Ga0307514_10036069 | 3300031649 | Bacteria | 3931 |
| 144 | Ga0307514_10040163 | 3300031649 | Bacteria | 3690 |
| 145 | Ga0307514_10046386 | 3300031649 | Bacteria | 3395 |
| 146 | Ga0307514_10060802 | 3300031649 | Bacteria | 2879 |
| 147 | Ga0265314_10011525 | 3300031711 | Bacteria | 7285 |
| 148 | Ga0307516_10003084 | 3300031730 | Bacteria | 21689 |
| 149 | Ga0307516_10011369 | 3300031730 | Bacteria | 9681 |
| 150 | Ga0307516_10021330 | 3300031730 | Bacteria | 6670 |
| 151 | Ga0307516_10235486 | 3300031730 | Bacteria | 1532 |
| 152 | Ga0307518_10001044 | 3300031838 | Bacteria | 20736 |
| 153 | Ga0307518_10099359 | 3300031838 | Bacteria | 2085 |
| 154 | Ga0307406_10135860 | 3300031901 | Bacteria | 1733 |
| 155 | Ga0307415_100206981 | 3300032126 | Bacteria | 1562 |
| 156 | Ga0307507_10008521 | 3300033179 | Bacteria | 14130 |
| 157 | Ga0307507_10019733 | 3300033179 | Bacteria | 7582 |
| 158 | Ga0307507_10141589 | 3300033179 | Bacteria | 1842 |
| 159 | Ga0373956_0002696 | 3300035119 | Bacteria | 7187 |
| 160 | Ga0395900_0071364 | 3300037418 | Bacteria | 3570 |
| 161 | Ga0395900_0205680 | 3300037418 | Bacteria | 1990 |
| 162 | Ga0395898_0004976 | 3300037466 | Bacteria | 14419 |
| 163 | Ga0395898_0021170 | 3300037466 | Bacteria | 6596 |
| 164 | Ga0395898_0263558 | 3300037466 | Bacteria | 1644 |
| 165 | Ga0395905_0139086 | 3300037471 | Bacteria | 2285 |
| 166 | Ga0395901_0345221 | 3300038443 | Bacteria | 1537 |
| 167 | Ga0436365_1038027 | 3300039437 | Bacteria | 15589 |
| 168 | Ga0439436_0000159 | 3300041404 | Bacteria | 15810 |
| 169 | Ga0439436_0009288 | 3300041404 | Bacteria | 3014 |
| 170 | Ga0439439_0010796 | 3300041406 | Bacteria | 2189 |
| 171 | Ga0451837_0453485 | 3300041494 | Bacteria | 3065 |
| 172 | Ga0451853_0935397 | 3300041512 | Bacteria | 6526 |
| 173 | Ga0451853_1587670 | 3300041512 | Bacteria | 3020 |
| 174 | Ga0439433_0000913 | 3300041999 | Bacteria | 5890 |
| 175 | Ga0439449_0013141 | 3300042007 | Bacteria | 3115 |
| 176 | Ga0439449_0013610 | 3300042007 | Bacteria | 3061 |
| 177 | Ga0439449_0068526 | 3300042007 | Bacteria | 1308 |
| 178 | Ga0439457_000263 | 3300042014 | Bacteria | 14393 |
| 179 | Ga0439457_002603 | 3300042014 | Bacteria | 5098 |
| 180 | Ga0439462_0001954 | 3300042015 | Bacteria | 4713 |
| 181 | Ga0450894_000378 | 3300042131 | Bacteria | 7710 |
| 182 | Ga0450903_000983 | 3300042138 | Bacteria | 5481 |
| 183 | Ga0450906_005131 | 3300042145 | Bacteria | 2713 |
| 184 | Ga0439458_0000204 | 3300042157 | Bacteria | 13742 |
| 185 | Ga0466969_0000268 | 3300044656 | Bacteria | 28572 |
| 186 | Ga0466969_0039827 | 3300044656 | Bacteria | 2358 |
| 187 | Ga0466972_0000495 | 3300044658 | Bacteria | 19814 |
| 188 | Ga0466972_0000971 | 3300044658 | Bacteria | 13812 |
| 189 | Ga0466972_0001897 | 3300044658 | Bacteria | 10264 |
| 190 | Ga0466965_0022592 | 3300044683 | Bacteria | 3033 |
| 191 | Ga0466965_0068095 | 3300044683 | Bacteria | 1787 |
| 192 | Ga0466966_0000145 | 3300044684 | Bacteria | 45112 |
| 193 | Ga0466966_0001445 | 3300044684 | Bacteria | 15254 |
| 194 | Ga0466966_0014381 | 3300044684 | Bacteria | 5239 |
| 195 | Ga0466966_0029450 | 3300044684 | Bacteria | 3572 |
| 196 | Ga0466966_0074316 | 3300044684 | Bacteria | 2124 |
| 197 | Ga0466961_0009105 | 3300044693 | Bacteria | 6327 |
| 198 | Ga0466961_0011089 | 3300044693 | Bacteria | 5761 |
| 199 | Ga0466961_0013752 | 3300044693 | Bacteria | 5187 |
| 200 | Ga0466961_0031701 | 3300044693 | Bacteria | 3399 |
| 201 | Ga0466961_0139543 | 3300044693 | Bacteria | 1518 |
| 202 | Ga0466963_0000450 | 3300044694 | Bacteria | 19035 |
| 203 | Ga0466963_0014540 | 3300044694 | Bacteria | 4855 |
| 204 | Ga0466963_0041362 | 3300044694 | Bacteria | 3023 |
| 205 | Ga0466963_0239455 | 3300044694 | Bacteria | 1272 |
| 206 | Ga0466964_0026164 | 3300044706 | Bacteria | 2283 |
| 207 | Ga0466971_0003865 | 3300044719 | Bacteria | 6423 |
| 208 | Ga0466968_0061639 | 3300044735 | Bacteria | 1618 |
| 209 | Ga0466968_0062737 | 3300044735 | Bacteria | 1605 |
| 210 | Ga0466968_0088794 | 3300044735 | Bacteria | 1367 |
| 211 | Ga0466970_0000074 | 3300044765 | Bacteria | 40311 |
| 212 | Ga0466970_0029557 | 3300044765 | Bacteria | 2886 |
| 213 | Ga0466957_0000836 | 3300044842 | Bacteria | 15738 |
| 214 | Ga0466957_0123788 | 3300044842 | Bacteria | 1650 |
| 215 | Ga0466957_0128395 | 3300044842 | Bacteria | 1622 |
| 216 | Ga0466957_0163547 | 3300044842 | Bacteria | 1446 |
| 217 | Ga0466959_0000333 | 3300045049 | Bacteria | 27831 |
| 218 | Ga0466959_0002100 | 3300045049 | Bacteria | 12603 |
| 219 | Ga0466959_0048750 | 3300045049 | Bacteria | 3112 |
| 220 | Ga0466959_0054598 | 3300045049 | Bacteria | 2918 |
| 221 | Ga0466958_0007432 | 3300045836 | Bacteria | 6028 |
| 222 | Ga0466958_0008579 | 3300045836 | Bacteria | 5673 |
| 223 | Ga0466967_0002290 | 3300045976 | Bacteria | 11819 |
| 224 | Ga0466967_0039524 | 3300045976 | Bacteria | 4056 |
| 225 | Ga0466967_0087328 | 3300045976 | Bacteria | 2827 |
| 226 | Ga0466967_0225050 | 3300045976 | Bacteria | 1784 |
| 227 | Ga0466967_0278352 | 3300045976 | Bacteria | 1605 |
| 228 | Ga0466967_0455207 | 3300045976 | Bacteria | 1251 |
| 229 | Ga0495592_0024366 | 3300046454 | Bacteria | 4601 |
| 230 | Ga0495592_0037816 | 3300046454 | Bacteria | 3632 |
| 231 | Ga0495592_0074041 | 3300046454 | Bacteria | 2474 |
| 232 | Ga0495603_0000249 | 3300046455 | Bacteria | 28144 |
| 233 | Ga0495603_0000620 | 3300046455 | Bacteria | 19882 |
| 234 | Ga0495603_0002468 | 3300046455 | Bacteria | 10877 |
| 235 | Ga0495603_0026352 | 3300046455 | Bacteria | 3512 |
| 236 | Ga0495629_0000979 | 3300046459 | Bacteria | 22914 |
| 237 | Ga0495629_0001794 | 3300046459 | Bacteria | 16817 |
| 238 | Ga0495629_0014394 | 3300046459 | Bacteria | 5690 |
| 239 | Ga0495629_0014486 | 3300046459 | Bacteria | 5673 |
| 240 | Ga0495629_0067927 | 3300046459 | Bacteria | 2487 |
| 241 | Ga0495629_0193430 | 3300046459 | Bacteria | 1407 |
| 242 | Ga0495638_0059315 | 3300046460 | Bacteria | 2370 |
| 243 | Ga0495651_0001447 | 3300046462 | Bacteria | 18379 |
| 244 | Ga0495651_0012696 | 3300046462 | Bacteria | 6501 |
| 245 | Ga0495651_0043750 | 3300046462 | Bacteria | 3473 |
| 246 | Ga0495651_0075849 | 3300046462 | Bacteria | 2548 |
| 247 | Ga0495653_0003548 | 3300046463 | Bacteria | 12565 |
| 248 | Ga0495580_0137136 | 3300046472 | Bacteria | 1696 |
| 249 | Ga0495605_0028145 | 3300046474 | Bacteria | 2903 |
| 250 | Ga0495639_0005664 | 3300046475 | Bacteria | 5374 |
| 251 | Ga0495662_0001123 | 3300046476 | Bacteria | 13186 |
| 252 | Ga0495662_0003455 | 3300046476 | Bacteria | 8003 |
| 253 | Ga0495662_0008571 | 3300046476 | Bacteria | 5024 |
| 254 | Ga0495662_0107750 | 3300046476 | Bacteria | 1364 |
| 255 | Ga0495664_0000499 | 3300046477 | Bacteria | 19552 |
| 256 | Ga0495664_0018107 | 3300046477 | Bacteria | 4029 |
| 257 | Ga0495664_0070306 | 3300046477 | Bacteria | 2090 |
| 258 | Ga0495585_0037860 | 3300046492 | Bacteria | 2716 |
| 259 | Ga0495585_0046807 | 3300046492 | Bacteria | 2411 |
| 260 | Ga0495594_0000261 | 3300046499 | Bacteria | 25780 |
| 261 | Ga0495594_0047219 | 3300046499 | Bacteria | 2364 |
| 262 | Ga0495594_0073909 | 3300046499 | Bacteria | 1898 |
| 263 | Ga0495583_0023635 | 3300046506 | Bacteria | 3105 |
| 264 | Ga0495606_0004181 | 3300046507 | Bacteria | 14633 |
| 265 | Ga0495606_0027622 | 3300046507 | Bacteria | 4019 |
| 266 | Ga0495608_0002781 | 3300046511 | Bacteria | 12555 |
| 267 | Ga0495610_0013445 | 3300046512 | Bacteria | 4864 |
| 268 | Ga0495616_0012902 | 3300046513 | Bacteria | 4726 |
| 269 | Ga0495618_0056378 | 3300046514 | Bacteria | 2488 |
| 270 | Ga0495620_0011987 | 3300046515 | Bacteria | 4501 |
| 271 | Ga0495628_0003340 | 3300046516 | Bacteria | 14356 |
| 272 | Ga0495628_0022151 | 3300046516 | Bacteria | 5222 |
| 273 | Ga0495628_0025047 | 3300046516 | Bacteria | 4878 |
| 274 | Ga0495630_0199143 | 3300046517 | Bacteria | 1528 |
| 275 | Ga0495631_0035905 | 3300046518 | Bacteria | 2215 |
