F466711

General Info

Members Datasets Scaffolds Average Seq Length
587 367 472 381

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0003654|Ga0501033_0003654_9444_10664
Length 406
Sequence MYVFQDPSRIPSPDPFFLWGDRVVNLELSEEQAAVRKLARDFVQREIAPHVVTWDRAEEVDRGIVKKLGEVGFLGLTVDEEYGGSGGDHLAYCLVTEELGRGDSSVRGIVSVSLGLVAKTIAAWGSEEHKRRWLPGLTSGEYVGCFGLTEPGTGSDAGNLATRAVRDGDDYVVNGTKMFITNGTWADVVLLFARSTDAPGHKGVSAFLVPTDTPGLTRRTIHGKLGLRGQATAELVLEDVRVPASAMLGEEGKGFSVAMSALAKGRMSVAAGCVGIAQAALDAAVRYAGEREQFGKPIARHQLVQELISDIAVDVDAARLLTWRVADLIDRGRPFAVEASKAKLFASEAAVRAANNALQVFGGYGYIDEYPAGKLLRDARVMTLYEGTSQIQKLLIGRALTGVSAF

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
5 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
6 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
7 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
8 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
9 2643221548 Streptomyces sp. Root55 Isolate Unclassified
10 2643221561 Nocardioides sp. Root151 Isolate Unclassified
11 2643221578 Streptomyces sp. Root63 Isolate Unclassified
12 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
13 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
14 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
15 2643221647 Streptomyces sp. Root369 Isolate Unclassified
16 2643221670 Streptomyces sp. Root431 Isolate Unclassified
17 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
18 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
19 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
20 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
21 2643221696 Nocardioides sp. Root140 Isolate Unclassified
22 2643221714 Streptomyces sp. Root264 Isolate Unclassified
23 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
24 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
25 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
26 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
27 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
28 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
29 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
30 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
31 2808606448 Streptomyces sp. 193411 Isolate Unclassified
32 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
33 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
34 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
35 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
36 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
37 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
38 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
39 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
40 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
41 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
42 2858882152 Micromonospora noduli MED15 Isolate Nodule
43 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
44 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
45 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
46 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
47 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
48 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
49 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
50 2862574272 Streptomyces sp. AcE210 Isolate Nodule
51 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
52 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
53 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
54 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
55 2867428634 Streptomyces sp. RP5T Isolate Unclassified
56 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
57 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
58 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
59 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
60 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
61 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
62 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
63 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
64 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
65 2902582711 Micromonospora sp. AP08 Isolate Unclassified
66 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
67 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
68 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
69 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
70 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
71 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
72 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
73 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
74 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
75 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
76 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
77 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
78 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
79 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
80 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
81 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
82 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
83 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
84 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
85 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
86 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
87 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
88 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
89 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
90 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
91 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
92 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
93 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
94 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
95 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
96 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
97 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
98 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
99 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
100 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
101 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
102 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
105 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
106 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
107 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
108 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
109 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
110 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
111 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
112 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
113 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
114 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
115 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
116 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
117 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
118 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
119 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
120 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
121 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
126 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
127 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
128 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
129 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
130 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
131 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
132 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
133 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
134 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
135 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
136 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
137 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
139 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
140 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
141 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
142 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
146 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
147 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
148 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
149 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
150 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
152 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
155 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
182 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
189 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
205 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
206 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
207 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
208 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
209 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
210 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
211 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
212 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
213 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
214 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
215 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
216 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
219 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
222 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
229 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
230 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
231 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
232 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
233 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
234 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
235 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
242 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
254 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
255 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
256 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
257 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
258 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
259 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
274 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
275 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
276 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
277 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
278 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
289 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
292 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
293 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
296 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
316 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
317 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
318 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
319 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
320 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
327 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
328 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
329 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
330 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
331 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
332 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
333 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
336 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
337 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
338 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
339 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
340 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
341 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
342 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