| 276 | Ga0495637_0040882 | 3300046520 | Bacteria | 1993 |
| 277 | Ga0495643_0006340 | 3300046522 | Bacteria | 7810 |
| 278 | Ga0495666_0006115 | 3300046526 | Bacteria | 6055 |
| 279 | Ga0495652_0000892 | 3300046529 | Bacteria | 34341 |
| 280 | Ga0495652_0030856 | 3300046529 | Bacteria | 4697 |
| 281 | Ga0495652_0064318 | 3300046529 | Bacteria | 3085 |
| 282 | Ga0495652_0220386 | 3300046529 | Bacteria | 1426 |
| 283 | Ga0495654_0024358 | 3300046530 | Bacteria | 3128 |
| 284 | Ga0495665_0008974 | 3300046531 | Bacteria | 5425 |
| 285 | Ga0495640_0004520 | 3300046533 | Bacteria | 11094 |
| 286 | Ga0495640_0020229 | 3300046533 | Bacteria | 4901 |
| 287 | Ga0495640_0049766 | 3300046533 | Bacteria | 2888 |
| 288 | Ga0495640_0083231 | 3300046533 | Bacteria | 2123 |
| 289 | Ga0495586_0047045 | 3300046535 | Bacteria | 2327 |
| 290 | Ga0495587_0004464 | 3300046536 | Bacteria | 9213 |
| 291 | Ga0495645_0012447 | 3300046543 | Bacteria | 5996 |
| 292 | Ga0495645_0016127 | 3300046543 | Bacteria | 5325 |
| 293 | Ga0495645_0099159 | 3300046543 | Bacteria | 2073 |
| 294 | Ga0495622_0002077 | 3300046557 | Bacteria | 9788 |
| 295 | Ga0495622_0007896 | 3300046557 | Bacteria | 4937 |
| 296 | Ga0495668_0000173 | 3300046616 | Bacteria | 95830 |
| 297 | Ga0495668_0027143 | 3300046616 | Bacteria | 3244 |
| 298 | Ga0495634_0001328 | 3300046642 | Bacteria | 22523 |
| 299 | Ga0495634_0016004 | 3300046642 | Bacteria | 5372 |
| 300 | Ga0495611_0015679 | 3300046648 | Bacteria | 3239 |
| 301 | Ga0495611_0027584 | 3300046648 | Bacteria | 2483 |
| 302 | Ga0495625_0001016 | 3300046660 | Bacteria | 37004 |
| 303 | Ga0495625_0103192 | 3300046660 | Bacteria | 1956 |
| 304 | Ga0495635_0001469 | 3300046663 | Bacteria | 15761 |
| 305 | Ga0495635_0002215 | 3300046663 | Bacteria | 13224 |
| 306 | Ga0495661_0063394 | 3300046665 | Bacteria | 2185 |
| 307 | Ga0495661_0077037 | 3300046665 | Bacteria | 1933 |
| 308 | Ga0495588_0004421 | 3300046674 | Bacteria | 6213 |
| 309 | Ga0495588_0024752 | 3300046674 | Bacteria | 2985 |
| 310 | Ga0495657_0000341 | 3300046675 | Bacteria | 43007 |
| 311 | Ga0495657_0002025 | 3300046675 | Bacteria | 17266 |
| 312 | Ga0495657_0024760 | 3300046675 | Bacteria | 4269 |
| 313 | Ga0495623_0069202 | 3300046679 | Bacteria | 2200 |
| 314 | Ga0495623_0146910 | 3300046679 | Bacteria | 1397 |
| 315 | Ga0495646_0001245 | 3300046680 | Bacteria | 14951 |
| 316 | Ga0495646_0073353 | 3300046680 | Bacteria | 2010 |
| 317 | Ga0495658_0041643 | 3300046683 | Bacteria | 2560 |
| 318 | Ga0495613_0000842 | 3300046689 | Bacteria | 23673 |
| 319 | Ga0495613_0003979 | 3300046689 | Bacteria | 11060 |
| 320 | Ga0495613_0004789 | 3300046689 | Bacteria | 10153 |
| 321 | Ga0495613_0007008 | 3300046689 | Bacteria | 8396 |
| 322 | Ga0495624_0095970 | 3300046690 | Bacteria | 1827 |
| 323 | Ga0495670_0054558 | 3300046691 | Bacteria | 2003 |
| 324 | Ga0495589_0011759 | 3300046794 | Bacteria | 4540 |
| 325 | Ga0495589_0017555 | 3300046794 | Bacteria | 3672 |
| 326 | Ga0495589_0066936 | 3300046794 | Bacteria | 1758 |
| 327 | Ga0495600_0019495 | 3300046809 | Bacteria | 4331 |
| 328 | Ga0495660_0020458 | 3300046810 | Bacteria | 3793 |
| 329 | Ga0495660_0028260 | 3300046810 | Bacteria | 3170 |
| 330 | Ga0495581_0006660 | 3300047315 | Bacteria | 6694 |
| 331 | Ga0495581_0008813 | 3300047315 | Bacteria | 5839 |
| 332 | Ga0495581_0109008 | 3300047315 | Bacteria | 1610 |
| 333 | Ga0495604_0000834 | 3300047317 | Bacteria | 25747 |
| 334 | Ga0495604_0001874 | 3300047317 | Bacteria | 17091 |
| 335 | Ga0495604_0014104 | 3300047317 | Bacteria | 6371 |
| 336 | Ga0495604_0045676 | 3300047317 | Bacteria | 3417 |
| 337 | Ga0495604_0047567 | 3300047317 | Bacteria | 3340 |
| 338 | Ga0495604_0160596 | 3300047317 | Bacteria | 1588 |
| 339 | Ga0495636_0003165 | 3300047318 | Bacteria | 6380 |
| 340 | Ga0495636_0023554 | 3300047318 | Bacteria | 2493 |
| 341 | Ga0495674_0037951 | 3300047319 | Bacteria | 4328 |
| 342 | Ga0495674_0044486 | 3300047319 | Bacteria | 3947 |
| 343 | Ga0495676_0001912 | 3300047321 | Bacteria | 18285 |
| 344 | Ga0495676_0004554 | 3300047321 | Bacteria | 12682 |
| 345 | Ga0495676_0007813 | 3300047321 | Bacteria | 9812 |
| 346 | Ga0495676_0009089 | 3300047321 | Bacteria | 9064 |
| 347 | Ga0495676_0016804 | 3300047321 | Bacteria | 6480 |
| 348 | Ga0495676_0019906 | 3300047321 | Bacteria | 5897 |
| 349 | Ga0495683_0001149 | 3300047323 | Bacteria | 18207 |
| 350 | Ga0495687_002083 | 3300047443 | Bacteria | 16813 |
| 351 | Ga0495687_007176 | 3300047443 | Bacteria | 6637 |
| 352 | Ga0495687_007522 | 3300047443 | Bacteria | 6399 |
| 353 | Ga0495675_0001288 | 3300047444 | Bacteria | 15182 |
| 354 | Ga0495675_0016249 | 3300047444 | Bacteria | 4707 |
| 355 | Ga0495675_0027886 | 3300047444 | Bacteria | 3599 |
| 356 | Ga0495677_0018294 | 3300047445 | Bacteria | 2540 |
| 357 | Ga0495685_005434 | 3300047447 | Bacteria | 4161 |
| 358 | Ga0495685_009962 | 3300047447 | Bacteria | 3181 |
| 359 | Ga0495685_019455 | 3300047447 | Bacteria | 2333 |
| 360 | Ga0495685_044298 | 3300047447 | Bacteria | 1517 |
| 361 | Ga0495681_0000784 | 3300047470 | Bacteria | 24436 |
| 362 | Ga0495684_0134492 | 3300047471 | Bacteria | 1856 |
| 363 | Ga0495686_0022730 | 3300047472 | Bacteria | 4146 |
| 364 | Ga0495686_0073250 | 3300047472 | Bacteria | 2104 |
| 365 | Ga0495593_0101375 | 3300047673 | Bacteria | 1476 |
| 366 | Ga0495602_0064187 | 3300048088 | Bacteria | 3177 |
| 367 | Ga0495614_0000263 | 3300048089 | Bacteria | 20482 |
| 368 | Ga0495614_0022889 | 3300048089 | Bacteria | 2693 |
| 369 | Ga0495614_0042812 | 3300048089 | Bacteria | 1941 |
| 370 | Ga0495614_0043722 | 3300048089 | Bacteria | 1921 |
| 371 | Ga0495626_0000267 | 3300048091 | Bacteria | 58992 |
| 372 | Ga0495626_0011502 | 3300048091 | Bacteria | 4680 |
| 373 | Ga0496104_0016807 | 3300048907 | Bacteria | 6649 |
| 374 | Ga0496108_0008951 | 3300048911 | Bacteria | 8111 |
| 375 | Ga0496108_0077432 | 3300048911 | Bacteria | 2813 |
| 376 | Ga0496109_0103754 | 3300048912 | Bacteria | 2639 |
| 377 | Ga0496115_0071010 | 3300048918 | Bacteria | 2824 |
| 378 | Ga0496125_0221430 | 3300048928 | Bacteria | 1219 |
| 379 | Ga0496126_0115936 | 3300048929 | Bacteria | 2328 |
| 380 | Ga0501031_0022792 | 3300049568 | Bacteria | 4082 |
| 381 | Ga0501031_0062569 | 3300049568 | Bacteria | 2425 |
| 382 | Ga0501031_0130617 | 3300049568 | Bacteria | 1641 |
| 383 | Ga0501032_0047688 | 3300049569 | Bacteria | 2892 |
| 384 | Ga0501032_0114438 | 3300049569 | Bacteria | 1784 |
| 385 | Ga0501033_0000179 | 3300049570 | Bacteria | 60544 |
| 386 | Ga0501033_0003654 | 3300049570 | Bacteria | 12543 |
| 387 | Ga0501034_0009370 | 3300049571 | Bacteria | 10259 |
| 388 | Ga0501034_0069294 | 3300049571 | Bacteria | 3538 |
| 389 | Ga0501034_0158204 | 3300049571 | Bacteria | 2238 |
| 390 | Ga0501034_0248612 | 3300049571 | Bacteria | 1723 |
| 391 | Ga0501036_0000451 | 3300049572 | Bacteria | 29280 |
| 392 | Ga0501036_0003493 | 3300049572 | Bacteria | 12563 |
| 393 | Ga0501036_0024200 | 3300049572 | Bacteria | 5118 |
| 394 | Ga0501036_0049706 | 3300049572 | Bacteria | 3551 |
| 395 | Ga0501036_0102607 | 3300049572 | Bacteria | 2419 |
| 396 | Ga0501037_0006301 | 3300049573 | Bacteria | 8677 |
| 397 | Ga0501037_0014154 | 3300049573 | Bacteria | 5873 |
| 398 | Ga0501037_0067776 | 3300049573 | Bacteria | 2598 |
| 399 | Ga0501038_0049134 | 3300049574 | Bacteria | 3648 |
| 400 | Ga0501038_0069384 | 3300049574 | Bacteria | 2994 |
| 401 | Ga0501038_0081832 | 3300049574 | Bacteria | 2720 |
| 402 | Ga0501039_0001059 | 3300049575 | Bacteria | 20182 |
| 403 | Ga0501039_0037612 | 3300049575 | Bacteria | 3736 |
| 404 | Ga0501043_0001254 | 3300049579 | Bacteria | 22385 |
| 405 | Ga0501043_0007676 | 3300049579 | Bacteria | 8545 |
| 406 | Ga0501043_0027047 | 3300049579 | Bacteria | 4502 |
| 407 | Ga0501043_0110655 | 3300049579 | Bacteria | 2157 |
| 408 | Ga0501046_0015692 | 3300049580 | Bacteria | 6359 |
| 409 | Ga0501047_0000118 | 3300049581 | Bacteria | 96347 |