343 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
344 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
347 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
348 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
349 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
350 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
353 649633069 Micromonospora sp. L5 Isolate Unclassified
354 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
355 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
356 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
357 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
358 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
359 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
360 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
361 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
362 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
363 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
364 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
365 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
366 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
367 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.73
Metatranscriptomes 0.68
Isolates 19.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.11
Nodule 1.7
Rhizoplane 0.85
Rhizosphere 75.13
Stem 0
Stem Tuber 0
Unclassified 17.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1004106 3300000549 Bacteria 1912
2 rootH1_10103301 3300003323 Bacteria 1770
3 JGI25160J50197_1001531 3300003354 Bacteria 11459
4 JGI25160J50197_1030167 3300003354 Bacteria 1418
5 Ga0070658_10000119 3300005327 Bacteria 71128
6 Ga0070658_10057917 3300005327 Bacteria 3152
7 Ga0070683_100249931 3300005329 Bacteria 1686
8 Ga0068869_100010444 3300005334 Bacteria 6056
9 Ga0070680_100002813 3300005336 Bacteria 12926
10 Ga0070680_100009686 3300005336 Bacteria 7413
11 Ga0070680_100017571 3300005336 Bacteria 5642
12 Ga0070682_100015997 3300005337 Bacteria 4356
13 Ga0068868_100005935 3300005338 Bacteria 8613
14 Ga0070675_100005903 3300005354 Bacteria 9379
15 Ga0070659_100000362 3300005366 Bacteria 34592
16 Ga0070659_100070943 3300005366 Bacteria 2769
17 Ga0070667_100040284 3300005367 Bacteria 3917
18 Ga0070700_100002714 3300005441 Bacteria 9040
19 Ga0070663_100025915 3300005455 Bacteria 3964
20 Ga0070681_10000019 3300005458 Bacteria 124774
21 Ga0070681_10006281 3300005458 Bacteria 11550
22 Ga0070681_10065801 3300005458 Bacteria 3593
23 Ga0070679_100000124 3300005530 Bacteria 61752
24 Ga0070679_100000682 3300005530 Bacteria 29067
25 Ga0070679_100005641 3300005530 Bacteria 11598
26 Ga0070679_100103121 3300005530 Bacteria 2839
27 Ga0070679_100252217 3300005530 Bacteria 1721
28 Ga0070684_100003816 3300005535 Bacteria 11392
29 Ga0070684_100037123 3300005535 Bacteria 4177
30 Ga0070684_100046732 3300005535 Bacteria 3751
31 Ga0070684_100053783 3300005535 Bacteria 3506
32 Ga0068853_100094369 3300005539 Bacteria 2636
33 Ga0070686_100161823 3300005544 Bacteria 1577
34 Ga0070665_100013343 3300005548 Bacteria 8269
35 Ga0070664_100000100 3300005564 Bacteria 55301
36 Ga0070664_100049645 3300005564 Bacteria 3549
37 Ga0068857_100009331 3300005577 Bacteria 8518
38 Ga0068857_100033789 3300005577 Bacteria 4523
39 Ga0068852_100204933 3300005616 Bacteria 1868
40 Ga0068864_100010902 3300005618 Bacteria 7513
41 Ga0068863_100062362 3300005841 Bacteria 3526
42 Ga0068860_100167387 3300005843 Bacteria 2122
43 Ga0068862_100046380 3300005844 Bacteria 3708
44 Ga0081455_10158684 3300005937 Bacteria 1736
45 Ga0075363_100008141 3300006048 Bacteria 4866
46 Ga0075363_100081479 3300006048 Bacteria 1770
47 Ga0075367_10011098 3300006178 Bacteria 4753
48 Ga0075428_100000024 3300006844 Bacteria 126990
49 Ga0075428_100019778 3300006844 Bacteria 7452
50 Ga0075430_100046437 3300006846 Bacteria 3668
51 Ga0075431_100042782 3300006847 Bacteria 4673
52 Ga0075429_100012244 3300006880 Bacteria 7439
53 Ga0099826_10049770 3300006948 Bacteria 2824
54 Ga0105251_10009316 3300009011 Bacteria 5808
55 Ga0105250_10028753 3300009092 Bacteria 2237
56 Ga0111539_10003076 3300009094 Bacteria 22107
57 Ga0105245_10006014 3300009098 Bacteria 10666
58 Ga0114129_10000004 3300009147 Bacteria 160944
59 Ga0114129_10019772 3300009147 Bacteria 9586
60 Ga0105243_10096713 3300009148 Bacteria 2443
61 Ga0105242_10239555 3300009176 Bacteria 1630
62 Ga0105248_10010483 3300009177 Bacteria 10207
63 Ga0157370_10030757 3300013104 Bacteria 5259
64 Ga0157369_10000797 3300013105 Bacteria 40264
65 Ga0157369_10001259 3300013105 Bacteria 31492
66 Ga0157369_10006845 3300013105 Bacteria 13153
67 Ga0157369_10134630 3300013105 Bacteria 2617
68 Ga0182008_10009520 3300014497 Bacteria 5239
69 Ga0157377_10011044 3300014745 Bacteria 4493
70 Ga0182006_1017598 3300015261 Bacteria 3034
71 Ga0182007_10000452 3300015262 Bacteria 24843
72 Ga0183367_1010 3300015688 Bacteria 416164
73 Ga0197907_11404546 3300020069 Bacteria 2956
74 Ga0213876_10006394 3300021384 Bacteria 6425
75 Ga0224712_10001361 3300022467 Bacteria 5592
76 Ga0224712_10012653 3300022467 Bacteria 2661
77 Ga0224712_10021624 3300022467 Bacteria 2204
78 Ga0209758_1005153 3300025297 Bacteria 10293
79 Ga0207426_1001268 3300025302 Bacteria 22033
80 Ga0207426_1003219 3300025302 Bacteria 9171
81 Ga0207426_1004436 3300025302 Bacteria 6848
82 Ga0207647_10022572 3300025904 Bacteria 4177
83 Ga0207705_10002817 3300025909 Bacteria 13293
84 Ga0207707_10000046 3300025912 Bacteria 119404
85 Ga0207707_10009881 3300025912 Bacteria 8272
86 Ga0207707_10037765 3300025912 Bacteria 4220
87 Ga0207660_10014899 3300025917 Bacteria 5125
88 Ga0207660_10038256 3300025917 Bacteria 3348
89 Ga0207660_10210023 3300025917 Bacteria 1524
90 Ga0207662_10066230 3300025918 Bacteria 2176
91 Ga0207652_10000476 3300025921 Bacteria 41111
92 Ga0207652_10004930 3300025921 Bacteria 10801
93 Ga0207652_10047772 3300025921 Bacteria 3657
94 Ga0207652_10083477 3300025921 Bacteria 2797
95 Ga0207652_10172600 3300025921 Bacteria 1941
96 Ga0207659_10068490 3300025926 Bacteria 2581
97 Ga0207687_10010426 3300025927 Bacteria 6072
98 Ga0207700_10162100 3300025928 Bacteria 1858
99 Ga0207664_10107762 3300025929 Bacteria 2312
100 Ga0207690_10003378 3300025932 Bacteria 9539
101 Ga0207690_10012941 3300025932 Bacteria 5000
102 Ga0207711_10013844 3300025941 Bacteria 6698
103 Ga0207689_10146692 3300025942 Bacteria 1944
104 Ga0207661_10188027 3300025944 Bacteria 1809
105 Ga0207679_10011196 3300025945 Bacteria 5796
106 Ga0207679_10050619 3300025945 Bacteria 3036
107 Ga0207658_10028698 3300025986 Bacteria 3922
108 Ga0207639_10068393 3300026041 Bacteria 2768
109 Ga0207678_10006576 3300026067 Bacteria 10305
110 Ga0207708_10004217 3300026075 Bacteria 10578
111 Ga0207641_10030774 3300026088 Bacteria 4447
112 Ga0207676_10005136 3300026095 Bacteria 9265
113 Ga0207674_10063479 3300026116 Bacteria 3728
114 Ga0207674_10098062 3300026116 Bacteria 2915
115 Ga0268266_10033635 3300028379 Bacteria 4358
116 Ga0268265_10009045 3300028380 Bacteria 6735
117 Ga0307517_10003570 3300028786 Bacteria 24142
118 Ga0307517_10005410 3300028786 Bacteria 19253
119 Ga0307517_10039990 3300028786 Bacteria 5127
120 Ga0307515_10001087 3300028794 Bacteria 62233
121 Ga0307515_10020750 3300028794 Bacteria 11696
122 Ga0307515_10066744 3300028794 Bacteria 4977
123 Ga0307511_10000282 3300030521 Bacteria 53455
124 Ga0307511_10091360 3300030521 Bacteria 2061
125 Ga0307512_10014964 3300030522 Bacteria 7211
126 Ga0307512_10039142 3300030522 Bacteria 3976
127 Ga0265340_10002237 3300031247 Bacteria 11064
128 Ga0265339_10013488 3300031249 Bacteria 4949
129 Ga0307513_10006824 3300031456 Bacteria 14878
130 Ga0307513_10025742 3300031456 Bacteria 6805
131 Ga0307513_10035790 3300031456 Bacteria 5550
132 Ga0307513_10176198 3300031456 Bacteria 2008
133 Ga0307509_10016697 3300031507 Bacteria 8483
134 Ga0307509_10139245 3300031507 Bacteria 2366
135 Ga0307509_10169170 3300031507 Bacteria 2068
136 Ga0307408_100336260 3300031548 Bacteria 1277
137 Ga0307508_10001243 3300031616 Bacteria 29109
138 Ga0307508_10015356 3300031616 Bacteria 6976
139 Ga0307508_10019777 3300031616 Bacteria 6118
140 Ga0307508_10058552 3300031616 Bacteria 3408
141 Ga0307514_10027494 3300031649 Bacteria 4595
142 Ga0307514_10029836 3300031649 Bacteria 4381
143 Ga0307514_10036069 3300031649 Bacteria 3931
144 Ga0307514_10040163 3300031649 Bacteria 3690
145 Ga0307514_10046386 3300031649 Bacteria 3395
146 Ga0307514_10060802 3300031649 Bacteria 2879
147 Ga0265314_10011525 3300031711 Bacteria 7285
148 Ga0307516_10003084 3300031730 Bacteria 21689
149 Ga0307516_10011369 3300031730 Bacteria 9681
150 Ga0307516_10021330 3300031730 Bacteria 6670
151 Ga0307516_10235486 3300031730 Bacteria 1532
152 Ga0307518_10001044 3300031838 Bacteria 20736
153 Ga0307518_10099359 3300031838 Bacteria 2085
154 Ga0307406_10135860 3300031901 Bacteria 1733
155 Ga0307415_100206981 3300032126 Bacteria 1562
156 Ga0307507_10008521 3300033179 Bacteria 14130
157 Ga0307507_10019733 3300033179 Bacteria 7582
158 Ga0307507_10141589 3300033179 Bacteria 1842
159 Ga0373956_0002696 3300035119 Bacteria 7187
160 Ga0395900_0071364 3300037418 Bacteria 3570
161 Ga0395900_0205680 3300037418 Bacteria 1990
162 Ga0395898_0004976 3300037466 Bacteria 14419
163 Ga0395898_0021170 3300037466 Bacteria 6596
164 Ga0395898_0263558 3300037466 Bacteria 1644
165 Ga0395905_0139086 3300037471 Bacteria 2285
166 Ga0395901_0345221 3300038443 Bacteria 1537
167 Ga0436365_1038027 3300039437 Bacteria 15589
168 Ga0439436_0000159 3300041404 Bacteria 15810
169 Ga0439436_0009288 3300041404 Bacteria 3014
170 Ga0439439_0010796 3300041406 Bacteria 2189
171 Ga0451837_0453485 3300041494 Bacteria 3065
172 Ga0451853_0935397 3300041512 Bacteria 6526
173 Ga0451853_1587670 3300041512 Bacteria 3020
174 Ga0439433_0000913 3300041999 Bacteria 5890
175 Ga0439449_0013141 3300042007 Bacteria 3115
176 Ga0439449_0013610 3300042007 Bacteria 3061
177 Ga0439449_0068526 3300042007 Bacteria 1308
178 Ga0439457_000263 3300042014 Bacteria 14393
179 Ga0439457_002603 3300042014 Bacteria 5098
180 Ga0439462_0001954 3300042015 Bacteria 4713
181 Ga0450894_000378 3300042131 Bacteria 7710
182 Ga0450903_000983 3300042138 Bacteria 5481
183 Ga0450906_005131 3300042145 Bacteria 2713
184 Ga0439458_0000204 3300042157 Bacteria 13742
185 Ga0466969_0000268 3300044656 Bacteria 28572
186 Ga0466969_0039827 3300044656 Bacteria 2358
187 Ga0466972_0000495 3300044658 Bacteria 19814
188 Ga0466972_0000971 3300044658 Bacteria 13812
189 Ga0466972_0001897 3300044658 Bacteria 10264
190 Ga0466965_0022592 3300044683 Bacteria 3033
191 Ga0466965_0068095 3300044683 Bacteria 1787
192 Ga0466966_0000145 3300044684 Bacteria 45112
193 Ga0466966_0001445 3300044684 Bacteria 15254
194 Ga0466966_0014381 3300044684 Bacteria 5239
195 Ga0466966_0029450 3300044684 Bacteria 3572
196 Ga0466966_0074316 3300044684 Bacteria 2124
197 Ga0466961_0009105 3300044693 Bacteria 6327
198 Ga0466961_0011089 3300044693 Bacteria 5761
199 Ga0466961_0013752 3300044693 Bacteria 5187
200 Ga0466961_0031701 3300044693 Bacteria 3399
201 Ga0466961_0139543 3300044693 Bacteria 1518
202 Ga0466963_0000450 3300044694 Bacteria 19035
203 Ga0466963_0014540 3300044694 Bacteria 4855
204 Ga0466963_0041362 3300044694 Bacteria 3023
205 Ga0466963_0239455 3300044694 Bacteria 1272
206 Ga0466964_0026164 3300044706 Bacteria 2283
207 Ga0466971_0003865 3300044719 Bacteria 6423
208 Ga0466968_0061639 3300044735 Bacteria 1618
209 Ga0466968_0062737 3300044735 Bacteria 1605
210 Ga0466968_0088794 3300044735 Bacteria 1367
211 Ga0466970_0000074 3300044765 Bacteria 40311
212 Ga0466970_0029557 3300044765 Bacteria 2886
213 Ga0466957_0000836 3300044842 Bacteria 15738
214 Ga0466957_0123788 3300044842 Bacteria 1650
215 Ga0466957_0128395 3300044842 Bacteria 1622
216 Ga0466957_0163547 3300044842 Bacteria 1446
217 Ga0466959_0000333 3300045049 Bacteria 27831
218 Ga0466959_0002100 3300045049 Bacteria 12603
219 Ga0466959_0048750 3300045049 Bacteria 3112
220 Ga0466959_0054598 3300045049 Bacteria 2918
221 Ga0466958_0007432 3300045836 Bacteria 6028
222 Ga0466958_0008579 3300045836 Bacteria 5673
223 Ga0466967_0002290 3300045976 Bacteria 11819
224 Ga0466967_0039524 3300045976 Bacteria 4056
225 Ga0466967_0087328 3300045976 Bacteria 2827
226 Ga0466967_0225050 3300045976 Bacteria 1784
227 Ga0466967_0278352 3300045976 Bacteria 1605
228 Ga0466967_0455207 3300045976 Bacteria 1251
229 Ga0495592_0024366 3300046454 Bacteria 4601
230 Ga0495592_0037816 3300046454 Bacteria 3632
231 Ga0495592_0074041 3300046454 Bacteria 2474
232 Ga0495603_0000249 3300046455 Bacteria 28144
233 Ga0495603_0000620 3300046455 Bacteria 19882
234 Ga0495603_0002468 3300046455 Bacteria 10877
235 Ga0495603_0026352 3300046455 Bacteria 3512
236 Ga0495629_0000979 3300046459 Bacteria 22914
237 Ga0495629_0001794 3300046459 Bacteria 16817
238 Ga0495629_0014394 3300046459 Bacteria 5690
239 Ga0495629_0014486 3300046459 Bacteria 5673
240 Ga0495629_0067927 3300046459 Bacteria 2487
241 Ga0495629_0193430 3300046459 Bacteria 1407
242 Ga0495638_0059315 3300046460 Bacteria 2370
243 Ga0495651_0001447 3300046462 Bacteria 18379
244 Ga0495651_0012696 3300046462 Bacteria 6501
245 Ga0495651_0043750 3300046462 Bacteria 3473
246 Ga0495651_0075849 3300046462 Bacteria 2548
247 Ga0495653_0003548 3300046463 Bacteria 12565
248 Ga0495580_0137136 3300046472 Bacteria 1696
249 Ga0495605_0028145 3300046474 Bacteria 2903
250 Ga0495639_0005664 3300046475 Bacteria 5374
251 Ga0495662_0001123 3300046476 Bacteria 13186
252 Ga0495662_0003455 3300046476 Bacteria 8003
253 Ga0495662_0008571 3300046476 Bacteria 5024
254 Ga0495662_0107750 3300046476 Bacteria 1364
255 Ga0495664_0000499 3300046477 Bacteria 19552
256 Ga0495664_0018107 3300046477 Bacteria 4029
257 Ga0495664_0070306 3300046477 Bacteria 2090
258 Ga0495585_0037860 3300046492 Bacteria 2716
259 Ga0495585_0046807 3300046492 Bacteria 2411
260 Ga0495594_0000261 3300046499 Bacteria 25780
261 Ga0495594_0047219 3300046499 Bacteria 2364
262 Ga0495594_0073909 3300046499 Bacteria 1898
263 Ga0495583_0023635 3300046506 Bacteria 3105
264 Ga0495606_0004181 3300046507 Bacteria 14633
265 Ga0495606_0027622 3300046507 Bacteria 4019
266 Ga0495608_0002781 3300046511 Bacteria 12555
267 Ga0495610_0013445 3300046512 Bacteria 4864
268 Ga0495616_0012902 3300046513 Bacteria 4726
269 Ga0495618_0056378 3300046514 Bacteria 2488
270 Ga0495620_0011987 3300046515 Bacteria 4501
271 Ga0495628_0003340 3300046516 Bacteria 14356
272 Ga0495628_0022151 3300046516 Bacteria 5222
273 Ga0495628_0025047 3300046516 Bacteria 4878
274 Ga0495630_0199143 3300046517 Bacteria 1528
275 Ga0495631_0035905 3300046518 Bacteria 2215
276 Ga0495637_0040882 3300046520 Bacteria 1993
277 Ga0495643_0006340 3300046522 Bacteria 7810
278 Ga0495666_0006115 3300046526 Bacteria 6055
279 Ga0495652_0000892 3300046529 Bacteria 34341
280 Ga0495652_0030856 3300046529 Bacteria 4697
281 Ga0495652_0064318 3300046529 Bacteria 3085
282 Ga0495652_0220386 3300046529 Bacteria 1426
283 Ga0495654_0024358 3300046530 Bacteria 3128
284 Ga0495665_0008974 3300046531 Bacteria 5425
285 Ga0495640_0004520 3300046533 Bacteria 11094
286 Ga0495640_0020229 3300046533 Bacteria 4901
287 Ga0495640_0049766 3300046533 Bacteria 2888
288 Ga0495640_0083231 3300046533 Bacteria 2123
289 Ga0495586_0047045 3300046535 Bacteria 2327
290 Ga0495587_0004464 3300046536 Bacteria 9213
291 Ga0495645_0012447 3300046543 Bacteria 5996
292 Ga0495645_0016127 3300046543 Bacteria 5325
293 Ga0495645_0099159 3300046543 Bacteria 2073
294 Ga0495622_0002077 3300046557 Bacteria 9788
295 Ga0495622_0007896 3300046557 Bacteria 4937
296 Ga0495668_0000173 3300046616 Bacteria 95830
297 Ga0495668_0027143 3300046616 Bacteria 3244
298 Ga0495634_0001328 3300046642 Bacteria 22523
299 Ga0495634_0016004 3300046642 Bacteria 5372
300 Ga0495611_0015679 3300046648 Bacteria 3239
301 Ga0495611_0027584 3300046648 Bacteria 2483
302 Ga0495625_0001016 3300046660 Bacteria 37004
303 Ga0495625_0103192 3300046660 Bacteria 1956
304 Ga0495635_0001469 3300046663 Bacteria 15761
305 Ga0495635_0002215 3300046663 Bacteria 13224
306 Ga0495661_0063394 3300046665 Bacteria 2185
307 Ga0495661_0077037 3300046665 Bacteria 1933
308 Ga0495588_0004421 3300046674 Bacteria 6213
309 Ga0495588_0024752 3300046674 Bacteria 2985
310 Ga0495657_0000341 3300046675 Bacteria 43007
311 Ga0495657_0002025 3300046675 Bacteria 17266
312 Ga0495657_0024760 3300046675 Bacteria 4269
313 Ga0495623_0069202 3300046679 Bacteria 2200
314 Ga0495623_0146910 3300046679 Bacteria 1397
315 Ga0495646_0001245 3300046680 Bacteria 14951
316 Ga0495646_0073353 3300046680 Bacteria 2010
317 Ga0495658_0041643 3300046683 Bacteria 2560
318 Ga0495613_0000842 3300046689 Bacteria 23673
319 Ga0495613_0003979 3300046689 Bacteria 11060
320 Ga0495613_0004789 3300046689 Bacteria 10153
321 Ga0495613_0007008 3300046689 Bacteria 8396
322 Ga0495624_0095970 3300046690 Bacteria 1827
323 Ga0495670_0054558 3300046691 Bacteria 2003
324 Ga0495589_0011759 3300046794 Bacteria 4540
325 Ga0495589_0017555 3300046794 Bacteria 3672
326 Ga0495589_0066936 3300046794 Bacteria 1758
327 Ga0495600_0019495 3300046809 Bacteria 4331
328 Ga0495660_0020458 3300046810 Bacteria 3793
329 Ga0495660_0028260 3300046810 Bacteria 3170
330 Ga0495581_0006660 3300047315 Bacteria 6694
331 Ga0495581_0008813 3300047315 Bacteria 5839
332 Ga0495581_0109008 3300047315 Bacteria 1610
333 Ga0495604_0000834 3300047317 Bacteria 25747
334 Ga0495604_0001874 3300047317 Bacteria 17091
335 Ga0495604_0014104 3300047317 Bacteria 6371
336 Ga0495604_0045676 3300047317 Bacteria 3417
337 Ga0495604_0047567 3300047317 Bacteria 3340
338 Ga0495604_0160596 3300047317 Bacteria 1588
339 Ga0495636_0003165 3300047318 Bacteria 6380
340 Ga0495636_0023554 3300047318 Bacteria 2493
341 Ga0495674_0037951 3300047319 Bacteria 4328
342 Ga0495674_0044486 3300047319 Bacteria 3947
343 Ga0495676_0001912 3300047321 Bacteria 18285
344 Ga0495676_0004554 3300047321 Bacteria 12682
345 Ga0495676_0007813 3300047321 Bacteria 9812
346 Ga0495676_0009089 3300047321 Bacteria 9064
347 Ga0495676_0016804 3300047321 Bacteria 6480
348 Ga0495676_0019906 3300047321 Bacteria 5897
349 Ga0495683_0001149 3300047323 Bacteria 18207
350 Ga0495687_002083 3300047443 Bacteria 16813
351 Ga0495687_007176 3300047443 Bacteria 6637
352 Ga0495687_007522 3300047443 Bacteria 6399
353 Ga0495675_0001288 3300047444 Bacteria 15182
354 Ga0495675_0016249 3300047444 Bacteria 4707
355 Ga0495675_0027886 3300047444 Bacteria 3599
356 Ga0495677_0018294 3300047445 Bacteria 2540
357 Ga0495685_005434 3300047447 Bacteria 4161
358 Ga0495685_009962 3300047447 Bacteria 3181
359 Ga0495685_019455 3300047447 Bacteria 2333
360 Ga0495685_044298 3300047447 Bacteria 1517
361 Ga0495681_0000784 3300047470 Bacteria 24436
362 Ga0495684_0134492 3300047471 Bacteria 1856
363 Ga0495686_0022730 3300047472 Bacteria 4146
364 Ga0495686_0073250 3300047472 Bacteria 2104
365 Ga0495593_0101375 3300047673 Bacteria 1476
366 Ga0495602_0064187 3300048088 Bacteria 3177
367 Ga0495614_0000263 3300048089 Bacteria 20482
368 Ga0495614_0022889 3300048089 Bacteria 2693
369 Ga0495614_0042812 3300048089 Bacteria 1941
370 Ga0495614_0043722 3300048089 Bacteria 1921
371 Ga0495626_0000267 3300048091 Bacteria 58992
372 Ga0495626_0011502 3300048091 Bacteria 4680
373 Ga0496104_0016807 3300048907 Bacteria 6649
374 Ga0496108_0008951 3300048911 Bacteria 8111
375 Ga0496108_0077432 3300048911 Bacteria 2813
376 Ga0496109_0103754 3300048912 Bacteria 2639
377 Ga0496115_0071010 3300048918 Bacteria 2824
378 Ga0496125_0221430 3300048928 Bacteria 1219
379 Ga0496126_0115936 3300048929 Bacteria 2328
380 Ga0501031_0022792 3300049568 Bacteria 4082
381 Ga0501031_0062569 3300049568 Bacteria 2425
382 Ga0501031_0130617 3300049568 Bacteria 1641
383 Ga0501032_0047688 3300049569 Bacteria 2892
384 Ga0501032_0114438 3300049569 Bacteria 1784
385 Ga0501033_0000179 3300049570 Bacteria 60544
386 Ga0501033_0003654 3300049570 Bacteria 12543
387 Ga0501034_0009370 3300049571 Bacteria 10259
388 Ga0501034_0069294 3300049571 Bacteria 3538
389 Ga0501034_0158204 3300049571 Bacteria 2238
390 Ga0501034_0248612 3300049571 Bacteria 1723
391 Ga0501036_0000451 3300049572 Bacteria 29280
392 Ga0501036_0003493 3300049572 Bacteria 12563
393 Ga0501036_0024200 3300049572 Bacteria 5118
394 Ga0501036_0049706 3300049572 Bacteria 3551
395 Ga0501036_0102607 3300049572 Bacteria 2419
396 Ga0501037_0006301 3300049573 Bacteria 8677
397 Ga0501037_0014154 3300049573 Bacteria 5873
398 Ga0501037_0067776 3300049573 Bacteria 2598
399 Ga0501038_0049134 3300049574 Bacteria 3648
400 Ga0501038_0069384 3300049574 Bacteria 2994
401 Ga0501038_0081832 3300049574 Bacteria 2720
402 Ga0501039_0001059 3300049575 Bacteria 20182
403 Ga0501039_0037612 3300049575 Bacteria 3736
404 Ga0501043_0001254 3300049579 Bacteria 22385
405 Ga0501043_0007676 3300049579 Bacteria 8545
406 Ga0501043_0027047 3300049579 Bacteria 4502
407 Ga0501043_0110655 3300049579 Bacteria 2157
408 Ga0501046_0015692 3300049580 Bacteria 6359
409 Ga0501047_0000118 3300049581 Bacteria 96347
410 Ga0501047_0083511 3300049581 Bacteria 3070
411 Ga0501069_0014865 3300049585 Bacteria 4168
412 Ga0501069_0240219 3300049585 Bacteria 1055
413 Ga0501070_0001293 3300049586 Bacteria 22462
414 Ga0501070_0002439 3300049586 Bacteria 16306
415 Ga0501070_0010595 3300049586 Bacteria 7792
416 Ga0501070_0037540 3300049586 Bacteria 4043
417 Ga0501070_0055842 3300049586 Bacteria 3273
418 Ga0501073_0051291 3300049589 Bacteria 2890
419 Ga0501074_0000165 3300049590 Bacteria 35249
420 Ga0501074_0007204 3300049590 Bacteria 8032
421 Ga0501076_0276551 3300049592 Bacteria 1375
422 Ga0501079_0000028 3300049741 Bacteria 60671
423 Ga0501080_0000294 3300049742 Bacteria 37892
424 Ga0501080_0132719 3300049742 Bacteria 2305
425 Ga0501035_0001045 3300049822 Bacteria 28960
426 Ga0501035_0006958 3300049822 Bacteria 10563
427 Ga0501035_0088176 3300049822 Bacteria 2734
428 Ga0501035_0134310 3300049822 Bacteria 2155
429 Ga0501035_0183113 3300049822 Bacteria 1804
430 Ga0501044_0001242 3300049823 Bacteria 30258
431 Ga0501044_0028991 3300049823 Bacteria 5839
432 Ga0501044_0061413 3300049823 Bacteria 3844
433 Ga0501044_0068230 3300049823 Bacteria 3622
434 Ga0501044_0097767 3300049823 Bacteria 2956
435 Ga0501045_0071795 3300049824 Bacteria 2548
436 nmdc:mga03n38_56219_c1 3300050490 Bacteria 1775
437 nmdc:mga03n38_7425_c1 3300050490 Bacteria 3880
438 nmdc:mga00v17_76806_c1 3300050491 Bacteria 2078
439 nmdc:mga06z11_10586_c1 3300050494 Bacteria 3938
440 nmdc:mga05p37_4281_c1 3300050507 Bacteria 16670
441 nmdc:mga05p37_744_c1 3300050507 Bacteria 36096
442 nmdc:mga09592_80_c1 3300050508 Bacteria 56013
443 nmdc:mga0qj67_29_c3 3300050509 Bacteria 57362
444 nmdc:mga06r32_2334_c1 3300050510 Bacteria 17005
445 nmdc:mga08y16_12126_c1 3300050511 Bacteria 9056
446 Ga0495601_0009723 3300053077 Bacteria 5687
447 Ga0495601_0031693 3300053077 Bacteria 3286
448 Ga0495601_0031798 3300053077 Bacteria 3281
449 Ga0495612_0008314 3300053078 Bacteria 4212
450 Ga0495612_0040311 3300053078 Bacteria 1902
451 Ga0495612_0047212 3300053078 Bacteria 1764
452 Ga0500610_0043468 3300053079 Bacteria 2328
453 Ga0495595_0041276 3300053084 Bacteria 2111
454 Ga0500578_0021682 3300053086 Bacteria 4126
455 Ga0500646_0000183 3300053090 Bacteria 18755
456 Ga0500583_0005061 3300053092 Bacteria 4375
457 Ga0500566_0052521 3300053094 Bacteria 2328
458 Ga0500650_0068384 3300053098 Bacteria 1660
459 Ga0500654_021317 3300053099 Bacteria 4135
460 Ga0500569_002102 3300053109 Bacteria 3877
461 Ga0500628_001701 3300053129 Bacteria 3714
462 Ga0500652_005085 3300053131 Bacteria 4114
463 Ga0500658_0023806 3300053134 Bacteria 2341
464 Ga0500559_0055245 3300053136 Bacteria 1761
465 Ga0500573_0023718 3300053140 Bacteria 3525
466 Ga0500600_0021395 3300053149 Bacteria 3877
467 Ga0500633_0046139 3300053160 Bacteria 1487
468 Ga0500634_0027117 3300053161 Bacteria 3121
469 Ga0500656_001145 3300053732 Bacteria 2214
470 Ga0501084_0182838 3300054114 Bacteria 1770
471 Ga0466962_0001956 3300061719 Bacteria 9704
472 Ga0466962_0011950 3300061719 Bacteria 4177