| 410 | Ga0501047_0083511 | 3300049581 | Bacteria | 3070 |
| 411 | Ga0501069_0014865 | 3300049585 | Bacteria | 4168 |
| 412 | Ga0501069_0240219 | 3300049585 | Bacteria | 1055 |
| 413 | Ga0501070_0001293 | 3300049586 | Bacteria | 22462 |
| 414 | Ga0501070_0002439 | 3300049586 | Bacteria | 16306 |
| 415 | Ga0501070_0010595 | 3300049586 | Bacteria | 7792 |
| 416 | Ga0501070_0037540 | 3300049586 | Bacteria | 4043 |
| 417 | Ga0501070_0055842 | 3300049586 | Bacteria | 3273 |
| 418 | Ga0501073_0051291 | 3300049589 | Bacteria | 2890 |
| 419 | Ga0501074_0000165 | 3300049590 | Bacteria | 35249 |
| 420 | Ga0501074_0007204 | 3300049590 | Bacteria | 8032 |
| 421 | Ga0501076_0276551 | 3300049592 | Bacteria | 1375 |
| 422 | Ga0501079_0000028 | 3300049741 | Bacteria | 60671 |
| 423 | Ga0501080_0000294 | 3300049742 | Bacteria | 37892 |
| 424 | Ga0501080_0132719 | 3300049742 | Bacteria | 2305 |
| 425 | Ga0501035_0001045 | 3300049822 | Bacteria | 28960 |
| 426 | Ga0501035_0006958 | 3300049822 | Bacteria | 10563 |
| 427 | Ga0501035_0088176 | 3300049822 | Bacteria | 2734 |
| 428 | Ga0501035_0134310 | 3300049822 | Bacteria | 2155 |
| 429 | Ga0501035_0183113 | 3300049822 | Bacteria | 1804 |
| 430 | Ga0501044_0001242 | 3300049823 | Bacteria | 30258 |
| 431 | Ga0501044_0028991 | 3300049823 | Bacteria | 5839 |
| 432 | Ga0501044_0061413 | 3300049823 | Bacteria | 3844 |
| 433 | Ga0501044_0068230 | 3300049823 | Bacteria | 3622 |
| 434 | Ga0501044_0097767 | 3300049823 | Bacteria | 2956 |
| 435 | Ga0501045_0071795 | 3300049824 | Bacteria | 2548 |
| 436 | nmdc:mga03n38_56219_c1 | 3300050490 | Bacteria | 1775 |
| 437 | nmdc:mga03n38_7425_c1 | 3300050490 | Bacteria | 3880 |
| 438 | nmdc:mga00v17_76806_c1 | 3300050491 | Bacteria | 2078 |
| 439 | nmdc:mga06z11_10586_c1 | 3300050494 | Bacteria | 3938 |
| 440 | nmdc:mga05p37_4281_c1 | 3300050507 | Bacteria | 16670 |
| 441 | nmdc:mga05p37_744_c1 | 3300050507 | Bacteria | 36096 |
| 442 | nmdc:mga09592_80_c1 | 3300050508 | Bacteria | 56013 |
| 443 | nmdc:mga0qj67_29_c3 | 3300050509 | Bacteria | 57362 |
| 444 | nmdc:mga06r32_2334_c1 | 3300050510 | Bacteria | 17005 |
| 445 | nmdc:mga08y16_12126_c1 | 3300050511 | Bacteria | 9056 |
| 446 | Ga0495601_0009723 | 3300053077 | Bacteria | 5687 |
| 447 | Ga0495601_0031693 | 3300053077 | Bacteria | 3286 |
| 448 | Ga0495601_0031798 | 3300053077 | Bacteria | 3281 |
| 449 | Ga0495612_0008314 | 3300053078 | Bacteria | 4212 |
| 450 | Ga0495612_0040311 | 3300053078 | Bacteria | 1902 |
| 451 | Ga0495612_0047212 | 3300053078 | Bacteria | 1764 |
| 452 | Ga0500610_0043468 | 3300053079 | Bacteria | 2328 |
| 453 | Ga0495595_0041276 | 3300053084 | Bacteria | 2111 |
| 454 | Ga0500578_0021682 | 3300053086 | Bacteria | 4126 |
| 455 | Ga0500646_0000183 | 3300053090 | Bacteria | 18755 |
| 456 | Ga0500583_0005061 | 3300053092 | Bacteria | 4375 |
| 457 | Ga0500566_0052521 | 3300053094 | Bacteria | 2328 |
| 458 | Ga0500650_0068384 | 3300053098 | Bacteria | 1660 |
| 459 | Ga0500654_021317 | 3300053099 | Bacteria | 4135 |
| 460 | Ga0500569_002102 | 3300053109 | Bacteria | 3877 |
| 461 | Ga0500628_001701 | 3300053129 | Bacteria | 3714 |
| 462 | Ga0500652_005085 | 3300053131 | Bacteria | 4114 |
| 463 | Ga0500658_0023806 | 3300053134 | Bacteria | 2341 |
| 464 | Ga0500559_0055245 | 3300053136 | Bacteria | 1761 |
| 465 | Ga0500573_0023718 | 3300053140 | Bacteria | 3525 |
| 466 | Ga0500600_0021395 | 3300053149 | Bacteria | 3877 |
| 467 | Ga0500633_0046139 | 3300053160 | Bacteria | 1487 |
| 468 | Ga0500634_0027117 | 3300053161 | Bacteria | 3121 |
| 469 | Ga0500656_001145 | 3300053732 | Bacteria | 2214 |
| 470 | Ga0501084_0182838 | 3300054114 | Bacteria | 1770 |
| 471 | Ga0466962_0001956 | 3300061719 | Bacteria | 9704 |
| 472 | Ga0466962_0011950 | 3300061719 | Bacteria | 4177 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048912 | Ga0496109_0103754 | Ga0496109_0103754_1647_2615 | 293 |
| 2 | 3300049585 | Ga0501069_0240219 | Ga0501069_0240219_24_992 | 304 |
| 3 | 3300047447 | Ga0495685_044298 | Ga0495685_044298_479_1507 | 324 |
| 4 | 3300061719 | Ga0466962_0001956 | Ga0466962_0001956_8624_9691 | 337 |
| 5 | 3300039437 | Ga0436365_1038027 | Ga0436365_1038027_7532_8611 | 342 |
| 6 | 3300025302 | Ga0207426_1003219 | Ga0207426_10032196 | 356 |
| 7 | iso_pu_bacteria | 2582581312 | 2585296789 | 356 |
| 8 | iso_pu_bacteria | 2867312974 | 2867314505 | 358 |
| 9 | iso_pu_bacteria | 2862382967 | 2862383104 | 360 |
| 10 | iso_pu_bacteria | 8008558824 | 8008561562 | 360 |
| 11 | 3300028794 | Ga0307515_10066744 | Ga0307515_100667442 | 361 |
| 12 | 3300031507 | Ga0307509_10169170 | Ga0307509_101691702 | 361 |
| 13 | 3300031616 | Ga0307508_10019777 | Ga0307508_100197774 | 361 |
| 14 | 3300031649 | Ga0307514_10029836 | Ga0307514_100298362 | 361 |
| 15 | 3300031649 | Ga0307514_10040163 | Ga0307514_100401633 | 361 |
| 16 | 3300031730 | Ga0307516_10011369 | Ga0307516_100113693 | 361 |
| 17 | 3300046794 | Ga0495589_0017555 | Ga0495589_0017555_2008_3165 | 361 |
| 18 | 3300047443 | Ga0495687_007176 | Ga0495687_007176_1124_2281 | 361 |
| 19 | iso_pu_bacteria | 2501939600 | 2501941592 | 361 |
| 20 | iso_pu_bacteria | 2547132111 | 2547406745 | 361 |
| 21 | iso_pu_bacteria | 2554235005 | 2554259344 | 361 |
| 22 | iso_pu_bacteria | 2582581314 | 2585315504 | 361 |
| 23 | iso_pu_bacteria | 2616644814 | 2616695884 | 361 |
| 24 | iso_pu_bacteria | 2616644941 | 2616900560 | 361 |
| 25 | iso_pu_bacteria | 2643221548 | 2643759962 | 361 |
| 26 | iso_pu_bacteria | 2643221561 | 2643824976 | 361 |
| 27 | iso_pu_bacteria | 2643221578 | 2643904704 | 361 |
| 28 | iso_pu_bacteria | 2643221587 | 2643946342 | 361 |
| 29 | iso_pu_bacteria | 2643221601 | 2644019521 | 361 |
| 30 | iso_pu_bacteria | 2643221631 | 2644180592 | 361 |
| 31 | iso_pu_bacteria | 2643221670 | 2644389316 | 361 |
| 32 | iso_pu_bacteria | 2643221673 | 2644406030 | 361 |
| 33 | iso_pu_bacteria | 2643221677 | 2644434146 | 361 |
| 34 | iso_pu_bacteria | 2643221682 | 2644460342 | 361 |
| 35 | iso_pu_bacteria | 2643221696 | 2644534716 | 361 |
| 36 | iso_pu_bacteria | 2772190715 | 2772646117 | 361 |
| 37 | iso_pu_bacteria | 2784132148 | 2784586949 | 361 |
| 38 | iso_pu_bacteria | 2784746763 | 2785345485 | 361 |
| 39 | iso_pu_bacteria | 2802429296 | 2804849184 | 361 |
| 40 | iso_pu_bacteria | 2808606448 | 2809230515 | 361 |
| 41 | iso_pu_bacteria | 2808606982 | 2811847180 | 361 |
| 42 | iso_pu_bacteria | 2811994917 | 2812478248 | 361 |
| 43 | iso_pu_bacteria | 2811994917 | 2812482150 | 361 |
| 44 | iso_pu_bacteria | 2818991463 | 2819696625 | 361 |
| 45 | iso_pu_bacteria | 2818991472 | 2819739168 | 361 |
| 46 | iso_pu_bacteria | 2852635781 | 2852637936 | 361 |
| 47 | iso_pu_bacteria | 2855670206 | 2855670748 | 361 |
| 48 | iso_pu_bacteria | 2855676851 | 2855677823 | 361 |
| 49 | iso_pu_bacteria | 2858848962 | 2858849355 | 361 |
| 50 | iso_pu_bacteria | 2858882152 | 2858882488 | 361 |
| 51 | iso_pu_bacteria | 2858888857 | 2858894663 | 361 |
| 52 | iso_pu_bacteria | 2858895516 | 2858895573 | 361 |
| 53 | iso_pu_bacteria | 2862178590 | 2862180462 | 361 |
| 54 | iso_pu_bacteria | 2862290372 | 2862294392 | 361 |
| 55 | iso_pu_bacteria | 2862507626 | 2862514181 | 361 |
| 56 | iso_pu_bacteria | 2862574272 | 2862583455 | 361 |
| 57 | iso_pu_bacteria | 2863404153 | 2863406747 | 361 |
| 58 | iso_pu_bacteria | 2867302475 | 2867302589 | 361 |
| 59 | iso_pu_bacteria | 2867319477 | 2867323331 | 361 |
| 60 | iso_pu_bacteria | 2869048445 | 2869051136 | 361 |
| 61 | iso_pu_bacteria | 2869061728 | 2869066780 | 361 |
| 62 | iso_pu_bacteria | 2869068681 | 2869069647 | 361 |
| 63 | iso_pu_bacteria | 2873151551 | 2873157463 | 361 |
| 64 | iso_pu_bacteria | 2875391855 | 2875392898 | 361 |
| 65 | iso_pu_bacteria | 2880489317 | 2880490862 | 361 |
| 66 | iso_pu_bacteria | 2880495981 | 2880501652 | 361 |
| 67 | iso_pu_bacteria | 2887478801 | 2887480903 | 361 |
| 68 | iso_pu_bacteria | 2902582711 | 2902582921 | 361 |
| 69 | iso_pu_bacteria | 2912715099 | 2912722166 | 361 |