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_0103754 Ga0496109_0103754_1647_2615 293
2 3300049585 Ga0501069_0240219 Ga0501069_0240219_24_992 304
3 3300047447 Ga0495685_044298 Ga0495685_044298_479_1507 324
4 3300061719 Ga0466962_0001956 Ga0466962_0001956_8624_9691 337
5 3300039437 Ga0436365_1038027 Ga0436365_1038027_7532_8611 342
6 3300025302 Ga0207426_1003219 Ga0207426_10032196 356
7 iso_pu_bacteria 2582581312 2585296789 356
8 iso_pu_bacteria 2867312974 2867314505 358
9 iso_pu_bacteria 2862382967 2862383104 360
10 iso_pu_bacteria 8008558824 8008561562 360
11 3300028794 Ga0307515_10066744 Ga0307515_100667442 361
12 3300031507 Ga0307509_10169170 Ga0307509_101691702 361
13 3300031616 Ga0307508_10019777 Ga0307508_100197774 361
14 3300031649 Ga0307514_10029836 Ga0307514_100298362 361
15 3300031649 Ga0307514_10040163 Ga0307514_100401633 361
16 3300031730 Ga0307516_10011369 Ga0307516_100113693 361
17 3300046794 Ga0495589_0017555 Ga0495589_0017555_2008_3165 361
18 3300047443 Ga0495687_007176 Ga0495687_007176_1124_2281 361
19 iso_pu_bacteria 2501939600 2501941592 361
20 iso_pu_bacteria 2547132111 2547406745 361
21 iso_pu_bacteria 2554235005 2554259344 361
22 iso_pu_bacteria 2582581314 2585315504 361
23 iso_pu_bacteria 2616644814 2616695884 361
24 iso_pu_bacteria 2616644941 2616900560 361
25 iso_pu_bacteria 2643221548 2643759962 361
26 iso_pu_bacteria 2643221561 2643824976 361
27 iso_pu_bacteria 2643221578 2643904704 361
28 iso_pu_bacteria 2643221587 2643946342 361
29 iso_pu_bacteria 2643221601 2644019521 361
30 iso_pu_bacteria 2643221631 2644180592 361
31 iso_pu_bacteria 2643221670 2644389316 361
32 iso_pu_bacteria 2643221673 2644406030 361
33 iso_pu_bacteria 2643221677 2644434146 361
34 iso_pu_bacteria 2643221682 2644460342 361
35 iso_pu_bacteria 2643221696 2644534716 361
36 iso_pu_bacteria 2772190715 2772646117 361
37 iso_pu_bacteria 2784132148 2784586949 361
38 iso_pu_bacteria 2784746763 2785345485 361
39 iso_pu_bacteria 2802429296 2804849184 361
40 iso_pu_bacteria 2808606448 2809230515 361
41 iso_pu_bacteria 2808606982 2811847180 361
42 iso_pu_bacteria 2811994917 2812478248 361
43 iso_pu_bacteria 2811994917 2812482150 361
44 iso_pu_bacteria 2818991463 2819696625 361
45 iso_pu_bacteria 2818991472 2819739168 361
46 iso_pu_bacteria 2852635781 2852637936 361
47 iso_pu_bacteria 2855670206 2855670748 361
48 iso_pu_bacteria 2855676851 2855677823 361
49 iso_pu_bacteria 2858848962 2858849355 361
50 iso_pu_bacteria 2858882152 2858882488 361
51 iso_pu_bacteria 2858888857 2858894663 361
52 iso_pu_bacteria 2858895516 2858895573 361
53 iso_pu_bacteria 2862178590 2862180462 361
54 iso_pu_bacteria 2862290372 2862294392 361
55 iso_pu_bacteria 2862507626 2862514181 361
56 iso_pu_bacteria 2862574272 2862583455 361
57 iso_pu_bacteria 2863404153 2863406747 361
58 iso_pu_bacteria 2867302475 2867302589 361
59 iso_pu_bacteria 2867319477 2867323331 361
60 iso_pu_bacteria 2869048445 2869051136 361
61 iso_pu_bacteria 2869061728 2869066780 361
62 iso_pu_bacteria 2869068681 2869069647 361
63 iso_pu_bacteria 2873151551 2873157463 361
64 iso_pu_bacteria 2875391855 2875392898 361
65 iso_pu_bacteria 2880489317 2880490862 361
66 iso_pu_bacteria 2880495981 2880501652 361
67 iso_pu_bacteria 2887478801 2887480903 361
68 iso_pu_bacteria 2902582711 2902582921 361
69 iso_pu_bacteria 2912715099 2912722166 361
70 iso_pu_bacteria 2918501144 2918502733 361
71 iso_pu_bacteria 2919713450 2919718694 361
72 iso_pu_bacteria 2929219909 2929223763 361
73 iso_pu_bacteria 2929226422 2929230155 361
74 iso_pu_bacteria 2935390628 2935395830 361
75 iso_pu_bacteria 2946045630 2946051800 361
76 iso_pu_bacteria 2954002825 2954010814 361
77 iso_pu_bacteria 2966598605 2966604176 361
78 iso_pu_bacteria 2990059506 2990062682 361
79 iso_pu_bacteria 2990088156 2990094473 361
80 iso_pu_bacteria 2997451912 2997454100 361
81 iso_pu_bacteria 2997600082 2997601852 361
82 iso_pu_bacteria 3002998708 3003008529 361
83 iso_pu_bacteria 3006486233 3006491530 361
84 iso_pu_bacteria 3006493962 3006495259 361
85 iso_pu_bacteria 649633069 649816050 361
86 iso_pu_bacteria 8003830390 8003834394 361
87 iso_pu_bacteria 8003870546 8003872448 361
88 iso_pu_bacteria 8023623736 8023631606 361
89 iso_pu_bacteria 8025413630 8025413879 361
90 iso_pu_bacteria 8048406513 8048412090 361
91 iso_pu_bacteria 8054704163 8054705884 361
92 iso_pu_bacteria 8054727385 8054728887 361
93 iso_pu_bacteria 8054734606 8054734752 361
94 iso_pu_bacteria 8055412473 8055417695 361
95 iso_pu_bacteria 8056207758 8056209527 361
96 3300028794 Ga0307515_10020750 Ga0307515_100207505 362
97 3300031456 Ga0307513_10025742 Ga0307513_100257422 362
98 3300031649 Ga0307514_10046386 Ga0307514_100463862 362
99 3300031838 Ga0307518_10001044 Ga0307518_100010447 362
100 iso_pu_bacteria 2582581313 2585303818 362
101 iso_pu_bacteria 2643221647 2644268287 362
102 iso_pu_bacteria 2643221678 2644438459 362
103 iso_pu_bacteria 2643221714 2644629261 362
104 iso_pu_bacteria 2784746768 2785367396 362
105 iso_pu_bacteria 2786546132 2786668442 362
106 iso_pu_bacteria 2808606359 2808847901 362
107 iso_pu_bacteria 2808606375 2808918651 362
108 iso_pu_bacteria 2811994879 2812360088 362
109 iso_pu_bacteria 2862281513 2862289393 362
110 iso_pu_bacteria 2867428634 2867430222 362
111 iso_pu_bacteria 2877676314 2877683154 362
112 iso_pu_bacteria 2912723979 2912725886 362
113 iso_pu_bacteria 2919468124 2919473666 362
114 iso_pu_bacteria 2946064051 2946065800 362
115 iso_pu_bacteria 2946072368 2946074144 362
116 iso_pu_bacteria 2954380949 2954388372 362
117 iso_pu_bacteria 2954673503 2954674718 362
118 iso_pu_bacteria 2954682443 2954689415 362
119 iso_pu_bacteria 2954691527 2954699187 362
120 iso_pu_bacteria 2954701450 2954703031 362
121 iso_pu_bacteria 2954711539 2954718139 362
122 iso_pu_bacteria 2954721474 2954728107 362
123 iso_pu_bacteria 2954731030 2954733699 362
124 iso_pu_bacteria 2954740390 2954747004 362
125 iso_pu_bacteria 2954749733 2954752583 362
126 iso_pu_bacteria 2954759201 2954766117 362
127 iso_pu_bacteria 3006393351 3006395287 362
128 iso_pu_bacteria 8008574985 8008580528 362
129 3300005548 Ga0070665_100013343 Ga0070665_1000133435 363
130 3300028379 Ga0268266_10033635 Ga0268266_100336353 363
131 3300044735 Ga0466968_0088794 Ga0466968_0088794_154_1302 363
132 3300046507 Ga0495606_0004181 Ga0495606_0004181_8337_9479 363
133 3300046616 Ga0495668_0000173 Ga0495668_0000173_48971_50113 363
134 3300046660 Ga0495625_0001016 Ga0495625_0001016_16439_17581 363
135 3300048091 Ga0495626_0000267 Ga0495626_0000267_54324_55466 363
136 3300050491 nmdc:mga00v17_76806_c1 nmdc:mga00v17_76806_c1_568_1716 363
137 iso_pu_bacteria 3006321560 3006326000 363
138 iso_pu_bacteria 8003856774 8003861675 363
139 3300025917 Ga0207660_10210023 Ga0207660_102100232 364
140 3300025918 Ga0207662_10066230 Ga0207662_100662302 364
141 3300035119 Ga0373956_0002696 Ga0373956_0002696_3298_4449 364
142 3300044842 Ga0466957_0123788 Ga0466957_0123788_129_1280 364
143 3300046533 Ga0495640_0049766 Ga0495640_0049766_308_1468 364
144 3300047317 Ga0495604_0047567 Ga0495604_0047567_1401_2561 364
145 3300049592 Ga0501076_0276551 Ga0501076_0276551_51_1199 364
146 3300053090 Ga0500646_0000183 Ga0500646_0000183_2755_3906 364
147 3300053092 Ga0500583_0005061 Ga0500583_0005061_1666_2820 364
148 3300053160 Ga0500633_0046139 Ga0500633_0046139_233_1387 364
149 3300054114 Ga0501084_0182838 Ga0501084_0182838_216_1367 364
150 iso_pu_bacteria 2857288857 2857289678 364
151 3300000549 LJQas_1004106 LJQas_10041062 365
152 3300003323 rootH1_10103301 rootH1_101033011 365
153 3300003354 JGI25160J50197_1001531 JGI25160J50197_10015315 365
154 3300003354 JGI25160J50197_1030167 JGI25160J50197_10301671 365
155 3300005327 Ga0070658_10000119 Ga0070658_1000011931 365
156 3300005327 Ga0070658_10057917 Ga0070658_100579173 365
157 3300005329 Ga0070683_100249931 Ga0070683_1002499311 365
158 3300005334 Ga0068869_100010444 Ga0068869_1000104441 365
159 3300005336 Ga0070680_100002813 Ga0070680_10000281315 365
160 3300005336 Ga0070680_100009686 Ga0070680_1000096865 365
161 3300005336 Ga0070680_100017571 Ga0070680_1000175713 365
162 3300005337 Ga0070682_100015997 Ga0070682_1000159972 365
163 3300005338 Ga0068868_100005935 Ga0068868_1000059351 365
164 3300005354 Ga0070675_100005903 Ga0070675_10000590310 365
165 3300005366 Ga0070659_100000362 Ga0070659_10000036223 365
166 3300005366 Ga0070659_100070943 Ga0070659_1000709432 365
167 3300005367 Ga0070667_100040284 Ga0070667_1000402843 365
168 3300005441 Ga0070700_100002714 Ga0070700_1000027142 365
169 3300005455 Ga0070663_100025915 Ga0070663_1000259151 365
170 3300005458 Ga0070681_10000019 Ga0070681_10000019113 365
171 3300005458 Ga0070681_10006281 Ga0070681_100062818 365
172 3300005458 Ga0070681_10065801 Ga0070681_100658016 365
173 3300005530 Ga0070679_100000124 Ga0070679_10000012421 365
174 3300005530 Ga0070679_100000682 Ga0070679_10000068217 365
175 3300005530 Ga0070679_100005641 Ga0070679_1000056415 365
176 3300005530 Ga0070679_100103121 Ga0070679_1001031211 365
177 3300005530 Ga0070679_100252217 Ga0070679_1002522172 365
178 3300005535 Ga0070684_100003816 Ga0070684_1000038161 365
179 3300005535 Ga0070684_100037123 Ga0070684_1000371234 365
180 3300005535 Ga0070684_100046732 Ga0070684_1000467325 365
181 3300005535 Ga0070684_100053783 Ga0070684_1000537832 365
182 3300005539 Ga0068853_100094369 Ga0068853_1000943693 365
183 3300005544 Ga0070686_100161823 Ga0070686_1001618232 365
184 3300005564 Ga0070664_100000100 Ga0070664_10000010042 365
185 3300005564 Ga0070664_100049645 Ga0070664_1000496452 365
186 3300005577 Ga0068857_100009331 Ga0068857_1000093316 365
187 3300005577 Ga0068857_100033789 Ga0068857_1000337892 365
188 3300005616 Ga0068852_100204933 Ga0068852_1002049331 365
189 3300005618 Ga0068864_100010902 Ga0068864_1000109024 365
190 3300005841 Ga0068863_100062362 Ga0068863_1000623624 365
191 3300005843 Ga0068860_100167387 Ga0068860_1001673871 365
192 3300005844 Ga0068862_100046380 Ga0068862_1000463802 365
193 3300005937 Ga0081455_10158684 Ga0081455_101586841 365
194 3300006048 Ga0075363_100008141 Ga0075363_1000081415 365
195 3300006048 Ga0075363_100081479 Ga0075363_1000814792 365
196 3300006178 Ga0075367_10011098 Ga0075367_100110986 365
197 3300006844 Ga0075428_100000024 Ga0075428_100000024110 365
198 3300006844 Ga0075428_100019778 Ga0075428_1000197785 365
199 3300006846 Ga0075430_100046437 Ga0075430_1000464372 365
200 3300006847 Ga0075431_100042782 Ga0075431_1000427822 365
201 3300006880 Ga0075429_100012244 Ga0075429_1000122442 365
202 3300006948 Ga0099826_10049770 Ga0099826_100497701 365
203 3300009011 Ga0105251_10009316 Ga0105251_100093167 365
204 3300009092 Ga0105250_10028753 Ga0105250_100287532 365
205 3300009094 Ga0111539_10003076 Ga0111539_100030769 365
206 3300009098 Ga0105245_10006014 Ga0105245_100060147 365
207 3300009147 Ga0114129_10000004 Ga0114129_1000000426 365
208 3300009147 Ga0114129_10019772 Ga0114129_100197723 365
209 3300009148 Ga0105243_10096713 Ga0105243_100967131 365
210 3300009176 Ga0105242_10239555 Ga0105242_102395552 365
211 3300009177 Ga0105248_10010483 Ga0105248_100104834 365
212 3300013104 Ga0157370_10030757 Ga0157370_100307572 365
213 3300013105 Ga0157369_10000797 Ga0157369_1000079714 365
214 3300013105 Ga0157369_10001259 Ga0157369_1000125912 365
215 3300013105 Ga0157369_10006845 Ga0157369_100068455 365
216 3300013105 Ga0157369_10134630 Ga0157369_101346303 365
217 3300014497 Ga0182008_10009520 Ga0182008_100095203 365
218 3300014745 Ga0157377_10011044 Ga0157377_100110444 365
219 3300015261 Ga0182006_1017598 Ga0182006_10175984 365
220 3300015262 Ga0182007_10000452 Ga0182007_100004523 365
221 3300015688 Ga0183367_1010 Ga0183367_1010123 365
222 3300020069 Ga0197907_11404546 Ga0197907_114045461 365
223 3300021384 Ga0213876_10006394 Ga0213876_100063942 365
224 3300022467 Ga0224712_10001361 Ga0224712_100013614 365
225 3300022467 Ga0224712_10012653 Ga0224712_100126531 365
226 3300022467 Ga0224712_10021624 Ga0224712_100216243 365
227 3300025297 Ga0209758_1005153 Ga0209758_10051536 365
228 3300025302 Ga0207426_1001268 Ga0207426_100126811 365
229 3300025302 Ga0207426_1004436 Ga0207426_10044361 365
230 3300025904 Ga0207647_10022572 Ga0207647_100225724 365
231 3300025909 Ga0207705_10002817 Ga0207705_100028175 365
232 3300025912 Ga0207707_10000046 Ga0207707_1000004621 365
233 3300025912 Ga0207707_10009881 Ga0207707_100098815 365
234 3300025912 Ga0207707_10037765 Ga0207707_100377653 365
235 3300025917 Ga0207660_10014899 Ga0207660_100148993 365
236 3300025917 Ga0207660_10038256 Ga0207660_100382563 365
237 3300025921 Ga0207652_10000476 Ga0207652_1000047618 365
238 3300025921 Ga0207652_10004930 Ga0207652_100049304 365
239 3300025921 Ga0207652_10047772 Ga0207652_100477722 365
240 3300025921 Ga0207652_10083477 Ga0207652_100834773 365
241 3300025921 Ga0207652_10172600 Ga0207652_101726001 365
242 3300025926 Ga0207659_10068490 Ga0207659_100684901 365
243 3300025927 Ga0207687_10010426 Ga0207687_100104261 365
244 3300025928 Ga0207700_10162100 Ga0207700_101621001 365
245 3300025929 Ga0207664_10107762 Ga0207664_101077622 365
246 3300025932 Ga0207690_10003378 Ga0207690_1000337812 365
247 3300025932 Ga0207690_10012941 Ga0207690_100129413 365
248 3300025941 Ga0207711_10013844 Ga0207711_100138446 365
249 3300025942 Ga0207689_10146692 Ga0207689_101466922 365
250 3300025944 Ga0207661_10188027 Ga0207661_101880272 365
251 3300025945 Ga0207679_10011196 Ga0207679_100111961 365
252 3300025945 Ga0207679_10050619 Ga0207679_100506192 365
253 3300025986 Ga0207658_10028698 Ga0207658_100286982 365
254 3300026041 Ga0207639_10068393 Ga0207639_100683933 365
255 3300026067 Ga0207678_10006576 Ga0207678_100065761 365
256 3300026075 Ga0207708_10004217 Ga0207708_100042179 365
257 3300026088 Ga0207641_10030774 Ga0207641_100307742 365
258 3300026095 Ga0207676_10005136 Ga0207676_100051365 365
259 3300026116 Ga0207674_10063479 Ga0207674_100634792 365
260 3300026116 Ga0207674_10098062 Ga0207674_100980621 365
261 3300028380 Ga0268265_10009045 Ga0268265_100090454 365
262 3300028786 Ga0307517_10003570 Ga0307517_1000357012 365
263 3300028786 Ga0307517_10005410 Ga0307517_1000541015 365
264 3300028786 Ga0307517_10039990 Ga0307517_100399901 365
265 3300028794 Ga0307515_10001087 Ga0307515_1000108727 365
266 3300030521 Ga0307511_10000282 Ga0307511_1000028220 365
267 3300030521 Ga0307511_10091360 Ga0307511_100913602 365
268 3300030522 Ga0307512_10014964 Ga0307512_100149646 365
269 3300030522 Ga0307512_10039142 Ga0307512_100391423 365
270 3300031247 Ga0265340_10002237 Ga0265340_100022374 365
271 3300031249 Ga0265339_10013488 Ga0265339_100134884 365
272 3300031456 Ga0307513_10006824 Ga0307513_1000682412 365
273 3300031456 Ga0307513_10035790 Ga0307513_100357904 365
274 3300031456 Ga0307513_10176198 Ga0307513_101761983 365
275 3300031507 Ga0307509_10016697 Ga0307509_100166976 365
276 3300031507 Ga0307509_10139245 Ga0307509_101392453 365
277 3300031548 Ga0307408_100336260 Ga0307408_1003362601 365
278 3300031616 Ga0307508_10001243 Ga0307508_100012433 365
279 3300031616 Ga0307508_10015356 Ga0307508_100153564 365
280 3300031616 Ga0307508_10058552 Ga0307508_100585524 365
281 3300031649 Ga0307514_10027494 Ga0307514_100274944 365
282 3300031649 Ga0307514_10036069 Ga0307514_100360692 365
283 3300031649 Ga0307514_10060802 Ga0307514_100608022 365
284 3300031711 Ga0265314_10011525 Ga0265314_100115257 365
285 3300031730 Ga0307516_10003084 Ga0307516_100030845 365
286 3300031730 Ga0307516_10021330 Ga0307516_100213306 365
287 3300031730 Ga0307516_10235486 Ga0307516_102354862 365
288 3300031838 Ga0307518_10099359 Ga0307518_100993592 365
289 3300031901 Ga0307406_10135860 Ga0307406_101358601 365
290 3300032126 Ga0307415_100206981 Ga0307415_1002069811 365
291 3300033179 Ga0307507_10008521 Ga0307507_100085219 365
292 3300033179 Ga0307507_10019733 Ga0307507_100197336 365
293 3300033179 Ga0307507_10141589 Ga0307507_101415892 365
294 3300037418 Ga0395900_0071364 Ga0395900_0071364_1181_2350 365
295 3300037418 Ga0395900_0205680 Ga0395900_0205680_119_1270 365
296 3300037466 Ga0395898_0004976 Ga0395898_0004976_584_1735 365
297 3300037466 Ga0395898_0021170 Ga0395898_0021170_4470_5639 365
298 3300037466 Ga0395898_0263558 Ga0395898_0263558_417_1568 365
299 3300037471 Ga0395905_0139086 Ga0395905_0139086_934_2085 365
300 3300038443 Ga0395901_0345221 Ga0395901_0345221_183_1334 365
301 3300041404 Ga0439436_0000159 Ga0439436_0000159_7016_8170 365
302 3300041404 Ga0439436_0009288 Ga0439436_0009288_732_1883 365
303 3300041406 Ga0439439_0010796 Ga0439439_0010796_1010_2164 365
304 3300041494 Ga0451837_0453485 Ga0451837_0453485_1531_2682 365
305 3300041512 Ga0451853_0935397 Ga0451853_0935397_5212_6396 365
306 3300041512 Ga0451853_1587670 Ga0451853_1587670_454_1605 365
307 3300041999 Ga0439433_0000913 Ga0439433_0000913_1603_2757 365
308 3300042007 Ga0439449_0013141 Ga0439449_0013141_1846_3009 365
309 3300042007 Ga0439449_0013610 Ga0439449_0013610_725_1876 365
310 3300042007 Ga0439449_0068526 Ga0439449_0068526_139_1290 365
311 3300042014 Ga0439457_000263 Ga0439457_000263_11041_12192 365
312 3300042014 Ga0439457_002603 Ga0439457_002603_2660_3814 365
313 3300042015 Ga0439462_0001954 Ga0439462_0001954_1359_2513 365
314 3300042131 Ga0450894_000378 Ga0450894_000378_3865_5043 365
315 3300042138 Ga0450903_000983 Ga0450903_000983_3018_4172 365
316 3300042145 Ga0450906_005131 Ga0450906_005131_703_1881 365
317 3300042157 Ga0439458_0000204 Ga0439458_0000204_1663_2817 365
318 3300044656 Ga0466969_0000268 Ga0466969_0000268_24884_26038 365