| 70 | iso_pu_bacteria | 2918501144 | 2918502733 | 361 |
| 71 | iso_pu_bacteria | 2919713450 | 2919718694 | 361 |
| 72 | iso_pu_bacteria | 2929219909 | 2929223763 | 361 |
| 73 | iso_pu_bacteria | 2929226422 | 2929230155 | 361 |
| 74 | iso_pu_bacteria | 2935390628 | 2935395830 | 361 |
| 75 | iso_pu_bacteria | 2946045630 | 2946051800 | 361 |
| 76 | iso_pu_bacteria | 2954002825 | 2954010814 | 361 |
| 77 | iso_pu_bacteria | 2966598605 | 2966604176 | 361 |
| 78 | iso_pu_bacteria | 2990059506 | 2990062682 | 361 |
| 79 | iso_pu_bacteria | 2990088156 | 2990094473 | 361 |
| 80 | iso_pu_bacteria | 2997451912 | 2997454100 | 361 |
| 81 | iso_pu_bacteria | 2997600082 | 2997601852 | 361 |
| 82 | iso_pu_bacteria | 3002998708 | 3003008529 | 361 |
| 83 | iso_pu_bacteria | 3006486233 | 3006491530 | 361 |
| 84 | iso_pu_bacteria | 3006493962 | 3006495259 | 361 |
| 85 | iso_pu_bacteria | 649633069 | 649816050 | 361 |
| 86 | iso_pu_bacteria | 8003830390 | 8003834394 | 361 |
| 87 | iso_pu_bacteria | 8003870546 | 8003872448 | 361 |
| 88 | iso_pu_bacteria | 8023623736 | 8023631606 | 361 |
| 89 | iso_pu_bacteria | 8025413630 | 8025413879 | 361 |
| 90 | iso_pu_bacteria | 8048406513 | 8048412090 | 361 |
| 91 | iso_pu_bacteria | 8054704163 | 8054705884 | 361 |
| 92 | iso_pu_bacteria | 8054727385 | 8054728887 | 361 |
| 93 | iso_pu_bacteria | 8054734606 | 8054734752 | 361 |
| 94 | iso_pu_bacteria | 8055412473 | 8055417695 | 361 |
| 95 | iso_pu_bacteria | 8056207758 | 8056209527 | 361 |
| 96 | 3300028794 | Ga0307515_10020750 | Ga0307515_100207505 | 362 |
| 97 | 3300031456 | Ga0307513_10025742 | Ga0307513_100257422 | 362 |
| 98 | 3300031649 | Ga0307514_10046386 | Ga0307514_100463862 | 362 |
| 99 | 3300031838 | Ga0307518_10001044 | Ga0307518_100010447 | 362 |
| 100 | iso_pu_bacteria | 2582581313 | 2585303818 | 362 |
| 101 | iso_pu_bacteria | 2643221647 | 2644268287 | 362 |
| 102 | iso_pu_bacteria | 2643221678 | 2644438459 | 362 |
| 103 | iso_pu_bacteria | 2643221714 | 2644629261 | 362 |
| 104 | iso_pu_bacteria | 2784746768 | 2785367396 | 362 |
| 105 | iso_pu_bacteria | 2786546132 | 2786668442 | 362 |
| 106 | iso_pu_bacteria | 2808606359 | 2808847901 | 362 |
| 107 | iso_pu_bacteria | 2808606375 | 2808918651 | 362 |
| 108 | iso_pu_bacteria | 2811994879 | 2812360088 | 362 |
| 109 | iso_pu_bacteria | 2862281513 | 2862289393 | 362 |
| 110 | iso_pu_bacteria | 2867428634 | 2867430222 | 362 |
| 111 | iso_pu_bacteria | 2877676314 | 2877683154 | 362 |
| 112 | iso_pu_bacteria | 2912723979 | 2912725886 | 362 |
| 113 | iso_pu_bacteria | 2919468124 | 2919473666 | 362 |
| 114 | iso_pu_bacteria | 2946064051 | 2946065800 | 362 |
| 115 | iso_pu_bacteria | 2946072368 | 2946074144 | 362 |
| 116 | iso_pu_bacteria | 2954380949 | 2954388372 | 362 |
| 117 | iso_pu_bacteria | 2954673503 | 2954674718 | 362 |
| 118 | iso_pu_bacteria | 2954682443 | 2954689415 | 362 |
| 119 | iso_pu_bacteria | 2954691527 | 2954699187 | 362 |
| 120 | iso_pu_bacteria | 2954701450 | 2954703031 | 362 |
| 121 | iso_pu_bacteria | 2954711539 | 2954718139 | 362 |
| 122 | iso_pu_bacteria | 2954721474 | 2954728107 | 362 |
| 123 | iso_pu_bacteria | 2954731030 | 2954733699 | 362 |
| 124 | iso_pu_bacteria | 2954740390 | 2954747004 | 362 |
| 125 | iso_pu_bacteria | 2954749733 | 2954752583 | 362 |
| 126 | iso_pu_bacteria | 2954759201 | 2954766117 | 362 |
| 127 | iso_pu_bacteria | 3006393351 | 3006395287 | 362 |
| 128 | iso_pu_bacteria | 8008574985 | 8008580528 | 362 |
| 129 | 3300005548 | Ga0070665_100013343 | Ga0070665_1000133435 | 363 |
| 130 | 3300028379 | Ga0268266_10033635 | Ga0268266_100336353 | 363 |
| 131 | 3300044735 | Ga0466968_0088794 | Ga0466968_0088794_154_1302 | 363 |
| 132 | 3300046507 | Ga0495606_0004181 | Ga0495606_0004181_8337_9479 | 363 |
| 133 | 3300046616 | Ga0495668_0000173 | Ga0495668_0000173_48971_50113 | 363 |
| 134 | 3300046660 | Ga0495625_0001016 | Ga0495625_0001016_16439_17581 | 363 |
| 135 | 3300048091 | Ga0495626_0000267 | Ga0495626_0000267_54324_55466 | 363 |
| 136 | 3300050491 | nmdc:mga00v17_76806_c1 | nmdc:mga00v17_76806_c1_568_1716 | 363 |
| 137 | iso_pu_bacteria | 3006321560 | 3006326000 | 363 |
| 138 | iso_pu_bacteria | 8003856774 | 8003861675 | 363 |
| 139 | 3300025917 | Ga0207660_10210023 | Ga0207660_102100232 | 364 |
| 140 | 3300025918 | Ga0207662_10066230 | Ga0207662_100662302 | 364 |
| 141 | 3300035119 | Ga0373956_0002696 | Ga0373956_0002696_3298_4449 | 364 |
| 142 | 3300044842 | Ga0466957_0123788 | Ga0466957_0123788_129_1280 | 364 |
| 143 | 3300046533 | Ga0495640_0049766 | Ga0495640_0049766_308_1468 | 364 |
| 144 | 3300047317 | Ga0495604_0047567 | Ga0495604_0047567_1401_2561 | 364 |
| 145 | 3300049592 | Ga0501076_0276551 | Ga0501076_0276551_51_1199 | 364 |
| 146 | 3300053090 | Ga0500646_0000183 | Ga0500646_0000183_2755_3906 | 364 |
| 147 | 3300053092 | Ga0500583_0005061 | Ga0500583_0005061_1666_2820 | 364 |
| 148 | 3300053160 | Ga0500633_0046139 | Ga0500633_0046139_233_1387 | 364 |
| 149 | 3300054114 | Ga0501084_0182838 | Ga0501084_0182838_216_1367 | 364 |
| 150 | iso_pu_bacteria | 2857288857 | 2857289678 | 364 |
| 151 | 3300000549 | LJQas_1004106 | LJQas_10041062 | 365 |
| 152 | 3300003323 | rootH1_10103301 | rootH1_101033011 | 365 |
| 153 | 3300003354 | JGI25160J50197_1001531 | JGI25160J50197_10015315 | 365 |
| 154 | 3300003354 | JGI25160J50197_1030167 | JGI25160J50197_10301671 | 365 |
| 155 | 3300005327 | Ga0070658_10000119 | Ga0070658_1000011931 | 365 |
| 156 | 3300005327 | Ga0070658_10057917 | Ga0070658_100579173 | 365 |
| 157 | 3300005329 | Ga0070683_100249931 | Ga0070683_1002499311 | 365 |
| 158 | 3300005334 | Ga0068869_100010444 | Ga0068869_1000104441 | 365 |
| 159 | 3300005336 | Ga0070680_100002813 | Ga0070680_10000281315 | 365 |
| 160 | 3300005336 | Ga0070680_100009686 | Ga0070680_1000096865 | 365 |
| 161 | 3300005336 | Ga0070680_100017571 | Ga0070680_1000175713 | 365 |
| 162 | 3300005337 | Ga0070682_100015997 | Ga0070682_1000159972 | 365 |
| 163 | 3300005338 | Ga0068868_100005935 | Ga0068868_1000059351 | 365 |
| 164 | 3300005354 | Ga0070675_100005903 | Ga0070675_10000590310 | 365 |
| 165 | 3300005366 | Ga0070659_100000362 | Ga0070659_10000036223 | 365 |
| 166 | 3300005366 | Ga0070659_100070943 | Ga0070659_1000709432 | 365 |
| 167 | 3300005367 | Ga0070667_100040284 | Ga0070667_1000402843 | 365 |
| 168 | 3300005441 | Ga0070700_100002714 | Ga0070700_1000027142 | 365 |
| 169 | 3300005455 | Ga0070663_100025915 | Ga0070663_1000259151 | 365 |
| 170 | 3300005458 | Ga0070681_10000019 | Ga0070681_10000019113 | 365 |
| 171 | 3300005458 | Ga0070681_10006281 | Ga0070681_100062818 | 365 |
| 172 | 3300005458 | Ga0070681_10065801 | Ga0070681_100658016 | 365 |
| 173 | 3300005530 | Ga0070679_100000124 | Ga0070679_10000012421 | 365 |
| 174 | 3300005530 | Ga0070679_100000682 | Ga0070679_10000068217 | 365 |
| 175 | 3300005530 | Ga0070679_100005641 | Ga0070679_1000056415 | 365 |
| 176 | 3300005530 | Ga0070679_100103121 | Ga0070679_1001031211 | 365 |
| 177 | 3300005530 | Ga0070679_100252217 | Ga0070679_1002522172 | 365 |
| 178 | 3300005535 | Ga0070684_100003816 | Ga0070684_1000038161 | 365 |
| 179 | 3300005535 | Ga0070684_100037123 | Ga0070684_1000371234 | 365 |
| 180 | 3300005535 | Ga0070684_100046732 | Ga0070684_1000467325 | 365 |
| 181 | 3300005535 | Ga0070684_100053783 | Ga0070684_1000537832 | 365 |
| 182 | 3300005539 | Ga0068853_100094369 | Ga0068853_1000943693 | 365 |
| 183 | 3300005544 | Ga0070686_100161823 | Ga0070686_1001618232 | 365 |
| 184 | 3300005564 | Ga0070664_100000100 | Ga0070664_10000010042 | 365 |
| 185 | 3300005564 | Ga0070664_100049645 | Ga0070664_1000496452 | 365 |
| 186 | 3300005577 | Ga0068857_100009331 | Ga0068857_1000093316 | 365 |
| 187 | 3300005577 | Ga0068857_100033789 | Ga0068857_1000337892 | 365 |
| 188 | 3300005616 | Ga0068852_100204933 | Ga0068852_1002049331 | 365 |
| 189 | 3300005618 | Ga0068864_100010902 | Ga0068864_1000109024 | 365 |