319 3300044656 Ga0466969_0039827 Ga0466969_0039827_519_1670 365
320 3300044658 Ga0466972_0000495 Ga0466972_0000495_8448_9602 365
321 3300044658 Ga0466972_0000971 Ga0466972_0000971_3286_4437 365
322 3300044658 Ga0466972_0001897 Ga0466972_0001897_458_1609 365
323 3300044683 Ga0466965_0022592 Ga0466965_0022592_1800_2951 365
324 3300044683 Ga0466965_0068095 Ga0466965_0068095_614_1768 365
325 3300044684 Ga0466966_0000145 Ga0466966_0000145_11244_12395 365
326 3300044684 Ga0466966_0001445 Ga0466966_0001445_571_1737 365
327 3300044684 Ga0466966_0014381 Ga0466966_0014381_3667_4818 365
328 3300044684 Ga0466966_0029450 Ga0466966_0029450_17_1168 365
329 3300044684 Ga0466966_0074316 Ga0466966_0074316_820_1980 365
330 3300044693 Ga0466961_0009105 Ga0466961_0009105_2298_3452 365
331 3300044693 Ga0466961_0011089 Ga0466961_0011089_2681_3841 365
332 3300044693 Ga0466961_0013752 Ga0466961_0013752_3824_4975 365
333 3300044693 Ga0466961_0031701 Ga0466961_0031701_2185_3336 365
334 3300044693 Ga0466961_0139543 Ga0466961_0139543_281_1432 365
335 3300044694 Ga0466963_0000450 Ga0466963_0000450_7502_8653 365
336 3300044694 Ga0466963_0014540 Ga0466963_0014540_737_1888 365
337 3300044694 Ga0466963_0041362 Ga0466963_0041362_1108_2259 365
338 3300044694 Ga0466963_0239455 Ga0466963_0239455_15_1163 365
339 3300044706 Ga0466964_0026164 Ga0466964_0026164_396_1547 365
340 3300044719 Ga0466971_0003865 Ga0466971_0003865_5229_6383 365
341 3300044735 Ga0466968_0061639 Ga0466968_0061639_68_1222 365
342 3300044735 Ga0466968_0062737 Ga0466968_0062737_334_1485 365
343 3300044765 Ga0466970_0000074 Ga0466970_0000074_11057_12208 365
344 3300044765 Ga0466970_0029557 Ga0466970_0029557_420_1571 365
345 3300044842 Ga0466957_0000836 Ga0466957_0000836_11245_12396 365
346 3300044842 Ga0466957_0128395 Ga0466957_0128395_382_1542 365
347 3300044842 Ga0466957_0163547 Ga0466957_0163547_262_1413 365
348 3300045049 Ga0466959_0000333 Ga0466959_0000333_5399_6553 365
349 3300045049 Ga0466959_0002100 Ga0466959_0002100_8302_9453 365
350 3300045049 Ga0466959_0048750 Ga0466959_0048750_219_1379 365
351 3300045049 Ga0466959_0054598 Ga0466959_0054598_698_1864 365
352 3300045836 Ga0466958_0007432 Ga0466958_0007432_1599_2750 365
353 3300045836 Ga0466958_0008579 Ga0466958_0008579_4511_5662 365
354 3300045976 Ga0466967_0002290 Ga0466967_0002290_5444_6595 365
355 3300045976 Ga0466967_0039524 Ga0466967_0039524_2753_3922 365
356 3300045976 Ga0466967_0087328 Ga0466967_0087328_104_1258 365
357 3300045976 Ga0466967_0225050 Ga0466967_0225050_505_1653 365
358 3300045976 Ga0466967_0278352 Ga0466967_0278352_392_1540 365
359 3300045976 Ga0466967_0455207 Ga0466967_0455207_42_1193 365
360 3300046454 Ga0495592_0024366 Ga0495592_0024366_86_1261 365
361 3300046454 Ga0495592_0037816 Ga0495592_0037816_142_1293 365
362 3300046454 Ga0495592_0074041 Ga0495592_0074041_243_1394 365
363 3300046455 Ga0495603_0000249 Ga0495603_0000249_13354_14505 365
364 3300046455 Ga0495603_0000620 Ga0495603_0000620_18292_19443 365
365 3300046455 Ga0495603_0002468 Ga0495603_0002468_6556_7707 365
366 3300046455 Ga0495603_0026352 Ga0495603_0026352_2174_3325 365
367 3300046459 Ga0495629_0000979 Ga0495629_0000979_16979_18130 365
368 3300046459 Ga0495629_0001794 Ga0495629_0001794_15008_16159 365
369 3300046459 Ga0495629_0014394 Ga0495629_0014394_2544_3692 365
370 3300046459 Ga0495629_0014486 Ga0495629_0014486_3021_4172 365
371 3300046459 Ga0495629_0067927 Ga0495629_0067927_388_1539 365
372 3300046459 Ga0495629_0193430 Ga0495629_0193430_30_1181 365
373 3300046460 Ga0495638_0059315 Ga0495638_0059315_926_2077 365
374 3300046462 Ga0495651_0001447 Ga0495651_0001447_15243_16394 365
375 3300046462 Ga0495651_0012696 Ga0495651_0012696_2051_3226 365
376 3300046462 Ga0495651_0043750 Ga0495651_0043750_728_1879 365
377 3300046462 Ga0495651_0075849 Ga0495651_0075849_1379_2527 365
378 3300046463 Ga0495653_0003548 Ga0495653_0003548_8765_9940 365
379 3300046472 Ga0495580_0137136 Ga0495580_0137136_102_1277 365
380 3300046474 Ga0495605_0028145 Ga0495605_0028145_1482_2633 365
381 3300046475 Ga0495639_0005664 Ga0495639_0005664_3530_4681 365
382 3300046476 Ga0495662_0001123 Ga0495662_0001123_2612_3787 365
383 3300046476 Ga0495662_0003455 Ga0495662_0003455_3145_4296 365
384 3300046476 Ga0495662_0008571 Ga0495662_0008571_3798_4949 365
385 3300046476 Ga0495662_0107750 Ga0495662_0107750_33_1184 365
386 3300046477 Ga0495664_0000499 Ga0495664_0000499_6802_7953 365
387 3300046477 Ga0495664_0018107 Ga0495664_0018107_1975_3150 365
388 3300046477 Ga0495664_0070306 Ga0495664_0070306_885_2036 365
389 3300046492 Ga0495585_0037860 Ga0495585_0037860_740_1891 365
390 3300046492 Ga0495585_0046807 Ga0495585_0046807_1098_2252 365
391 3300046499 Ga0495594_0000261 Ga0495594_0000261_5486_6637 365
392 3300046499 Ga0495594_0047219 Ga0495594_0047219_194_1345 365
393 3300046499 Ga0495594_0073909 Ga0495594_0073909_733_1884 365
394 3300046506 Ga0495583_0023635 Ga0495583_0023635_471_1622 365
395 3300046507 Ga0495606_0027622 Ga0495606_0027622_1725_2876 365
396 3300046511 Ga0495608_0002781 Ga0495608_0002781_2307_3482 365
397 3300046512 Ga0495610_0013445 Ga0495610_0013445_1571_2722 365
398 3300046513 Ga0495616_0012902 Ga0495616_0012902_2474_3625 365
399 3300046514 Ga0495618_0056378 Ga0495618_0056378_856_2007 365
400 3300046515 Ga0495620_0011987 Ga0495620_0011987_372_1523 365
401 3300046516 Ga0495628_0003340 Ga0495628_0003340_5096_6256 365
402 3300046516 Ga0495628_0022151 Ga0495628_0022151_891_2039 365
403 3300046516 Ga0495628_0025047 Ga0495628_0025047_322_1497 365
404 3300046517 Ga0495630_0199143 Ga0495630_0199143_30_1181 365
405 3300046518 Ga0495631_0035905 Ga0495631_0035905_415_1602 365
406 3300046520 Ga0495637_0040882 Ga0495637_0040882_527_1678 365
407 3300046522 Ga0495643_0006340 Ga0495643_0006340_871_2025 365
408 3300046526 Ga0495666_0006115 Ga0495666_0006115_3191_4366 365
409 3300046529 Ga0495652_0000892 Ga0495652_0000892_2151_3311 365
410 3300046529 Ga0495652_0030856 Ga0495652_0030856_2079_3230 365
411 3300046529 Ga0495652_0064318 Ga0495652_0064318_1077_2225 365
412 3300046529 Ga0495652_0220386 Ga0495652_0220386_92_1267 365
413 3300046530 Ga0495654_0024358 Ga0495654_0024358_1240_2391 365
414 3300046531 Ga0495665_0008974 Ga0495665_0008974_507_1682 365
415 3300046533 Ga0495640_0004520 Ga0495640_0004520_7407_8555 365
416 3300046533 Ga0495640_0020229 Ga0495640_0020229_1158_2333 365
417 3300046533 Ga0495640_0083231 Ga0495640_0083231_602_1753 365
418 3300046535 Ga0495586_0047045 Ga0495586_0047045_359_1534 365
419 3300046536 Ga0495587_0004464 Ga0495587_0004464_4011_5162 365
420 3300046543 Ga0495645_0012447 Ga0495645_0012447_278_1444 365
421 3300046543 Ga0495645_0016127 Ga0495645_0016127_3829_5004 365
422 3300046543 Ga0495645_0099159 Ga0495645_0099159_180_1331 365
423 3300046557 Ga0495622_0002077 Ga0495622_0002077_6386_7537 365
424 3300046557 Ga0495622_0007896 Ga0495622_0007896_2583_3734 365
425 3300046616 Ga0495668_0027143 Ga0495668_0027143_1597_2748 365
426 3300046642 Ga0495634_0001328 Ga0495634_0001328_9572_10723 365
427 3300046642 Ga0495634_0016004 Ga0495634_0016004_3177_4352 365
428 3300046648 Ga0495611_0015679 Ga0495611_0015679_819_1970 365
429 3300046648 Ga0495611_0027584 Ga0495611_0027584_124_1275 365
430 3300046660 Ga0495625_0103192 Ga0495625_0103192_451_1605 365
431 3300046663 Ga0495635_0001469 Ga0495635_0001469_10532_11692 365
432 3300046663 Ga0495635_0002215 Ga0495635_0002215_5595_6746 365
433 3300046665 Ga0495661_0063394 Ga0495661_0063394_124_1275 365
434 3300046665 Ga0495661_0077037 Ga0495661_0077037_165_1316 365
435 3300046674 Ga0495588_0004421 Ga0495588_0004421_4875_6026 365
436 3300046674 Ga0495588_0024752 Ga0495588_0024752_604_1755 365
437 3300046675 Ga0495657_0000341 Ga0495657_0000341_30989_32140 365
438 3300046675 Ga0495657_0002025 Ga0495657_0002025_10409_11560 365
439 3300046675 Ga0495657_0024760 Ga0495657_0024760_950_2098 365
440 3300046679 Ga0495623_0069202 Ga0495623_0069202_231_1391 365
441 3300046679 Ga0495623_0146910 Ga0495623_0146910_134_1285 365
442 3300046680 Ga0495646_0001245 Ga0495646_0001245_10723_11874 365
443 3300046680 Ga0495646_0073353 Ga0495646_0073353_194_1369 365
444 3300046683 Ga0495658_0041643 Ga0495658_0041643_48_1202 365
445 3300046689 Ga0495613_0000842 Ga0495613_0000842_15777_16928 365
446 3300046689 Ga0495613_0003979 Ga0495613_0003979_2143_3294 365
447 3300046689 Ga0495613_0004789 Ga0495613_0004789_350_1498 365
448 3300046689 Ga0495613_0007008 Ga0495613_0007008_5833_6984 365
449 3300046690 Ga0495624_0095970 Ga0495624_0095970_20_1171 365
450 3300046691 Ga0495670_0054558 Ga0495670_0054558_510_1661 365
451 3300046794 Ga0495589_0011759 Ga0495589_0011759_471_1622 365
452 3300046794 Ga0495589_0066936 Ga0495589_0066936_399_1550 365
453 3300046809 Ga0495600_0019495 Ga0495600_0019495_1122_2270 365