| 190 | 3300005841 | Ga0068863_100062362 | Ga0068863_1000623624 | 365 |
| 191 | 3300005843 | Ga0068860_100167387 | Ga0068860_1001673871 | 365 |
| 192 | 3300005844 | Ga0068862_100046380 | Ga0068862_1000463802 | 365 |
| 193 | 3300005937 | Ga0081455_10158684 | Ga0081455_101586841 | 365 |
| 194 | 3300006048 | Ga0075363_100008141 | Ga0075363_1000081415 | 365 |
| 195 | 3300006048 | Ga0075363_100081479 | Ga0075363_1000814792 | 365 |
| 196 | 3300006178 | Ga0075367_10011098 | Ga0075367_100110986 | 365 |
| 197 | 3300006844 | Ga0075428_100000024 | Ga0075428_100000024110 | 365 |
| 198 | 3300006844 | Ga0075428_100019778 | Ga0075428_1000197785 | 365 |
| 199 | 3300006846 | Ga0075430_100046437 | Ga0075430_1000464372 | 365 |
| 200 | 3300006847 | Ga0075431_100042782 | Ga0075431_1000427822 | 365 |
| 201 | 3300006880 | Ga0075429_100012244 | Ga0075429_1000122442 | 365 |
| 202 | 3300006948 | Ga0099826_10049770 | Ga0099826_100497701 | 365 |
| 203 | 3300009011 | Ga0105251_10009316 | Ga0105251_100093167 | 365 |
| 204 | 3300009092 | Ga0105250_10028753 | Ga0105250_100287532 | 365 |
| 205 | 3300009094 | Ga0111539_10003076 | Ga0111539_100030769 | 365 |
| 206 | 3300009098 | Ga0105245_10006014 | Ga0105245_100060147 | 365 |
| 207 | 3300009147 | Ga0114129_10000004 | Ga0114129_1000000426 | 365 |
| 208 | 3300009147 | Ga0114129_10019772 | Ga0114129_100197723 | 365 |
| 209 | 3300009148 | Ga0105243_10096713 | Ga0105243_100967131 | 365 |
| 210 | 3300009176 | Ga0105242_10239555 | Ga0105242_102395552 | 365 |
| 211 | 3300009177 | Ga0105248_10010483 | Ga0105248_100104834 | 365 |
| 212 | 3300013104 | Ga0157370_10030757 | Ga0157370_100307572 | 365 |
| 213 | 3300013105 | Ga0157369_10000797 | Ga0157369_1000079714 | 365 |
| 214 | 3300013105 | Ga0157369_10001259 | Ga0157369_1000125912 | 365 |
| 215 | 3300013105 | Ga0157369_10006845 | Ga0157369_100068455 | 365 |
| 216 | 3300013105 | Ga0157369_10134630 | Ga0157369_101346303 | 365 |
| 217 | 3300014497 | Ga0182008_10009520 | Ga0182008_100095203 | 365 |
| 218 | 3300014745 | Ga0157377_10011044 | Ga0157377_100110444 | 365 |
| 219 | 3300015261 | Ga0182006_1017598 | Ga0182006_10175984 | 365 |
| 220 | 3300015262 | Ga0182007_10000452 | Ga0182007_100004523 | 365 |
| 221 | 3300015688 | Ga0183367_1010 | Ga0183367_1010123 | 365 |
| 222 | 3300020069 | Ga0197907_11404546 | Ga0197907_114045461 | 365 |
| 223 | 3300021384 | Ga0213876_10006394 | Ga0213876_100063942 | 365 |
| 224 | 3300022467 | Ga0224712_10001361 | Ga0224712_100013614 | 365 |
| 225 | 3300022467 | Ga0224712_10012653 | Ga0224712_100126531 | 365 |
| 226 | 3300022467 | Ga0224712_10021624 | Ga0224712_100216243 | 365 |
| 227 | 3300025297 | Ga0209758_1005153 | Ga0209758_10051536 | 365 |
| 228 | 3300025302 | Ga0207426_1001268 | Ga0207426_100126811 | 365 |
| 229 | 3300025302 | Ga0207426_1004436 | Ga0207426_10044361 | 365 |
| 230 | 3300025904 | Ga0207647_10022572 | Ga0207647_100225724 | 365 |
| 231 | 3300025909 | Ga0207705_10002817 | Ga0207705_100028175 | 365 |
| 232 | 3300025912 | Ga0207707_10000046 | Ga0207707_1000004621 | 365 |
| 233 | 3300025912 | Ga0207707_10009881 | Ga0207707_100098815 | 365 |
| 234 | 3300025912 | Ga0207707_10037765 | Ga0207707_100377653 | 365 |
| 235 | 3300025917 | Ga0207660_10014899 | Ga0207660_100148993 | 365 |
| 236 | 3300025917 | Ga0207660_10038256 | Ga0207660_100382563 | 365 |
| 237 | 3300025921 | Ga0207652_10000476 | Ga0207652_1000047618 | 365 |
| 238 | 3300025921 | Ga0207652_10004930 | Ga0207652_100049304 | 365 |
| 239 | 3300025921 | Ga0207652_10047772 | Ga0207652_100477722 | 365 |
| 240 | 3300025921 | Ga0207652_10083477 | Ga0207652_100834773 | 365 |
| 241 | 3300025921 | Ga0207652_10172600 | Ga0207652_101726001 | 365 |
| 242 | 3300025926 | Ga0207659_10068490 | Ga0207659_100684901 | 365 |
| 243 | 3300025927 | Ga0207687_10010426 | Ga0207687_100104261 | 365 |
| 244 | 3300025928 | Ga0207700_10162100 | Ga0207700_101621001 | 365 |
| 245 | 3300025929 | Ga0207664_10107762 | Ga0207664_101077622 | 365 |
| 246 | 3300025932 | Ga0207690_10003378 | Ga0207690_1000337812 | 365 |
| 247 | 3300025932 | Ga0207690_10012941 | Ga0207690_100129413 | 365 |
| 248 | 3300025941 | Ga0207711_10013844 | Ga0207711_100138446 | 365 |
| 249 | 3300025942 | Ga0207689_10146692 | Ga0207689_101466922 | 365 |
| 250 | 3300025944 | Ga0207661_10188027 | Ga0207661_101880272 | 365 |
| 251 | 3300025945 | Ga0207679_10011196 | Ga0207679_100111961 | 365 |
| 252 | 3300025945 | Ga0207679_10050619 | Ga0207679_100506192 | 365 |
| 253 | 3300025986 | Ga0207658_10028698 | Ga0207658_100286982 | 365 |
| 254 | 3300026041 | Ga0207639_10068393 | Ga0207639_100683933 | 365 |
| 255 | 3300026067 | Ga0207678_10006576 | Ga0207678_100065761 | 365 |
| 256 | 3300026075 | Ga0207708_10004217 | Ga0207708_100042179 | 365 |
| 257 | 3300026088 | Ga0207641_10030774 | Ga0207641_100307742 | 365 |
| 258 | 3300026095 | Ga0207676_10005136 | Ga0207676_100051365 | 365 |
| 259 | 3300026116 | Ga0207674_10063479 | Ga0207674_100634792 | 365 |
| 260 | 3300026116 | Ga0207674_10098062 | Ga0207674_100980621 | 365 |
| 261 | 3300028380 | Ga0268265_10009045 | Ga0268265_100090454 | 365 |
| 262 | 3300028786 | Ga0307517_10003570 | Ga0307517_1000357012 | 365 |
| 263 | 3300028786 | Ga0307517_10005410 | Ga0307517_1000541015 | 365 |
| 264 | 3300028786 | Ga0307517_10039990 | Ga0307517_100399901 | 365 |
| 265 | 3300028794 | Ga0307515_10001087 | Ga0307515_1000108727 | 365 |
| 266 | 3300030521 | Ga0307511_10000282 | Ga0307511_1000028220 | 365 |
| 267 | 3300030521 | Ga0307511_10091360 | Ga0307511_100913602 | 365 |
| 268 | 3300030522 | Ga0307512_10014964 | Ga0307512_100149646 | 365 |
| 269 | 3300030522 | Ga0307512_10039142 | Ga0307512_100391423 | 365 |
| 270 | 3300031247 | Ga0265340_10002237 | Ga0265340_100022374 | 365 |
| 271 | 3300031249 | Ga0265339_10013488 | Ga0265339_100134884 | 365 |
| 272 | 3300031456 | Ga0307513_10006824 | Ga0307513_1000682412 | 365 |
| 273 | 3300031456 | Ga0307513_10035790 | Ga0307513_100357904 | 365 |
| 274 | 3300031456 | Ga0307513_10176198 | Ga0307513_101761983 | 365 |
| 275 | 3300031507 | Ga0307509_10016697 | Ga0307509_100166976 | 365 |
| 276 | 3300031507 | Ga0307509_10139245 | Ga0307509_101392453 | 365 |
| 277 | 3300031548 | Ga0307408_100336260 | Ga0307408_1003362601 | 365 |
| 278 | 3300031616 | Ga0307508_10001243 | Ga0307508_100012433 | 365 |
| 279 | 3300031616 | Ga0307508_10015356 | Ga0307508_100153564 | 365 |
| 280 | 3300031616 | Ga0307508_10058552 | Ga0307508_100585524 | 365 |
| 281 | 3300031649 | Ga0307514_10027494 | Ga0307514_100274944 | 365 |
| 282 | 3300031649 | Ga0307514_10036069 | Ga0307514_100360692 | 365 |
| 283 | 3300031649 | Ga0307514_10060802 | Ga0307514_100608022 | 365 |
| 284 | 3300031711 | Ga0265314_10011525 | Ga0265314_100115257 | 365 |
| 285 | 3300031730 | Ga0307516_10003084 | Ga0307516_100030845 | 365 |
| 286 | 3300031730 | Ga0307516_10021330 | Ga0307516_100213306 | 365 |
| 287 | 3300031730 | Ga0307516_10235486 | Ga0307516_102354862 | 365 |
| 288 | 3300031838 | Ga0307518_10099359 | Ga0307518_100993592 | 365 |
| 289 | 3300031901 | Ga0307406_10135860 | Ga0307406_101358601 | 365 |
| 290 | 3300032126 | Ga0307415_100206981 | Ga0307415_1002069811 | 365 |
| 291 | 3300033179 | Ga0307507_10008521 | Ga0307507_100085219 | 365 |
| 292 | 3300033179 | Ga0307507_10019733 | Ga0307507_100197336 | 365 |
| 293 | 3300033179 | Ga0307507_10141589 | Ga0307507_101415892 | 365 |
| 294 | 3300037418 | Ga0395900_0071364 | Ga0395900_0071364_1181_2350 | 365 |
| 295 | 3300037418 | Ga0395900_0205680 | Ga0395900_0205680_119_1270 | 365 |
| 296 | 3300037466 | Ga0395898_0004976 | Ga0395898_0004976_584_1735 | 365 |
| 297 | 3300037466 | Ga0395898_0021170 | Ga0395898_0021170_4470_5639 | 365 |
| 298 | 3300037466 | Ga0395898_0263558 | Ga0395898_0263558_417_1568 | 365 |
| 299 | 3300037471 | Ga0395905_0139086 | Ga0395905_0139086_934_2085 | 365 |
| 300 | 3300038443 | Ga0395901_0345221 | Ga0395901_0345221_183_1334 | 365 |
| 301 | 3300041404 | Ga0439436_0000159 | Ga0439436_0000159_7016_8170 | 365 |