454 3300046810 Ga0495660_0020458 Ga0495660_0020458_168_1319 365
455 3300046810 Ga0495660_0028260 Ga0495660_0028260_1022_2176 365
456 3300047315 Ga0495581_0006660 Ga0495581_0006660_3447_4598 365
457 3300047315 Ga0495581_0008813 Ga0495581_0008813_2611_3786 365
458 3300047315 Ga0495581_0109008 Ga0495581_0109008_141_1295 365
459 3300047317 Ga0495604_0000834 Ga0495604_0000834_11409_12584 365
460 3300047317 Ga0495604_0001874 Ga0495604_0001874_11035_12186 365
461 3300047317 Ga0495604_0014104 Ga0495604_0014104_4896_6044 365
462 3300047317 Ga0495604_0045676 Ga0495604_0045676_586_1734 365
463 3300047317 Ga0495604_0160596 Ga0495604_0160596_118_1269 365
464 3300047318 Ga0495636_0003165 Ga0495636_0003165_2929_4080 365
465 3300047318 Ga0495636_0023554 Ga0495636_0023554_212_1363 365
466 3300047319 Ga0495674_0037951 Ga0495674_0037951_2378_3529 365
467 3300047319 Ga0495674_0044486 Ga0495674_0044486_86_1261 365
468 3300047321 Ga0495676_0001912 Ga0495676_0001912_7024_8172 365
469 3300047321 Ga0495676_0004554 Ga0495676_0004554_8879_10030 365
470 3300047321 Ga0495676_0007813 Ga0495676_0007813_4051_5202 365
471 3300047321 Ga0495676_0009089 Ga0495676_0009089_4818_5969 365
472 3300047321 Ga0495676_0016804 Ga0495676_0016804_3154_4305 365
473 3300047321 Ga0495676_0019906 Ga0495676_0019906_4701_5852 365
474 3300047323 Ga0495683_0001149 Ga0495683_0001149_7116_8267 365
475 3300047443 Ga0495687_002083 Ga0495687_002083_2460_3611 365
476 3300047443 Ga0495687_007522 Ga0495687_007522_3731_4882 365
477 3300047444 Ga0495675_0001288 Ga0495675_0001288_10355_11506 365
478 3300047444 Ga0495675_0016249 Ga0495675_0016249_2269_3435 365
479 3300047444 Ga0495675_0027886 Ga0495675_0027886_1962_3113 365
480 3300047445 Ga0495677_0018294 Ga0495677_0018294_431_1582 365
481 3300047447 Ga0495685_005434 Ga0495685_005434_1884_3038 365
482 3300047447 Ga0495685_009962 Ga0495685_009962_341_1492 365
483 3300047447 Ga0495685_019455 Ga0495685_019455_609_1760 365
484 3300047470 Ga0495681_0000784 Ga0495681_0000784_1090_2244 365
485 3300047471 Ga0495684_0134492 Ga0495684_0134492_452_1603 365
486 3300047472 Ga0495686_0022730 Ga0495686_0022730_2090_3244 365
487 3300047472 Ga0495686_0073250 Ga0495686_0073250_895_2046 365
488 3300047673 Ga0495593_0101375 Ga0495593_0101375_85_1260 365
489 3300048088 Ga0495602_0064187 Ga0495602_0064187_683_1834 365
490 3300048089 Ga0495614_0000263 Ga0495614_0000263_5122_6273 365
491 3300048089 Ga0495614_0022889 Ga0495614_0022889_42_1193 365
492 3300048089 Ga0495614_0042812 Ga0495614_0042812_398_1549 365
493 3300048089 Ga0495614_0043722 Ga0495614_0043722_652_1803 365
494 3300048091 Ga0495626_0011502 Ga0495626_0011502_895_2046 365
495 3300048907 Ga0496104_0016807 Ga0496104_0016807_2625_3809 365
496 3300048911 Ga0496108_0008951 Ga0496108_0008951_1382_2566 365
497 3300048911 Ga0496108_0077432 Ga0496108_0077432_1388_2539 365
498 3300048918 Ga0496115_0071010 Ga0496115_0071010_1016_2176 365
499 3300048928 Ga0496125_0221430 Ga0496125_0221430_24_1175 365
500 3300048929 Ga0496126_0115936 Ga0496126_0115936_842_2002 365
501 3300049568 Ga0501031_0022792 Ga0501031_0022792_1852_3024 365
502 3300049568 Ga0501031_0062569 Ga0501031_0062569_1248_2399 365
503 3300049568 Ga0501031_0130617 Ga0501031_0130617_322_1473 365
504 3300049569 Ga0501032_0047688 Ga0501032_0047688_693_1844 365
505 3300049569 Ga0501032_0114438 Ga0501032_0114438_450_1610 365
506 3300049570 Ga0501033_0000179 Ga0501033_0000179_8050_9204 365
507 3300049570 Ga0501033_0003654 Ga0501033_0003654_9444_10664 365
508 3300049571 Ga0501034_0009370 Ga0501034_0009370_5097_6248 365
509 3300049571 Ga0501034_0069294 Ga0501034_0069294_1538_2689 365
510 3300049571 Ga0501034_0158204 Ga0501034_0158204_1061_2212 365
511 3300049571 Ga0501034_0248612 Ga0501034_0248612_469_1629 365
512 3300049572 Ga0501036_0000451 Ga0501036_0000451_3972_5126 365
513 3300049572 Ga0501036_0003493 Ga0501036_0003493_1779_2933 365
514 3300049572 Ga0501036_0024200 Ga0501036_0024200_720_1871 365
515 3300049572 Ga0501036_0049706 Ga0501036_0049706_1028_2176 365
516 3300049572 Ga0501036_0102607 Ga0501036_0102607_215_1429 365
517 3300049573 Ga0501037_0006301 Ga0501037_0006301_7499_8650 365
518 3300049573 Ga0501037_0014154 Ga0501037_0014154_2159_3307 365
519 3300049573 Ga0501037_0067776 Ga0501037_0067776_886_2034 365
520 3300049574 Ga0501038_0049134 Ga0501038_0049134_234_1385 365
521 3300049574 Ga0501038_0069384 Ga0501038_0069384_1583_2731 365
522 3300049574 Ga0501038_0081832 Ga0501038_0081832_794_1954 365
523 3300049575 Ga0501039_0001059 Ga0501039_0001059_15996_17150 365
524 3300049575 Ga0501039_0037612 Ga0501039_0037612_1853_3004 365
525 3300049579 Ga0501043_0001254 Ga0501043_0001254_11681_12835 365
526 3300049579 Ga0501043_0007676 Ga0501043_0007676_35_1186 365
527 3300049579 Ga0501043_0027047 Ga0501043_0027047_2210_3361 365
528 3300049579 Ga0501043_0110655 Ga0501043_0110655_647_1807 365
529 3300049580 Ga0501046_0015692 Ga0501046_0015692_1150_2301 365
530 3300049581 Ga0501047_0000118 Ga0501047_0000118_4561_5709 365
531 3300049581 Ga0501047_0083511 Ga0501047_0083511_163_1317 365
532 3300049585 Ga0501069_0014865 Ga0501069_0014865_2571_3722 365
533 3300049586 Ga0501070_0001293 Ga0501070_0001293_9572_10726 365
534 3300049586 Ga0501070_0002439 Ga0501070_0002439_11822_12973 365
535 3300049586 Ga0501070_0010595 Ga0501070_0010595_3993_5189 365
536 3300049586 Ga0501070_0037540 Ga0501070_0037540_1160_2311 365
537 3300049586 Ga0501070_0055842 Ga0501070_0055842_2065_3216 365
538 3300049589 Ga0501073_0051291 Ga0501073_0051291_639_1790 365
539 3300049590 Ga0501074_0000165 Ga0501074_0000165_17584_18735 365
540 3300049590 Ga0501074_0007204 Ga0501074_0007204_3381_4535 365
541 3300049741 Ga0501079_0000028 Ga0501079_0000028_19005_20156 365
542 3300049742 Ga0501080_0000294 Ga0501080_0000294_24942_26093 365
543 3300049742 Ga0501080_0132719 Ga0501080_0132719_881_2032 365
544 3300049822 Ga0501035_0001045 Ga0501035_0001045_24773_25927 365
545 3300049822 Ga0501035_0006958 Ga0501035_0006958_2079_3230 365
546 3300049822 Ga0501035_0088176 Ga0501035_0088176_964_2112 365
547 3300049822 Ga0501035_0134310 Ga0501035_0134310_884_2104 365
548 3300049822 Ga0501035_0183113 Ga0501035_0183113_286_1434 365
549 3300049823 Ga0501044_0001242 Ga0501044_0001242_9307_10461 365
550 3300049823 Ga0501044_0028991 Ga0501044_0028991_236_1384 365
551 3300049823 Ga0501044_0061413 Ga0501044_0061413_1758_2909 365
552 3300049823 Ga0501044_0068230 Ga0501044_0068230_1309_2460 365
553 3300049823 Ga0501044_0097767 Ga0501044_0097767_983_2197 365
554 3300049824 Ga0501045_0071795 Ga0501045_0071795_270_1421 365
555 3300050490 nmdc:mga03n38_56219_c1 nmdc:mga03n38_56219_c1_529_1683 365
556 3300050490 nmdc:mga03n38_7425_c1 nmdc:mga03n38_7425_c1_2035_3228 365
557 3300050494 nmdc:mga06z11_10586_c1 nmdc:mga06z11_10586_c1_1649_2824 365
558 3300050507 nmdc:mga05p37_4281_c1 nmdc:mga05p37_4281_c1_183_1334 365
559 3300050507 nmdc:mga05p37_744_c1 nmdc:mga05p37_744_c1_2356_3507 365
560 3300050508 nmdc:mga09592_80_c1 nmdc:mga09592_80_c1_25494_26645 365
561 3300050509 nmdc:mga0qj67_29_c3 nmdc:mga0qj67_29_c3_41004_42155 365
562 3300050510 nmdc:mga06r32_2334_c1 nmdc:mga06r32_2334_c1_8254_9405 365
563 3300050511 nmdc:mga08y16_12126_c1 nmdc:mga08y16_12126_c1_4993_6144 365
564 3300053077 Ga0495601_0009723 Ga0495601_0009723_2885_4060 365
565 3300053077 Ga0495601_0031693 Ga0495601_0031693_1427_2587 365
566 3300053077 Ga0495601_0031798 Ga0495601_0031798_1513_2673 365
567 3300053078 Ga0495612_0008314 Ga0495612_0008314_353_1513 365
568 3300053078 Ga0495612_0040311 Ga0495612_0040311_482_1657 365
569 3300053078 Ga0495612_0047212 Ga0495612_0047212_263_1423 365
570 3300053079 Ga0500610_0043468 Ga0500610_0043468_762_1913 365
571 3300053084 Ga0495595_0041276 Ga0495595_0041276_208_1362 365
572 3300053086 Ga0500578_0021682 Ga0500578_0021682_890_2044 365
573 3300053094 Ga0500566_0052521 Ga0500566_0052521_369_1523 365
574 3300053098 Ga0500650_0068384 Ga0500650_0068384_360_1511 365
575 3300053099 Ga0500654_021317 Ga0500654_021317_2325_3479 365
576 3300053109 Ga0500569_002102 Ga0500569_002102_2473_3627 365
577 3300053129 Ga0500628_001701 Ga0500628_001701_2132_3286 365
578 3300053131 Ga0500652_005085 Ga0500652_005085_802_1956 365
579 3300053134 Ga0500658_0023806 Ga0500658_0023806_141_1295 365
580 3300053136 Ga0500559_0055245 Ga0500559_0055245_490_1641 365
581 3300053140 Ga0500573_0023718 Ga0500573_0023718_2284_3435 365
582 3300053149 Ga0500600_0021395 Ga0500600_0021395_840_1994 365
583 3300053161 Ga0500634_0027117 Ga0500634_0027117_813_1967 365
584 3300053732 Ga0500656_001145 Ga0500656_001145_935_2089 365
585 3300061719 Ga0466962_0011950 Ga0466962_0011950_1308_2468 365
586 iso_pu_bacteria 2947224130 2947231596 365
587 iso_pu_bacteria 8056829672 8056835472 365