| 302 | 3300041404 | Ga0439436_0009288 | Ga0439436_0009288_732_1883 | 365 |
| 303 | 3300041406 | Ga0439439_0010796 | Ga0439439_0010796_1010_2164 | 365 |
| 304 | 3300041494 | Ga0451837_0453485 | Ga0451837_0453485_1531_2682 | 365 |
| 305 | 3300041512 | Ga0451853_0935397 | Ga0451853_0935397_5212_6396 | 365 |
| 306 | 3300041512 | Ga0451853_1587670 | Ga0451853_1587670_454_1605 | 365 |
| 307 | 3300041999 | Ga0439433_0000913 | Ga0439433_0000913_1603_2757 | 365 |
| 308 | 3300042007 | Ga0439449_0013141 | Ga0439449_0013141_1846_3009 | 365 |
| 309 | 3300042007 | Ga0439449_0013610 | Ga0439449_0013610_725_1876 | 365 |
| 310 | 3300042007 | Ga0439449_0068526 | Ga0439449_0068526_139_1290 | 365 |
| 311 | 3300042014 | Ga0439457_000263 | Ga0439457_000263_11041_12192 | 365 |
| 312 | 3300042014 | Ga0439457_002603 | Ga0439457_002603_2660_3814 | 365 |
| 313 | 3300042015 | Ga0439462_0001954 | Ga0439462_0001954_1359_2513 | 365 |
| 314 | 3300042131 | Ga0450894_000378 | Ga0450894_000378_3865_5043 | 365 |
| 315 | 3300042138 | Ga0450903_000983 | Ga0450903_000983_3018_4172 | 365 |
| 316 | 3300042145 | Ga0450906_005131 | Ga0450906_005131_703_1881 | 365 |
| 317 | 3300042157 | Ga0439458_0000204 | Ga0439458_0000204_1663_2817 | 365 |
| 318 | 3300044656 | Ga0466969_0000268 | Ga0466969_0000268_24884_26038 | 365 |
| 319 | 3300044656 | Ga0466969_0039827 | Ga0466969_0039827_519_1670 | 365 |
| 320 | 3300044658 | Ga0466972_0000495 | Ga0466972_0000495_8448_9602 | 365 |
| 321 | 3300044658 | Ga0466972_0000971 | Ga0466972_0000971_3286_4437 | 365 |
| 322 | 3300044658 | Ga0466972_0001897 | Ga0466972_0001897_458_1609 | 365 |
| 323 | 3300044683 | Ga0466965_0022592 | Ga0466965_0022592_1800_2951 | 365 |
| 324 | 3300044683 | Ga0466965_0068095 | Ga0466965_0068095_614_1768 | 365 |
| 325 | 3300044684 | Ga0466966_0000145 | Ga0466966_0000145_11244_12395 | 365 |
| 326 | 3300044684 | Ga0466966_0001445 | Ga0466966_0001445_571_1737 | 365 |
| 327 | 3300044684 | Ga0466966_0014381 | Ga0466966_0014381_3667_4818 | 365 |
| 328 | 3300044684 | Ga0466966_0029450 | Ga0466966_0029450_17_1168 | 365 |
| 329 | 3300044684 | Ga0466966_0074316 | Ga0466966_0074316_820_1980 | 365 |
| 330 | 3300044693 | Ga0466961_0009105 | Ga0466961_0009105_2298_3452 | 365 |
| 331 | 3300044693 | Ga0466961_0011089 | Ga0466961_0011089_2681_3841 | 365 |
| 332 | 3300044693 | Ga0466961_0013752 | Ga0466961_0013752_3824_4975 | 365 |
| 333 | 3300044693 | Ga0466961_0031701 | Ga0466961_0031701_2185_3336 | 365 |
| 334 | 3300044693 | Ga0466961_0139543 | Ga0466961_0139543_281_1432 | 365 |
| 335 | 3300044694 | Ga0466963_0000450 | Ga0466963_0000450_7502_8653 | 365 |
| 336 | 3300044694 | Ga0466963_0014540 | Ga0466963_0014540_737_1888 | 365 |
| 337 | 3300044694 | Ga0466963_0041362 | Ga0466963_0041362_1108_2259 | 365 |
| 338 | 3300044694 | Ga0466963_0239455 | Ga0466963_0239455_15_1163 | 365 |
| 339 | 3300044706 | Ga0466964_0026164 | Ga0466964_0026164_396_1547 | 365 |
| 340 | 3300044719 | Ga0466971_0003865 | Ga0466971_0003865_5229_6383 | 365 |
| 341 | 3300044735 | Ga0466968_0061639 | Ga0466968_0061639_68_1222 | 365 |
| 342 | 3300044735 | Ga0466968_0062737 | Ga0466968_0062737_334_1485 | 365 |
| 343 | 3300044765 | Ga0466970_0000074 | Ga0466970_0000074_11057_12208 | 365 |
| 344 | 3300044765 | Ga0466970_0029557 | Ga0466970_0029557_420_1571 | 365 |
| 345 | 3300044842 | Ga0466957_0000836 | Ga0466957_0000836_11245_12396 | 365 |
| 346 | 3300044842 | Ga0466957_0128395 | Ga0466957_0128395_382_1542 | 365 |
| 347 | 3300044842 | Ga0466957_0163547 | Ga0466957_0163547_262_1413 | 365 |
| 348 | 3300045049 | Ga0466959_0000333 | Ga0466959_0000333_5399_6553 | 365 |
| 349 | 3300045049 | Ga0466959_0002100 | Ga0466959_0002100_8302_9453 | 365 |
| 350 | 3300045049 | Ga0466959_0048750 | Ga0466959_0048750_219_1379 | 365 |
| 351 | 3300045049 | Ga0466959_0054598 | Ga0466959_0054598_698_1864 | 365 |
| 352 | 3300045836 | Ga0466958_0007432 | Ga0466958_0007432_1599_2750 | 365 |
| 353 | 3300045836 | Ga0466958_0008579 | Ga0466958_0008579_4511_5662 | 365 |
| 354 | 3300045976 | Ga0466967_0002290 | Ga0466967_0002290_5444_6595 | 365 |
| 355 | 3300045976 | Ga0466967_0039524 | Ga0466967_0039524_2753_3922 | 365 |
| 356 | 3300045976 | Ga0466967_0087328 | Ga0466967_0087328_104_1258 | 365 |
| 357 | 3300045976 | Ga0466967_0225050 | Ga0466967_0225050_505_1653 | 365 |
| 358 | 3300045976 | Ga0466967_0278352 | Ga0466967_0278352_392_1540 | 365 |
| 359 | 3300045976 | Ga0466967_0455207 | Ga0466967_0455207_42_1193 | 365 |
| 360 | 3300046454 | Ga0495592_0024366 | Ga0495592_0024366_86_1261 | 365 |
| 361 | 3300046454 | Ga0495592_0037816 | Ga0495592_0037816_142_1293 | 365 |
| 362 | 3300046454 | Ga0495592_0074041 | Ga0495592_0074041_243_1394 | 365 |
| 363 | 3300046455 | Ga0495603_0000249 | Ga0495603_0000249_13354_14505 | 365 |
| 364 | 3300046455 | Ga0495603_0000620 | Ga0495603_0000620_18292_19443 | 365 |
| 365 | 3300046455 | Ga0495603_0002468 | Ga0495603_0002468_6556_7707 | 365 |
| 366 | 3300046455 | Ga0495603_0026352 | Ga0495603_0026352_2174_3325 | 365 |
| 367 | 3300046459 | Ga0495629_0000979 | Ga0495629_0000979_16979_18130 | 365 |
| 368 | 3300046459 | Ga0495629_0001794 | Ga0495629_0001794_15008_16159 | 365 |
| 369 | 3300046459 | Ga0495629_0014394 | Ga0495629_0014394_2544_3692 | 365 |
| 370 | 3300046459 | Ga0495629_0014486 | Ga0495629_0014486_3021_4172 | 365 |
| 371 | 3300046459 | Ga0495629_0067927 | Ga0495629_0067927_388_1539 | 365 |
| 372 | 3300046459 | Ga0495629_0193430 | Ga0495629_0193430_30_1181 | 365 |
| 373 | 3300046460 | Ga0495638_0059315 | Ga0495638_0059315_926_2077 | 365 |
| 374 | 3300046462 | Ga0495651_0001447 | Ga0495651_0001447_15243_16394 | 365 |
| 375 | 3300046462 | Ga0495651_0012696 | Ga0495651_0012696_2051_3226 | 365 |
| 376 | 3300046462 | Ga0495651_0043750 | Ga0495651_0043750_728_1879 | 365 |
| 377 | 3300046462 | Ga0495651_0075849 | Ga0495651_0075849_1379_2527 | 365 |
| 378 | 3300046463 | Ga0495653_0003548 | Ga0495653_0003548_8765_9940 | 365 |
| 379 | 3300046472 | Ga0495580_0137136 | Ga0495580_0137136_102_1277 | 365 |
| 380 | 3300046474 | Ga0495605_0028145 | Ga0495605_0028145_1482_2633 | 365 |
| 381 | 3300046475 | Ga0495639_0005664 | Ga0495639_0005664_3530_4681 | 365 |
| 382 | 3300046476 | Ga0495662_0001123 | Ga0495662_0001123_2612_3787 | 365 |
| 383 | 3300046476 | Ga0495662_0003455 | Ga0495662_0003455_3145_4296 | 365 |
| 384 | 3300046476 | Ga0495662_0008571 | Ga0495662_0008571_3798_4949 | 365 |
| 385 | 3300046476 | Ga0495662_0107750 | Ga0495662_0107750_33_1184 | 365 |
| 386 | 3300046477 | Ga0495664_0000499 | Ga0495664_0000499_6802_7953 | 365 |
| 387 | 3300046477 | Ga0495664_0018107 | Ga0495664_0018107_1975_3150 | 365 |
| 388 | 3300046477 | Ga0495664_0070306 | Ga0495664_0070306_885_2036 | 365 |
| 389 | 3300046492 | Ga0495585_0037860 | Ga0495585_0037860_740_1891 | 365 |
| 390 | 3300046492 | Ga0495585_0046807 | Ga0495585_0046807_1098_2252 | 365 |
| 391 | 3300046499 | Ga0495594_0000261 | Ga0495594_0000261_5486_6637 | 365 |
| 392 | 3300046499 | Ga0495594_0047219 | Ga0495594_0047219_194_1345 | 365 |
| 393 | 3300046499 | Ga0495594_0073909 | Ga0495594_0073909_733_1884 | 365 |
| 394 | 3300046506 | Ga0495583_0023635 | Ga0495583_0023635_471_1622 | 365 |
| 395 | 3300046507 | Ga0495606_0027622 | Ga0495606_0027622_1725_2876 | 365 |
| 396 | 3300046511 | Ga0495608_0002781 | Ga0495608_0002781_2307_3482 | 365 |
| 397 | 3300046512 | Ga0495610_0013445 | Ga0495610_0013445_1571_2722 | 365 |
| 398 | 3300046513 | Ga0495616_0012902 | Ga0495616_0012902_2474_3625 | 365 |
| 399 | 3300046514 | Ga0495618_0056378 | Ga0495618_0056378_856_2007 | 365 |
| 400 | 3300046515 | Ga0495620_0011987 | Ga0495620_0011987_372_1523 | 365 |
| 401 | 3300046516 | Ga0495628_0003340 | Ga0495628_0003340_5096_6256 | 365 |
| 402 | 3300046516 | Ga0495628_0022151 | Ga0495628_0022151_891_2039 | 365 |
| 403 | 3300046516 | Ga0495628_0025047 | Ga0495628_0025047_322_1497 | 365 |
| 404 | 3300046517 | Ga0495630_0199143 | Ga0495630_0199143_30_1181 | 365 |
| 405 | 3300046518 | Ga0495631_0035905 | Ga0495631_0035905_415_1602 | 365 |
| 406 | 3300046520 | Ga0495637_0040882 | Ga0495637_0040882_527_1678 | 365 |
| 407 | 3300046522 | Ga0495643_0006340 | Ga0495643_0006340_871_2025 | 365 |
| 408 | 3300046526 | Ga0495666_0006115 | Ga0495666_0006115_3191_4366 | 365 |
| 409 | 3300046529 | Ga0495652_0000892 | Ga0495652_0000892_2151_3311 | 365 |
| 410 | 3300046529 | Ga0495652_0030856 | Ga0495652_0030856_2079_3230 | 365 |
| 411 | 3300046529 | Ga0495652_0064318 | Ga0495652_0064318_1077_2225 | 365 |
| 412 | 3300046529 | Ga0495652_0220386 | Ga0495652_0220386_92_1267 | 365 |
| 413 | 3300046530 | Ga0495654_0024358 | Ga0495654_0024358_1240_2391 | 365 |
| 414 | 3300046531 | Ga0495665_0008974 | Ga0495665_0008974_507_1682 | 365 |
| 415 | 3300046533 | Ga0495640_0004520 | Ga0495640_0004520_7407_8555 | 365 |
| 416 | 3300046533 | Ga0495640_0020229 | Ga0495640_0020229_1158_2333 | 365 |
| 417 | 3300046533 | Ga0495640_0083231 | Ga0495640_0083231_602_1753 | 365 |
| 418 | 3300046535 | Ga0495586_0047045 | Ga0495586_0047045_359_1534 | 365 |
| 419 | 3300046536 | Ga0495587_0004464 | Ga0495587_0004464_4011_5162 | 365 |
| 420 | 3300046543 | Ga0495645_0012447 | Ga0495645_0012447_278_1444 | 365 |
| 421 | 3300046543 | Ga0495645_0016127 | Ga0495645_0016127_3829_5004 | 365 |
| 422 | 3300046543 | Ga0495645_0099159 | Ga0495645_0099159_180_1331 | 365 |
| 423 | 3300046557 | Ga0495622_0002077 | Ga0495622_0002077_6386_7537 | 365 |
| 424 | 3300046557 | Ga0495622_0007896 | Ga0495622_0007896_2583_3734 | 365 |
| 425 | 3300046616 | Ga0495668_0027143 | Ga0495668_0027143_1597_2748 | 365 |
| 426 | 3300046642 | Ga0495634_0001328 | Ga0495634_0001328_9572_10723 | 365 |
| 427 | 3300046642 | Ga0495634_0016004 | Ga0495634_0016004_3177_4352 | 365 |
| 428 | 3300046648 | Ga0495611_0015679 | Ga0495611_0015679_819_1970 | 365 |
| 429 | 3300046648 | Ga0495611_0027584 | Ga0495611_0027584_124_1275 | 365 |
| 430 | 3300046660 | Ga0495625_0103192 | Ga0495625_0103192_451_1605 | 365 |
| 431 | 3300046663 | Ga0495635_0001469 | Ga0495635_0001469_10532_11692 | 365 |
| 432 | 3300046663 | Ga0495635_0002215 | Ga0495635_0002215_5595_6746 | 365 |
| 433 | 3300046665 | Ga0495661_0063394 | Ga0495661_0063394_124_1275 | 365 |
| 434 | 3300046665 | Ga0495661_0077037 | Ga0495661_0077037_165_1316 | 365 |
| 435 | 3300046674 | Ga0495588_0004421 | Ga0495588_0004421_4875_6026 | 365 |
| 436 | 3300046674 | Ga0495588_0024752 | Ga0495588_0024752_604_1755 | 365 |
| 437 | 3300046675 | Ga0495657_0000341 | Ga0495657_0000341_30989_32140 | 365 |
| 438 | 3300046675 | Ga0495657_0002025 | Ga0495657_0002025_10409_11560 | 365 |
| 439 | 3300046675 | Ga0495657_0024760 | Ga0495657_0024760_950_2098 | 365 |
| 440 | 3300046679 | Ga0495623_0069202 | Ga0495623_0069202_231_1391 | 365 |
| 441 | 3300046679 | Ga0495623_0146910 | Ga0495623_0146910_134_1285 | 365 |
| 442 | 3300046680 | Ga0495646_0001245 | Ga0495646_0001245_10723_11874 | 365 |
| 443 | 3300046680 | Ga0495646_0073353 | Ga0495646_0073353_194_1369 | 365 |
| 444 | 3300046683 | Ga0495658_0041643 | Ga0495658_0041643_48_1202 | 365 |
| 445 | 3300046689 | Ga0495613_0000842 | Ga0495613_0000842_15777_16928 | 365 |
| 446 | 3300046689 | Ga0495613_0003979 | Ga0495613_0003979_2143_3294 | 365 |
| 447 | 3300046689 | Ga0495613_0004789 | Ga0495613_0004789_350_1498 | 365 |
| 448 | 3300046689 | Ga0495613_0007008 | Ga0495613_0007008_5833_6984 | 365 |
| 449 | 3300046690 | Ga0495624_0095970 | Ga0495624_0095970_20_1171 | 365 |
| 450 | 3300046691 | Ga0495670_0054558 | Ga0495670_0054558_510_1661 | 365 |
| 451 | 3300046794 | Ga0495589_0011759 | Ga0495589_0011759_471_1622 | 365 |
| 452 | 3300046794 | Ga0495589_0066936 | Ga0495589_0066936_399_1550 | 365 |
| 453 | 3300046809 | Ga0495600_0019495 | Ga0495600_0019495_1122_2270 | 365 |
| 454 | 3300046810 | Ga0495660_0020458 | Ga0495660_0020458_168_1319 | 365 |
| 455 | 3300046810 | Ga0495660_0028260 | Ga0495660_0028260_1022_2176 | 365 |
| 456 | 3300047315 | Ga0495581_0006660 | Ga0495581_0006660_3447_4598 | 365 |
| 457 | 3300047315 | Ga0495581_0008813 | Ga0495581_0008813_2611_3786 | 365 |
| 458 | 3300047315 | Ga0495581_0109008 | Ga0495581_0109008_141_1295 | 365 |
| 459 | 3300047317 | Ga0495604_0000834 | Ga0495604_0000834_11409_12584 | 365 |
| 460 | 3300047317 | Ga0495604_0001874 | Ga0495604_0001874_11035_12186 | 365 |
| 461 | 3300047317 | Ga0495604_0014104 | Ga0495604_0014104_4896_6044 | 365 |
| 462 | 3300047317 | Ga0495604_0045676 | Ga0495604_0045676_586_1734 | 365 |
| 463 | 3300047317 | Ga0495604_0160596 | Ga0495604_0160596_118_1269 | 365 |
| 464 | 3300047318 | Ga0495636_0003165 | Ga0495636_0003165_2929_4080 | 365 |
| 465 | 3300047318 | Ga0495636_0023554 | Ga0495636_0023554_212_1363 | 365 |
| 466 | 3300047319 | Ga0495674_0037951 | Ga0495674_0037951_2378_3529 | 365 |
| 467 | 3300047319 | Ga0495674_0044486 | Ga0495674_0044486_86_1261 | 365 |
| 468 | 3300047321 | Ga0495676_0001912 | Ga0495676_0001912_7024_8172 | 365 |
| 469 | 3300047321 | Ga0495676_0004554 | Ga0495676_0004554_8879_10030 | 365 |
| 470 | 3300047321 | Ga0495676_0007813 | Ga0495676_0007813_4051_5202 | 365 |
| 471 | 3300047321 | Ga0495676_0009089 | Ga0495676_0009089_4818_5969 | 365 |
| 472 | 3300047321 | Ga0495676_0016804 | Ga0495676_0016804_3154_4305 | 365 |
| 473 | 3300047321 | Ga0495676_0019906 | Ga0495676_0019906_4701_5852 | 365 |
| 474 | 3300047323 | Ga0495683_0001149 | Ga0495683_0001149_7116_8267 | 365 |
| 475 | 3300047443 | Ga0495687_002083 | Ga0495687_002083_2460_3611 | 365 |
| 476 | 3300047443 | Ga0495687_007522 | Ga0495687_007522_3731_4882 | 365 |
| 477 | 3300047444 | Ga0495675_0001288 | Ga0495675_0001288_10355_11506 | 365 |
| 478 | 3300047444 | Ga0495675_0016249 | Ga0495675_0016249_2269_3435 | 365 |
| 479 | 3300047444 | Ga0495675_0027886 | Ga0495675_0027886_1962_3113 | 365 |
| 480 | 3300047445 | Ga0495677_0018294 | Ga0495677_0018294_431_1582 | 365 |
| 481 | 3300047447 | Ga0495685_005434 | Ga0495685_005434_1884_3038 | 365 |
| 482 | 3300047447 | Ga0495685_009962 | Ga0495685_009962_341_1492 | 365 |
| 483 | 3300047447 | Ga0495685_019455 | Ga0495685_019455_609_1760 | 365 |
| 484 | 3300047470 | Ga0495681_0000784 | Ga0495681_0000784_1090_2244 | 365 |
| 485 | 3300047471 | Ga0495684_0134492 | Ga0495684_0134492_452_1603 | 365 |
| 486 | 3300047472 | Ga0495686_0022730 | Ga0495686_0022730_2090_3244 | 365 |
| 487 | 3300047472 | Ga0495686_0073250 | Ga0495686_0073250_895_2046 | 365 |
| 488 | 3300047673 | Ga0495593_0101375 | Ga0495593_0101375_85_1260 | 365 |
| 489 | 3300048088 | Ga0495602_0064187 | Ga0495602_0064187_683_1834 | 365 |
| 490 | 3300048089 | Ga0495614_0000263 | Ga0495614_0000263_5122_6273 | 365 |
| 491 | 3300048089 | Ga0495614_0022889 | Ga0495614_0022889_42_1193 | 365 |
| 492 | 3300048089 | Ga0495614_0042812 | Ga0495614_0042812_398_1549 | 365 |
| 493 | 3300048089 | Ga0495614_0043722 | Ga0495614_0043722_652_1803 | 365 |
| 494 | 3300048091 | Ga0495626_0011502 | Ga0495626_0011502_895_2046 | 365 |
| 495 | 3300048907 | Ga0496104_0016807 | Ga0496104_0016807_2625_3809 | 365 |
| 496 | 3300048911 | Ga0496108_0008951 | Ga0496108_0008951_1382_2566 | 365 |
| 497 | 3300048911 | Ga0496108_0077432 | Ga0496108_0077432_1388_2539 | 365 |
| 498 | 3300048918 | Ga0496115_0071010 | Ga0496115_0071010_1016_2176 | 365 |
| 499 | 3300048928 | Ga0496125_0221430 | Ga0496125_0221430_24_1175 | 365 |
| 500 | 3300048929 | Ga0496126_0115936 | Ga0496126_0115936_842_2002 | 365 |
| 501 | 3300049568 | Ga0501031_0022792 | Ga0501031_0022792_1852_3024 | 365 |
| 502 | 3300049568 | Ga0501031_0062569 | Ga0501031_0062569_1248_2399 | 365 |
| 503 | 3300049568 | Ga0501031_0130617 | Ga0501031_0130617_322_1473 | 365 |
| 504 | 3300049569 | Ga0501032_0047688 | Ga0501032_0047688_693_1844 | 365 |
| 505 | 3300049569 | Ga0501032_0114438 | Ga0501032_0114438_450_1610 | 365 |
| 506 | 3300049570 | Ga0501033_0000179 | Ga0501033_0000179_8050_9204 | 365 |
| 507 | 3300049570 | Ga0501033_0003654 | Ga0501033_0003654_9444_10664 | 365 |
| 508 | 3300049571 | Ga0501034_0009370 | Ga0501034_0009370_5097_6248 | 365 |