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00441

Acyl-CoA_dh_1

Acyl-CoA dehydrogenase, C-terminal domain

252

401

0.99

PF02771

Acyl-CoA_dh_N

Acyl-CoA dehydrogenase, N-terminal domain

29

141

0.99

PF08028

Acyl-CoA_dh_2

Acyl-CoA dehydrogenase, C-terminal domain

267

390

0.97

PF02770

Acyl-CoA_dh_M

Acyl-CoA dehydrogenase, middle domain

145

240

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7y0a-assembly1.cif.gz_B crystal structure of human short-chain acyl-coa dehydrogenase 0.8942 1 359
4l1f-assembly1.cif.gz_A electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation 0.8939 1 360
2vig-assembly1.cif.gz_A crystal structure of human short-chain acyl coa dehydrogenase 0.8925 5 359
1buc-assembly1.cif.gz_A three-dimensional structure of butyryl-coa dehydrogenase from megasphaera elsdenii 0.8903 1 359
2d29-assembly1.cif.gz_A structural study on project id tt0172 from thermus thermophilus hb8 0.8896 6 361
ID Description Score Start End Superfamily
2ebaC01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.983 5 118 1.10.540.10
1siqA01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9717 5 120 1.10.540.10
3swoC01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9691 5 120 1.10.540.10
2ix5A01 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9633 5 116 1.10.540.10
af_A0A1D6ML15_49_182_1.10.540.10 Mainly Alpha;Orthogonal Bundle;Butyryl-Coa Dehydrogenase, subunit A; domain 1;Acyl-CoA dehydrogenase/oxidase, N-terminal domain 0.9631 5 116 1.10.540.10
ID Description Score Start End GO Terms
AF-A0A7W1HTL2-F1-model_v4 Acyl-CoA dehydrogenase family protein 0.9777 1 116 GO:0003995
GO:0050660
AF-A0A7C5L8T5-F1-model_v4 Acyl-CoA dehydrogenase family protein 0.9768 1 88 GO:0003995
GO:0050660
AF-W7DNJ0-F1-model_v4 Butyryl-CoA dehydrogenase 0.9759 1 128 GO:0003995
GO:0050660
AF-X1K8M7-F1-model_v4 Acyl-CoA dehydrogenase/oxidase N-terminal domain-containing protein 0.9754 1 193 GO:0003995
GO:0050660
AF-A0A7C7L8F3-F1-model_v4 Acyl-CoA dehydrogenase 0.9742 1 238 GO:0003995
GO:0050660

Feature Viewer

pLDDT pTM Quality
82.55 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map