| 509 | 3300049571 | Ga0501034_0069294 | Ga0501034_0069294_1538_2689 | 365 |
| 510 | 3300049571 | Ga0501034_0158204 | Ga0501034_0158204_1061_2212 | 365 |
| 511 | 3300049571 | Ga0501034_0248612 | Ga0501034_0248612_469_1629 | 365 |
| 512 | 3300049572 | Ga0501036_0000451 | Ga0501036_0000451_3972_5126 | 365 |
| 513 | 3300049572 | Ga0501036_0003493 | Ga0501036_0003493_1779_2933 | 365 |
| 514 | 3300049572 | Ga0501036_0024200 | Ga0501036_0024200_720_1871 | 365 |
| 515 | 3300049572 | Ga0501036_0049706 | Ga0501036_0049706_1028_2176 | 365 |
| 516 | 3300049572 | Ga0501036_0102607 | Ga0501036_0102607_215_1429 | 365 |
| 517 | 3300049573 | Ga0501037_0006301 | Ga0501037_0006301_7499_8650 | 365 |
| 518 | 3300049573 | Ga0501037_0014154 | Ga0501037_0014154_2159_3307 | 365 |
| 519 | 3300049573 | Ga0501037_0067776 | Ga0501037_0067776_886_2034 | 365 |
| 520 | 3300049574 | Ga0501038_0049134 | Ga0501038_0049134_234_1385 | 365 |
| 521 | 3300049574 | Ga0501038_0069384 | Ga0501038_0069384_1583_2731 | 365 |
| 522 | 3300049574 | Ga0501038_0081832 | Ga0501038_0081832_794_1954 | 365 |
| 523 | 3300049575 | Ga0501039_0001059 | Ga0501039_0001059_15996_17150 | 365 |
| 524 | 3300049575 | Ga0501039_0037612 | Ga0501039_0037612_1853_3004 | 365 |
| 525 | 3300049579 | Ga0501043_0001254 | Ga0501043_0001254_11681_12835 | 365 |
| 526 | 3300049579 | Ga0501043_0007676 | Ga0501043_0007676_35_1186 | 365 |
| 527 | 3300049579 | Ga0501043_0027047 | Ga0501043_0027047_2210_3361 | 365 |
| 528 | 3300049579 | Ga0501043_0110655 | Ga0501043_0110655_647_1807 | 365 |
| 529 | 3300049580 | Ga0501046_0015692 | Ga0501046_0015692_1150_2301 | 365 |
| 530 | 3300049581 | Ga0501047_0000118 | Ga0501047_0000118_4561_5709 | 365 |
| 531 | 3300049581 | Ga0501047_0083511 | Ga0501047_0083511_163_1317 | 365 |
| 532 | 3300049585 | Ga0501069_0014865 | Ga0501069_0014865_2571_3722 | 365 |
| 533 | 3300049586 | Ga0501070_0001293 | Ga0501070_0001293_9572_10726 | 365 |
| 534 | 3300049586 | Ga0501070_0002439 | Ga0501070_0002439_11822_12973 | 365 |
| 535 | 3300049586 | Ga0501070_0010595 | Ga0501070_0010595_3993_5189 | 365 |
| 536 | 3300049586 | Ga0501070_0037540 | Ga0501070_0037540_1160_2311 | 365 |
| 537 | 3300049586 | Ga0501070_0055842 | Ga0501070_0055842_2065_3216 | 365 |
| 538 | 3300049589 | Ga0501073_0051291 | Ga0501073_0051291_639_1790 | 365 |
| 539 | 3300049590 | Ga0501074_0000165 | Ga0501074_0000165_17584_18735 | 365 |
| 540 | 3300049590 | Ga0501074_0007204 | Ga0501074_0007204_3381_4535 | 365 |
| 541 | 3300049741 | Ga0501079_0000028 | Ga0501079_0000028_19005_20156 | 365 |
| 542 | 3300049742 | Ga0501080_0000294 | Ga0501080_0000294_24942_26093 | 365 |
| 543 | 3300049742 | Ga0501080_0132719 | Ga0501080_0132719_881_2032 | 365 |
| 544 | 3300049822 | Ga0501035_0001045 | Ga0501035_0001045_24773_25927 | 365 |
| 545 | 3300049822 | Ga0501035_0006958 | Ga0501035_0006958_2079_3230 | 365 |
| 546 | 3300049822 | Ga0501035_0088176 | Ga0501035_0088176_964_2112 | 365 |
| 547 | 3300049822 | Ga0501035_0134310 | Ga0501035_0134310_884_2104 | 365 |
| 548 | 3300049822 | Ga0501035_0183113 | Ga0501035_0183113_286_1434 | 365 |
| 549 | 3300049823 | Ga0501044_0001242 | Ga0501044_0001242_9307_10461 | 365 |
| 550 | 3300049823 | Ga0501044_0028991 | Ga0501044_0028991_236_1384 | 365 |
| 551 | 3300049823 | Ga0501044_0061413 | Ga0501044_0061413_1758_2909 | 365 |
| 552 | 3300049823 | Ga0501044_0068230 | Ga0501044_0068230_1309_2460 | 365 |
| 553 | 3300049823 | Ga0501044_0097767 | Ga0501044_0097767_983_2197 | 365 |
| 554 | 3300049824 | Ga0501045_0071795 | Ga0501045_0071795_270_1421 | 365 |
| 555 | 3300050490 | nmdc:mga03n38_56219_c1 | nmdc:mga03n38_56219_c1_529_1683 | 365 |
| 556 | 3300050490 | nmdc:mga03n38_7425_c1 | nmdc:mga03n38_7425_c1_2035_3228 | 365 |
| 557 | 3300050494 | nmdc:mga06z11_10586_c1 | nmdc:mga06z11_10586_c1_1649_2824 | 365 |
| 558 | 3300050507 | nmdc:mga05p37_4281_c1 | nmdc:mga05p37_4281_c1_183_1334 | 365 |
| 559 | 3300050507 | nmdc:mga05p37_744_c1 | nmdc:mga05p37_744_c1_2356_3507 | 365 |
| 560 | 3300050508 | nmdc:mga09592_80_c1 | nmdc:mga09592_80_c1_25494_26645 | 365 |
| 561 | 3300050509 | nmdc:mga0qj67_29_c3 | nmdc:mga0qj67_29_c3_41004_42155 | 365 |
| 562 | 3300050510 | nmdc:mga06r32_2334_c1 | nmdc:mga06r32_2334_c1_8254_9405 | 365 |
| 563 | 3300050511 | nmdc:mga08y16_12126_c1 | nmdc:mga08y16_12126_c1_4993_6144 | 365 |
| 564 | 3300053077 | Ga0495601_0009723 | Ga0495601_0009723_2885_4060 | 365 |
| 565 | 3300053077 | Ga0495601_0031693 | Ga0495601_0031693_1427_2587 | 365 |
| 566 | 3300053077 | Ga0495601_0031798 | Ga0495601_0031798_1513_2673 | 365 |
| 567 | 3300053078 | Ga0495612_0008314 | Ga0495612_0008314_353_1513 | 365 |
| 568 | 3300053078 | Ga0495612_0040311 | Ga0495612_0040311_482_1657 | 365 |
| 569 | 3300053078 | Ga0495612_0047212 | Ga0495612_0047212_263_1423 | 365 |
| 570 | 3300053079 | Ga0500610_0043468 | Ga0500610_0043468_762_1913 | 365 |
| 571 | 3300053084 | Ga0495595_0041276 | Ga0495595_0041276_208_1362 | 365 |
| 572 | 3300053086 | Ga0500578_0021682 | Ga0500578_0021682_890_2044 | 365 |
| 573 | 3300053094 | Ga0500566_0052521 | Ga0500566_0052521_369_1523 | 365 |
| 574 | 3300053098 | Ga0500650_0068384 | Ga0500650_0068384_360_1511 | 365 |
| 575 | 3300053099 | Ga0500654_021317 | Ga0500654_021317_2325_3479 | 365 |
| 576 | 3300053109 | Ga0500569_002102 | Ga0500569_002102_2473_3627 | 365 |
| 577 | 3300053129 | Ga0500628_001701 | Ga0500628_001701_2132_3286 | 365 |
| 578 | 3300053131 | Ga0500652_005085 | Ga0500652_005085_802_1956 | 365 |
| 579 | 3300053134 | Ga0500658_0023806 | Ga0500658_0023806_141_1295 | 365 |
| 580 | 3300053136 | Ga0500559_0055245 | Ga0500559_0055245_490_1641 | 365 |
| 581 | 3300053140 | Ga0500573_0023718 | Ga0500573_0023718_2284_3435 | 365 |
| 582 | 3300053149 | Ga0500600_0021395 | Ga0500600_0021395_840_1994 | 365 |
| 583 | 3300053161 | Ga0500634_0027117 | Ga0500634_0027117_813_1967 | 365 |
| 584 | 3300053732 | Ga0500656_001145 | Ga0500656_001145_935_2089 | 365 |
| 585 | 3300061719 | Ga0466962_0011950 | Ga0466962_0011950_1308_2468 | 365 |
| 586 | iso_pu_bacteria | 2947224130 | 2947231596 | 365 |
| 587 | iso_pu_bacteria | 8056829672 | 8056835472 | 365 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7y0a-assembly1.cif.gz_B | crystal structure of human short-chain acyl-coa dehydrogenase | 0.8942 | 1 | 359 |
| 4l1f-assembly1.cif.gz_A | electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation | 0.8939 | 1 | 360 |
| 2vig-assembly1.cif.gz_A | crystal structure of human short-chain acyl coa dehydrogenase | 0.8925 | 5 | 359 |
| 1buc-assembly1.cif.gz_A | three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii | 0.8903 | 1 | 359 |
| 2d29-assembly1.cif.gz_A | structural study on project id tt0172 from thermus thermophilus hb8 | 0.8896 | 6 | 361 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ebaC01 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.983 | 5 | 118 | 1.10.540.10 |
| 1siqA01 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.9717 | 5 | 120 | 1.10.540.10 |
| 3swoC01 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.9691 | 5 | 120 | 1.10.540.10 |
| 2ix5A01 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.9633 | 5 | 116 | 1.10.540.10 |
| af_A0A1D6ML15_49_182_1.10.540.10 | Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain | 0.9631 | 5 | 116 | 1.10.540.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W1HTL2-F1-model_v4 | Acyl-CoA dehydrogenase family protein | 0.9777 | 1 | 116 |
GO:0003995
GO:0050660 |
| AF-A0A7C5L8T5-F1-model_v4 | Acyl-CoA dehydrogenase family protein | 0.9768 | 1 | 88 |
GO:0003995
GO:0050660 |
| AF-W7DNJ0-F1-model_v4 | Butyryl-CoA dehydrogenase | 0.9759 | 1 | 128 |
GO:0003995
GO:0050660 |
| AF-X1K8M7-F1-model_v4 | Acyl-CoA dehydrogenase/oxidase N-terminal domain-containing protein | 0.9754 | 1 | 193 |
GO:0003995
GO:0050660 |
| AF-A0A7C7L8F3-F1-model_v4 | Acyl-CoA dehydrogenase | 0.9742 | 1 | 238 |
GO:0003995
GO:0050660 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar